Activation of t-cells with mutant g-csfr

Abstract

Provided for herein are particles or compositions comprising one or more nucleic acid molecules encoding for a chimeric antigen receptor (CAR) and / or a polypeptide comprising i) a ligand binding extracellular domain (ECD), ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD and ICD, polypeptides comprising the same, and nucleic acid molecules encoding for the same. Also provided for herein are compositions comprising the same, and methods of using the same. Also provided for herein are viral particles comprising the same.

Description

[0001]DOCKET NO: INH-023WO PATENT ACTIVATION OF T-CELLS WITH MUTANT G-CSFR RELATED APPLICATIONS This application claims the benefit of U.S. Provisional Application Ser. No. 63 / 508,055 filed June 14, 2023 and U.S. Provisional Application Ser. No. 63 / 510,745 filed June 28, 2023, each of which are hereby incorporated by referenced in their entirety. REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on June 5, 2024, is named “INH-023WO_SL.xml” and is 146,320 bytes in size. FIELD Embodiments provided herein relate to mutant G-CSFR constructs and methods of using the same. Embodiments provided herein also relate to viral particles comprising a heterologous viral glycoprotein, a targeting moiety and a nucleic acid molecule encoding for a heterologous molecule of interest. In some embodiments, the nucleic acid molecule encodes for a chimeric antigen receptor and the mutant G-CSFR. Embodiments provided herein further relate to compositions comprising the viral particles provided for herein and methods of using the same. BACKGROUND Chimeric antigen receptor T (CAR-T) cell therapy has revolutionized antitumor treatments, especially against hematological malignancies. However, significant limitations such as high costs, long manufacturing periods, and safety concerns persist and hinder the broad applicability of this technology. In vivo CAR-T is based on the concept that the CAR molecules can be delivered in vivo to the target T cells with T cell-targeted vectors. Traditional CAR-T methods require the isolation and proliferation of individualized T cells prior to infusion back into the patient after CAR transduction. Therefore, one potential pitfall of in vivo CAR-T is a hypothesized lack of proliferation of CAR containing T cells which might limit the efficacy of the method. The present embodiments, fulfill these needs as well as others. BRIEF SUMMARY IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, a particle or composition is provided. In some embodiments, the particle or composition comprises one or more nucleic acid molecules encoding for a) a chimeric antigen receptor (CAR); and b) a polypeptide comprising: i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD. In some embodiments, the immune cell activating ICD comprises the ICD of hGCSF- R (human granulocyte colony-stimulating factor receptor), or a mutant or fragment thereof. In some embodiments, the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111, or an amino acid sequence having at least 50, 60, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same. In some embodiments, the ECD is a GCSF-R ECD. In some embodiments, the GCSF-R ECD is a human GCSF-R ECD. In some embodiments, the human GCSF-R ECD comprises an amino acid sequence of SEQ ID NO: 107 or SEQ ID NO: 108. In some embodiments, the ECD is a human growth hormone receptor (hGH-R) ECD, or a mutant or fragment thereof. In some embodiments, the hGH-R ECD comprises an amino acid sequence of SEQ ID NO: 114 or SEQ ID NO: 115, or an amino acid sequence having at least 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same. In some embodiments, the polypeptide comprises: an ECD that is a GCSFR-ECD, or variant thereof (e.g. as set forth herein); a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof (e.g. as set forth herein), and an immune activating ICD that is a GCSF-R ICD, or variant thereof (e.g. as set forth herein). In some embodiments, the polypeptide comprises: an ECD that is a hGH-R-ECD, or variant thereof (e.g. as set forth herein); a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof (e.g. as set forth herein), and immune activating ICD that is a GCSF-R ICD, or variant thereof (e.g. as set forth herein). In some embodiments, the polypeptide comprises: an ECD that is a hGH-R-ECD, or variant thereof (e.g. as set forth herein); a transmembrane domain that is a gp130 transmembrane domain, or variant thereof (e.g. as set forth herein), and immune activating ICD that comprises a gp130 ICD, or variant thereof (e.g. as set forth herein) and a IL-2Rβ ICD, or variant thereof (e.g. as set forth herein). In some embodiments, the polypeptide comprises: an ECD that is a hGH-R-ECD, or variant thereof (e.g. as set forth herein); a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof (e.g. as set forth herein), and immune activating ICD -2- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT that comprises a GCSF-R ICD, or variant thereof (e.g. as set forth herein) and a IL-7Rα ICD, or variant thereof (e.g. as set forth herein). In some embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124, or a variant of any of the foregoing. In some embodiments, the variant comprises a polypeptide having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124. In some embodiments, a nucleic acid molecule is provided, the nucleic acid molecule encoding a polypeptide comprising i) a ligand binding extracellular domain (ECD) as provided for herein; ii) an immune cell activating intracellular domain (ICD) as provided for herein; and iii) a transmembrane domain linking the ECD to the ICD as provided for herein. In some embodiments, the nucleic acid molecule further encodes for a chimeric antigen receptor (CAR). In some embodiments, the CAR is as provided for herein. In some embodiments, the CAR is a CD20 CAR as provided for herein. In some embodiments, the CAR comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 99, at least 90% identity to SEQ ID NO: 99, at least 95% identity to SEQ ID NO: 99, at least 99% identity to SEQ ID NO: 99, or at least 100% identity to SEQ ID NO: 99. In some embodiments, the nucleic acid sequence encoding for the polypeptide and the nucleic acid sequence encoding for the CAR are separated by a nucleic acid sequence encoding for a cleavable peptide sequence, such as a 2A sequence. In some embodiments, a polypeptide is provided. In some embodiments, the polypeptide comprises i) a ligand binding extracellular domain (ECD) as provided for herein; ii) an immune cell activating intracellular domain (ICD) as provided for herein; and iii) a transmembrane domain linking the ECD to the ICD as provided for herein. In some embodiments, a particle is provided comprising a polypeptide as provided for herein. In some embodiments, the particle is a virus or a viral vector. In some embodiments, the viral vector is a lentiviral vector, AV vector, an AAV vector, and the like. In some embodiments, the viral vector is a pseudotyped viral vector. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety, and one or more nucleic acid molecules encoding for one or more heterologous molecules of interest, wherein -3- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT the targeting moiety comprises a polypeptide having the formula T-S1, wherein T is a target binding domain and S1 is a stalk portion, and wherein the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, the stalk portion S1 comprises variant Fc protein. In some embodiments, the variant Fc protein comprises a transmembrane domain, such as, but not limited to, a CD8 or CD28 transmembrane domain. In some embodiments, the variant Fc protein comprises an effector mutation, wherein the effector mutation inhibits the interaction between the Fc protein and a Fc interacting protein, such as FcγR, C1q, FcRβ, or FcRn. In some embodiments, the variant Fc protein is a variant IgG1 Fc protein comprising one or more mutations selected from the group consisting of : L234A, L235A, N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant IgG1 Fc protein comprises an amino acid sequence having at least 80% identity to SEQ ID NO: 104, at least 85% identity to SEQ ID NO: 104, at least 90% identity to SEQ ID NO: 104, at least 95% identity to SEQ ID NO: 104, at least 98% identity to SEQ ID NO: 104, or at least 100% identity to SEQ ID NO: 104. In some embodiments, the variant Fc protein is a variant IgG2 Fc protein comprising one or more mutations selected from the group consisting of: N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant Fc protein is a variant IgG4 Fc protein comprising one or more mutations selected from the group consisting of: S228P, L235E, N297A, P329G, I253A, H310A, and H435A. In some embodiments, the targeting moiety having the formula T-S1 comprises a stalk portion S1 having a formula of L1-Fc-L2-X1, wherein L1 is a linker or absent, Fc is a variant Fc protein, L2 is a linker or absent, and X1 is a polypeptide comprising the transmembrane domain, wherein the targeting moiety having the formula T-S1 has a formula of T-L1-Fc-L2-X1. In some embodiments, the polypeptide comprising the transmembrane domain (X1) comprises a polypeptide having a formula of ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent; TM is a transmembrane domain of a transmembrane protein; and ICD is an intracellular domain or a protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, or is absent; wherein the targeting moiety having the formula of T-L1-Fc-L2-X1 has a formula of T- L1-Fc-L2-ECD-TM-ICD. -4- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the stalk portion S1 comprises a formula of L3-X1, wherein L3 is a flexible peptide linker, and X1 is a polypeptide comprising a transmembrane domain; wherein the targeting moiety having the formula T-S1 has a formula of T-L3-X1. In some embodiments, the polypeptide comprising the transmembrane domain (X1) comprises a polypeptide having a formula of ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent; TM is a transmembrane domain of a transmembrane protein; and ICD is an intracellular domain or a protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, or is absent; wherein the targeting moiety having the formula of T-L3-X1 has a formula of T-L3- ECD-TM-ICD. In some embodiments, the targeting moiety binds to CD7. In some embodiments, the targeting moiety comprises a polypeptide having a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 30, a HCDR2 of SEQ ID NO: 31, and an HCDR3 of SEQ ID NO: 32, or variants of any of the forging. In some embodiments, the targeting moiety comprises a polypeptide having a light chain variable region comprising a LCDR1 of SEQ ID NO: 33, a LCDR2 of SEQ ID NO: 34, and an LCDR3 of SEQ ID NO: 35, or variants of any of the forging. In some embodiments, the heavy chain comprises a heavy chain variable region having at least 90% sequence identity to SEQ ID NO: 36. In some embodiments, the light chain comprises a light chain variable region having at least 90% sequence identity to SEQ ID NO: 37. In some embodiments, the targeting moiety that binds to CD7 comprises a polypeptide having a sequence having at least 90% sequence identity to SEQ ID NO: 38. In some embodiments, the targeting moiety that binds to CD7 comprises a polypeptide having a sequence having at least 90% sequence identity to SEQ ID NO: 39. In some embodiments, the targeting moiety binds to CD8. In some embodiments, the targeting moiety comprises a polypeptide having a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 42, a HCDR2 of SEQ ID NO: 43, and an HCDR3 of SEQ ID NO: 44, or variants of any of the forging. In some embodiments, the targeting moiety comprises a polypeptide having a light chain variable region comprising a LCDR1 of SEQ ID NO: 45, a LCDR2 of SEQ ID NO: 46, and an LCDR3 of SEQ ID NO: 47, or variants of any of the forging. In some embodiments, the heavy chain comprises a heavy chain variable region having at least 90% sequence identity to SEQ ID NO: 48. In some embodiments, the light chain comprises a light chain variable region having at least 90% sequence identity to SEQ ID NO: 49. In some embodiments, the targeting moiety that binds to CD8 comprises a polypeptide having a sequence having at least 90% sequence identity to SEQ ID NO: 50. In some embodiments, the -5- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT targeting moiety that binds to CD8 comprises a polypeptide having a sequence having at least 90% sequence identity to SEQ ID NO: 51. In some embodiments, the heterologous viral glycoprotein is a SVCV-G polypeptide as provided for herein. In some embodiments, the heterologous viral glycoprotein is a VSV-G polypeptide. In some embodiments, the VSV-G polypeptide comprises substitutions at positions I182, T214, and T352 of SEQ ID NO: 2. In some embodiments, the substitution at position 182 is I182D or I182E. In some embodiments, the substitution at position 214 is T214N. In some embodiments, the substitution at position 352 is T352A. In some embodiments, the viral particle provided for herein further comprises a nucleic acid molecule encoding a heterologous molecule of interest. In some embodiments, the heterologous molecule of interest is as provided for herein. In some embodiments, the heterologous molecule of interest is a CAR. In some embodiments, the CAR comprises an antigen binding domain having a heavy chain variable region having at least 95% identity to SEQ ID NO: 89 and a light chain variable region having at least 95% identity to SEQ ID NO: 90. In some embodiments, the CAR comprises an antigen binding domain having a heavy chain variable region having at least 95% identity to SEQ ID NO: 94 and a light chain variable region having at least 95% identity to SEQ ID NO: 95. In some embodiments, the CAR comprises an antigen binding domain having an amino acid sequence having at least 95% identity to SEQ ID NO: 92. In some embodiments, the CAR comprises an antigen binding domain having an amino acid sequence having at least 95% identity to SEQ ID NO: 93. In some embodiments, the CAR comprises an antigen binding domain having an amino acid sequence having at least 95% identity to SEQ ID NO: 96. In some embodiments, CAR comprises an antigen binding domain having an amino acid sequence having at least 95% identity to SEQ ID NO: 97. In some embodiments, the CAR comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 99, at least 90% identity to SEQ ID NO: 99, at least 95% identity to SEQ ID NO: 99, at least 99% identity to SEQ ID NO: 99, or at least 100% identity to SEQ ID NO: 99. In some embodiments, a method of infecting a cell is provided. In some embodiments the method comprises contacting the cell with a viral particle as provided for herein. In some embodiments, a method of infecting a cell in a subject is provided. In some embodiments, the method comprises administering to the subject a pharmaceutical composition comprising a viral particle as provided for herein. -6- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, a method of delivering a heterologous molecule of interest to a cell is provided. In some embodiments, the method comprises contacting the cell with a viral particle as provided for herein, wherein the viral particle comprises a nucleic acid molecule encoding the heterologous molecule of interest. In some embodiments, a method of delivering a heterologous molecule of interest to a cell in a subject is provided. In some embodiments, the method comprises administering to the subject a viral particle as provided for herein, wherein the viral particle comprises a nucleic acid molecule encoding the heterologous molecule of interest. In some embodiments, a method of treating a disease or disorder in a subject is provided. In some embodiments, the method comprises administering to the subject a viral particle as provided for herein, wherein the viral particle comprises a nucleic acid molecule encoding a heterologous molecule of interest to treat the disease or disorder. In some embodiments, a method of delivering a heterologous molecule to a target cell is provided. In some embodiments, the method comprises contacting the cell with a viral particle as provided for herein, wherein the viral particle comprises a nucleic acid molecule encoding the heterologous molecule. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence selected from SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 52, or SEQ ID NO: 53. In some embodiments, the targeting binding domain comprises a sequence selected from SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 50, or SEQ ID NO: 51. In some embodiments, the stalk portion S1 comprises a variant Fc protein comprising a sequence that is a variant of SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28. In some embodiments, the variant of SEQ ID NO: 26 comprises one or more mutations selected from the group consisting of L234A, L235A, N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant of SEQ ID NO: 27 comprises one or more mutations selected from the group consisting of N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant of SEQ ID NO: 28 comprises one or more mutations selected from the group consisting of S228P, L235E, N297A, P329G, I253A, H310A and H435A. In some embodiments, the variant Fc protein further comprises a transmembrane domain comprising a sequence selected from SEQ ID NO: -7- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 61 or SEQ ID NO: 62. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence selected from SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 52, or SEQ ID NO: 53. In some embodiments, the target binding domain comprises a sequence selected from SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 50, or SEQ ID NO: 51. In some embodiments, the stalk portion S1 comprises a formula of L1-Fc-L2-X1, wherein L1 is a linker comprising a sequence selected from SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, or SEQ ID NO: 76, or is absent; Fc is a variant Fc protein comprising a sequence that is a variant of SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28, L2 is a linker comprising a sequence selected from SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, or SEQ ID NO: 76, or is absent; and X1 is a polypeptide comprising a transmembrane domain. In some embodiments, the variant of SEQ ID NO: 26 comprises one or more mutations selected from the group consisting of L234A, L235A, N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant of SEQ ID NO: 27 comprises one or more mutations selected from the group consisting of N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant of SEQ ID NO: 28 comprises one or more mutations selected from the group consisting of S228P, L235E, N297A, P329G, I253A, H310A and H435A. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain having a sequence selected from SEQ ID NO: 59 or SEQ ID NO: 60, or is a fragment thereof, or is absent; TM is a transmembrane domain having a sequence of SEQ ID NO: 61 or SEQ ID NO: 62 or a fragment thereof; and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64, or the ICD is absent. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. -8- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence selected from SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 52, or SEQ ID NO: 53. In some embodiments, the target binding domain comprises a sequence selected from SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 50, or SEQ ID NO: 51. In some embodiments, the stalk portion S1 comprises a formula of L1-Fc-L2-X1, wherein L1 is a linker comprising a sequence of SEQ ID NO: 55 or is absent; Fc is a variant Fc protein comprises a sequence that is a variant of SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28, L2 is a linker comprising a sequence of SEQ ID NO: 55 or is absent; and X1 is a polypeptide comprising a transmembrane domain. In some embodiments, the variant of SEQ ID NO: 26 comprises one or more mutations selected from the group consisting of L234A, L235A, N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant of SEQ ID NO: 27 comprises one or more mutations selected from the group consisting of N297A, P329G, I253A, H310A, and H435A. In some embodiments, the variant of SEQ ID NO: 28 comprises one or more mutations selected from the group consisting of S228P, L235E, N297A, P329G, I253A, H310A and H435A. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain having a sequence of SEQ ID NO: 60, or a fragment thereof, or is absent; TM is a transmembrane domain having a sequence of SEQ ID NO: 62 or a fragment thereof; and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64, or the ICD is absent. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, heterologous viral glycoprotein comprises a sequence selected from SEQ ID NO: 23 or SEQ ID NO: 25. In some embodiments, the target binding domain comprises a of SEQ ID NO: 39. In some embodiments, the stalk portion S1 comprises a formula of L1-Fc-L2- -9- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT X1, wherein L1 is a linker comprising a sequence of SEQ ID NO: 55; Fc is a variant Fc protein comprising a sequence of SEQ ID NO: 104, L2 is a linker and is absent; and X1 is a polypeptide comprising a transmembrane domain. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain having a sequence of SEQ ID NO: 60; TM is a transmembrane domain having a sequence of SEQ ID NO: 62; and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest encodes for a chimeric antigen receptor as provided for herein and a polypeptide comprising i) a ligand binding extracellular domain (ECD) as provided for herein, ii) an immune cell activating intracellular domain (ICD) as provided for herein, and ii) a transmembrane domain linking the ECD to the ICD as provided for herein. In some embodiments, a viral particle is provided, wherein the viral particle comprises a heterologous viral glycoprotein, a targeting moiety, and a nucleic acid molecule encoding for a heterologous molecule of interest. In some embodiments, the heterologous viral glycoprotein comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 23 or SEQ ID NO: 25, having at least 95% identity to SEQ ID NO: 23 or SEQ ID NO: 25, having at least 99% identity to SEQ ID NO: 23 or SEQ ID NO: 25, or having at least 100% identity to SEQ ID NO: 23 or SEQ ID NO: 25. In some embodiments, the targeting moiety comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 98, at least 95% identity to SEQ ID NO: 98, at least 99% identity to SEQ ID NO: 98, or at least 100% identity to SEQ ID NO: 98. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest encodes for a chimeric antigen receptor as provided for herein and a polypeptide comprising i) a ligand binding extracellular domain (ECD) as provided for herein, ii) an immune cell activating intracellular domain (ICD) as provided for herein, and ii) a transmembrane domain linking the ECD to the ICD as provided for herein. In some embodiments, a viral particle is provided, wherein the viral particle comprises a heterologous viral glycoprotein, a targeting moiety, and a nucleic acid molecule encoding for a heterologous molecule of interest. In some embodiments, the heterologous viral glycoprotein comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 52 or SEQ ID NO: 53, having at least 95% identity to SEQ ID NO: 52 or SEQ ID NO: 53, having at least 99% identity to SEQ ID NO: 52 or SEQ ID NO: 53, or having at least 100% identity to SEQ ID NO: 52 or SEQ ID NO: 53. In some embodiments, the targeting moiety -10- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 98, at least 95% identity to SEQ ID NO: 98, at least 99% identity to SEQ ID NO: 98, or at least 100% identity to SEQ ID NO: 98. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest encodes for a chimeric antigen receptor as provided for herein and a polypeptide comprising i) a ligand binding extracellular domain (ECD) as provided for herein, ii) an immune cell activating intracellular domain (ICD) as provided for herein, and ii) a transmembrane domain linking the ECD to the ICD as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the target binding domain comprises an amino acid sequence of SEQ ID NO: 38 or SEQ ID NO: 39. In some embodiments, the stalk portion S1 comprises a formula L3-X1, wherein L3 is a flexible peptide linker comprising an amino acid sequence of SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, or SEQ ID NO: 58 and X1 is a polypeptide linker comprising a transmembrane domain. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain comprising an amino acid sequence of SEQ ID NO: 59 or SEQ ID NO: 60, or is a fragment thereof, or is absent, TM is a transmembrane domain comprising an amino acid sequence of SEQ ID NO: 61 or SEQ ID NO: 62, and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64, or the ICD is absent. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the target binding domain comprises an amino acid sequence of SEQ ID NO: 50 or SEQ ID NO: 51. In some embodiments, the stalk portion S1 comprises a formula L3-X1, wherein L3 is a flexible peptide linker comprising an amino acid sequence of SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, or SEQ ID NO: 58 and X1 is a polypeptide linker comprising a transmembrane domain. In some embodiments, the polypeptide -11- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain comprising an amino acid sequence of SEQ ID NO: 59 or SEQ ID NO: 60, or is a fragment thereof, or is absent, TM is a transmembrane domain comprising an amino acid sequence of SEQ ID NO: 61 or SEQ ID NO: 62, and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64, or the ICD is absent. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 52, or SEQ ID NO: 53. In some embodiments, the target binding domain comprises an amino acid sequence of SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 50, or SEQ ID NO: 51. In some embodiments, the stalk portion S1 comprises a formula L3-X1, wherein L3 is a flexible peptide linker comprising an amino acid sequence of SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, or SEQ ID NO: 58 and X1 is a polypeptide linker comprising a transmembrane domain. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain comprising an amino acid sequence of SEQ ID NO: 59 or SEQ ID NO: 60, or is a fragment thereof, or is absent, TM is a transmembrane domain comprising an amino acid sequence of SEQ ID NO: 61 or SEQ ID NO: 62, and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64, or the ICD is absent. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence of SEQ ID NO: 22, -12- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 52, or SEQ ID NO: 53. In some embodiments, the target binding domain comprises an amino acid sequence of SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 50, or SEQ ID NO: 51. In some embodiments, the stalk portion S1 comprises a formula L3-X1, wherein L3 is a flexible peptide linker comprising an amino acid sequence of SEQ ID NO: 55, and X1 is a polypeptide linker comprising a transmembrane domain. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain comprising an amino acid sequence of SEQ ID NO: 59 or SEQ ID NO: 60, or is a fragment thereof, or is absent, TM is a transmembrane domain comprising an amino acid sequence of SEQ ID NO: 61 or SEQ ID NO: 62, and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64, or the ICD is absent. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence of SEQ ID NO: 23 or SEQ ID NO: 25. In some embodiments, the target binding domain comprises an amino acid sequence of SEQ ID NO: 39. In some embodiments, the stalk portion S1 comprises a formula L3-X1, wherein L3 is a flexible peptide linker comprising an amino acid sequence of SEQ ID NO: 55, and X1 is a polypeptide linker comprising a transmembrane domain. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain comprising an amino acid sequence of SEQ ID NO: 59, TM is a transmembrane domain comprising an amino acid sequence of SEQ ID NO: 61, and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest is a nucleic acid molecule as provided for herein. In some embodiments, a viral particle is provided. In some embodiments, the viral particle comprises a heterologous viral glycoprotein, a targeting moiety comprising a -13- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT polypeptide having the formula T-S1, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein T is a target binding domain and S1 is a stalk portion. In some embodiments, the heterologous viral glycoprotein comprises a sequence of SEQ ID NO: 52 or SEQ ID NO: 53. In some embodiments, the target binding domain comprises an amino acid sequence of SEQ ID NO: 39. In some embodiments, the stalk portion S1 comprises a formula L3-X1, wherein L3 is a flexible peptide linker comprising an amino acid sequence of SEQ ID NO: 55, and X1 is a polypeptide linker comprising a transmembrane domain. In some embodiments, the polypeptide comprising a transmembrane domain (X1) has a formula of ECD-TM-ICD, wherein ECD is an extracellular domain comprising an amino acid sequence of SEQ ID NO: 59, TMis a transmembrane domain comprising an amino acid sequence of SEQ ID NO: 61, and ICD is an intracellular domain or protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, wherein the ICD comprises an env incorporation motif comprising an amino acid sequence of SEQ ID NO: 63 or SEQ ID NO: 64. In some embodiments, the nucleic acid molecule encoding for a heterologous molecule of interest encodes for a chimeric antigen receptor as provided for herein and a polypeptide comprising i) a ligand binding extracellular domain (ECD) as provided for herein, ii) an immune cell activating intracellular domain (ICD) as provided for herein, and ii) a transmembrane domain linking the ECD to the ICD as provided for herein. In some embodiments, the CAR comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 99, at least 90% identity to SEQ ID NO: 99, at least 95% identity to SEQ ID NO: 99, at least 99% identity to SEQ ID NO: 99, or at least 100% identity to SEQ ID NO: 99. BRIEF DESCRIPTION OF FIGURES FIG. 1A and FIG. 1B illustrate exemplary chimeric GCSFR constructs provided for herein. FIG. 2A and FIG. 2B illustrate crystal structures of VSV-G bound to LDL-R. FIG. 2A illustrates the crystal structure of VSV-G bound to CR3 of the LDL-R. FIG.2B illustrates the crystal structure of VSV-G bound to CR2 of the LDL-R. FIG. 3A and FIG. 3B illustrate the effect of adding negatively charged amino acids to the VSV-G:LDL-R binding interface on native tropism and fusogenicity. FIG.3A illustrates the titration of VSV-G constructs on SupT1 cells. FIG. 3B illustrates functional titer of each construct calculated from the titration in FIG.3A. -14- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT FIG.4 illustrates an alignment of the ectodomains of different VSV-G proteins from different strains. FIG.5 illustrates the effect of various VSV-G mutations on the serum stability of viral constructs in combination with a CD7 binder. FIG.6 illustrates the effect of various VSV-G mutations on the serum stability of viral constructs in combination with a CD7 binder. FIG. 7 illustrates the ability of various rhabdovirus G proteins to transduce SupT1 and PBMC cells alone or in combination with a CD7 binder. FIG. 8A-L show flow cytometry data of human PBMCs transduced with exemplary vectors comprising CD7 binders as disclosed herein. FIG. 8M shows flow cytometry data of human PBMCs transduced with exemplary vectors comprising CD7 binders as disclosed herein. FIG. 9A-L shows flow cytometry data of non-human primate PBMCs transduced with exemplary vectors comprising CD7 binders as disclosed herein. FIG.9M shows flow cytometry data of non-human primate PBMCs transduced with exemplary vectors comprising CD7 binders as disclosed herein. FIG. 10A shows flow cytometry data of human PBMCs transduced with exemplary vectors comprising CD8 binders as disclosed herein. FIG.10B shows flow cytometry data of non-human primate PBMCs transduced with exemplary vectors comprising CD8 binders as disclosed herein. FIG.11A illustrates the ability of VSV-G* pseudotyped lentiviral particles harboring a CD7 binder with a variant Fc stalk to transduce SupT1 cells as well as human and non-human primate PBMCs. FIG 11B illustrates the transduction of cells in the absence of the CD7 binder. FIG. 11C illustrates the transduction of human and non-human primate PBMCs in terms of MOI calculated from SupT1 titration. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG.12A illustrates the ability of VSV-G* pseudotyped lentiviral particles harboring a CD7 binder with a flexible stalk to transduce SupT1 cells as well as human and non-human primate PBMCs. FIG. 12B illustrates the transduction of cells in the absence of the CD7 binder. FIG 12C illustrates the transduction of human and non-human primate PBMCs in terms of MOI calculated from SupT1 titration. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG.13A illustrates the ability of viral particles harboring a CD7 binder with flexible stalks of varying length to transduce SupT1 cells in comparison to other IgG based binders. FIG.13B illustrates the ability of viral particles harboring a CD7 binder with flexible stalks of varying length to transduce activated PBMC cells in comparison to other IgG based binders. -15- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT FIG.14A illustrates the ability of SVCV-G pseudotyped lentiviral particles harboring a CD7 binder with a variant Fc stalk to transduce SupT1 cells as well as human and non-human primate PBMCs. FIG 14B illustrates the transduction of cells in the absence of the CD7 binder. FIG. 14C illustrates the transduction of human and non-human primate PBMCs in terms of MOI calculated from SupT1 titration. FIG.15A illustrates the ability of SVCV-G pseudotyped lentiviral particles harboring a CD7 binder with a flexible stalk to transduce SupT1 cells as well as human and non-human primate PBMCs. FIG. 15B illustrates the transduction of cells in the absence of the CD7 binder. FIG 15C illustrates the transduction of human and non-human primate PBMCs in terms of MOI calculated from SupT1 titration. FIG.16A-D is a comparison of the ability of VSV-G* pseudotyped lentiviral particles (panels A and B) and SVCV-G pseudotyped lentiviral particles (panels C and D) to transduce SupT1 cells as well as human and non-human primate PBMCs. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG.17A-D is a comparison of the ability of VSV-G* pseudotyped lentiviral particles (panels A and B) and SVCV-G pseudotyped lentiviral particles (panels C and D) to transduce SupT1 cells as well as human and non-human primate PBMCs. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG. 18A and FIG. 18B is a comparison of the off target transduction of GFP in a panel of B-cell cell lines as compared to control SupT1 cells. FIG.18A illustrates the data for VSV-G* pseudotyped lentiviral particles harboring a CD7 binder with a variant Fc stalk. VSV- G* denotes VSV-G (I182E, T214N, T352A). FIG. 18B illustrates the data for SVCV-G pseudotyped lentiviral particles harboring a CD7 binder with a variant Fc stalk. FIG. 19A and FIG. 19B is a comparison of the off target transduction of a CAR20- T2A-GFP construct in a panel of B-cell cell lines as compared to control SupT1 cells. FIG. 19A illustrates the data for VSV-G* pseudotyped lentiviral particles harboring a CD7 binder with a variant Fc stalk. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG.19B illustrates the data for SVCV-G pseudotyped lentiviral particles harboring a CD7 binder with a variant Fc stalk. FIG. 20A and FIG. 20B is a comparison of the off target transduction of GFP in a panel of B-cell cell lines as compared to control SupT1. FIG.20A illustrates the data for VSV- G* pseudotyped lentiviral particles harboring a CD7 binder with a flexible stalk. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG 20B illustrates the data for SVCV-G pseudotyped lentiviral particles harboring a CD7 binder with a flexible stalk. -16- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT FIG. 21A and FIG. 21B is a comparison of the off target transduction of a CAR20- T2A-GFP construct in a panel of B-cell cell lines as compared to control SupT1. FIG. 21A illustrates the data for VSV-G* pseudotyped lentiviral particles harboring a CD7 binder with a flexible stalk. VSV-G* denotes VSV-G (I182E, T214N, T352A). FIG 21B illustrates the data for SVCV-G pseudotyped lentiviral particles harboring a CD7 binder with a flexible stalk. FIG. 22A and 22B illustrate the ability of VSV-G* pseudotyped lentiviral particles utilizing CD7 binders and a CD20-CAR transgene as provided for herein to kill Daudi lymphoma cells (FIG. 22A) or Raji lymphoma cells (FIG. 22B). CAR20 constructs utilized antigen binding domains comprising rituximab, or CD20AB1 SEQ ID NOs 92 or 93 as provided for herein. FIG.23A-F illustrates the toxicity of the ligand GCSF on PBMCs transduced with a CAR20-2A-chimeric GCSFR construct as provided for herein. FIG.23A illustrates the results for no chimeric receptor control. FIG. 23B illustrates the results for GCSFR-d15. FIG. 23C illustrates the results for G7R1. FIG. 23D illustrates the results for G21 / R1. FIG. 23E illustrates the results for G2R2. FIG.23F illustrates the results for G27 / 2R1. FIG. 24A-E illustrates the toxicity of the ligand hGH on PBMCs transduced with a CAR20-2A-chimerinc GHR construct as provided for herein. FIG. 24A illustrates the results for GHR-GCSFRd715. FIG. 24B illustrates the results for GHR-G7R1. FIG. 24C illustrates the results for GHR-G21 / 7R1. FIG. 24D illustrates the results for GHR-G2R2. FIG. 24E illustrates the results for GHR-G27 / 2R1. FIG. 25A-F illustrates the ability of the chimeric GCSFR receptors provided for herein to induce proliferation of transduced PBMCs. FIG. 25A illustrates the results for no chimeric receptor control. FIG.25B illustrates the results for GCSFR-d15. FIG.25C illustrates the results for G7R1. FIG. 25D illustrates the results for G21 / R1. FIG. 25E illustrates the results for G2R2. FIG.25F illustrates the results for G27 / 2R1. FIG.26A-E illustrates the ability of the chimeric GHR receptors provided for herein to induce proliferation of transduced PBMCs. FIG. 26A illustrates the results for GHR- GCSFRd715. FIG.26B illustrates the results for GHR-G7R1. FIG.26C illustrates the results for GHR-G21 / 7R1. FIG. 26D illustrates the results for GHR-G2R2. FIG. 26E illustrates the results for GHR-G27 / 2R1. FIG. 27A-E illustrates the results of a follow up PBMC induced proliferation experiment with select chimeric receptor constructs. FIG. 27A illustrates the results for GCSFR FL. FIG. 27B illustrates the results for GCSFRd715. FIG.27C illustrates the results -17- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT for GCSFR-G2R2. FIG.27D illustrates the results for GHR-GCSFR. FIG.27E illustrates the results for GHR-dFN-GCSFR. FIG.27F illustrates the results for GHR-G2R2. FIG. 28A and 28B illustrate the ability of VSV-G* pseudotyped lentiviral particles utilizing CD7 binders and a CD20-CAR transgene as provided for herein to deplete B-cells in vivo in huCD34 NSG mice. B-cells were detected via assessment for CD20 (FIG. 28A) or CD19 (FIG.28B). FIG. 29A and 29B illustrate the ability of VSV-G* pseudotyped lentiviral particles utilizing CD7 binders and a CD20-CAR transgene as provided for herein to prevent tumor formation in vivo. FIG. 29A depicts the experimental design. FIG. 29B illustrates that mice receiving i.v. lentiviral particles as provided for herein prior to Raji tumor infusion had significantly lower tumor burden than mice receiving control (GFP) vector or untreated mice. Tumor burden measured via IVIS imaging. FIG. 30A and 30B illustrate the ability of VSV-G* pseudotyped lentiviral particles utilizing CD7 binders and a CD20-CAR transgene as provided for herein to eliminate established Raji tumors in vivo. FIG.30A depicts the experimental design. FIG.30B illustrates that mice receiving i.v. lentiviral particles as provided for herein after 6 days after Raji tumor infusion had their tumor burdens diminished below the limit of detection. Tumor burden measured via IVIS imaging. FIG.31A shows an example CAR – GCSF Receptor construct for tunable expansion of cells. FIG.31B shows flow cytometry data demonstrating tunable CAR cell proliferation in vitro. FIG.31C shows a dose response of CAR-T cells to an exogenous GCSF agonist. FIGs. 31D and 31E depict an example in vivo experimental design for evaluating the CAR-GSCFR construct. FIGs. 31F and 31G show significant proliferation of CAR20+ cells in the presence of GCSF agonist. FIG. 32A – 32F illustrate the results of a cell count analysis of PBMCs transduced with combinations of a CAR20 construct, GCSFR construct, or GFP when treated with the indicated concentrations of GCSF or complete media. FIG. 32A illustrates the growth of PBMCs from PBMC donor 1 transduced with CAR20 alone. FIG. 32B illustrates the growth of PBMCs from PBMC donor 2 transduced with CAR20 alone. FIG.32C illustrates the growth of PBMCs from PBMC donor 1 transduced with CAR20 and a GCSFR construct. FIG. 32D illustrates the growth of PBMCs from PBMC donor 2 transduced with CAR20 and a GCSFR construct. FIG. 32E illustrates the growth of PBMCs from PBMC donor 1 transduced with GFP and a GCSFR construct. FIG.32F illustrates the growth of PBMCs from PBMC donor 2 transduced with GFP and a GCSFR construct. -18- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT FIG. 33A – 33F illustrate the results of a cell count analysis of PBMCs transduced with combinations of a CAR20 construct, GHR construct, or GFP when treated with the indicated concentrations of GH or complete media. FIG.33A illustrates the growth of PBMCs from PBMC donor 1 transduced with CAR20 alone. FIG.33B illustrates the growth of PBMCs from PBMC donor 2 transduced with CAR20 alone. FIG.33C illustrates the growth of PBMCs from PBMC donor 1 transduced with CAR20 and a GHR construct. FIG. 33D illustrates the growth of PBMCs from PBMC donor 2 transduced with CAR20 and a GHR construct. FIG. 33E illustrates the growth of PBMCs from PBMC donor 1 transduced with GFP and a GHR construct. FIG. 33F illustrates the growth of PBMCs from PBMC donor 2 transduced with GFP and a GHR construct. DETAILED DESCRIPTION Provided for herein are particles or compositions comprising one or more nucleic acid molecules encoding for a chimeric antigen receptor (CAR) and a polypeptide comprising i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD. As provided for herein, the particle may be a viral particle. Accordingly, also provided for herein are viral particles comprising a heterologous viral glycoprotein, a targeting moiety, and one or more nucleic acid molecules encoding for one or more heterologous molecules of interest, wherein the targeting moiety comprises a polypeptide having the formula of T-S1, wherein T is a target binding domain, and S1 is a stalk portion, and wherein the one or more nucleic acid molecules encode for a chimeric antigen receptor (CAR) and a polypeptide comprising i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD. In some embodiments, S1 comprises a mutant Fc polypeptide that can be, for example, linked to a transmembrane domain as provided for herein. In some embodiments, S1 comprises flexible polypeptides as provided for herein. The mutant Fc polypeptides or the flexible polypeptides can be incorporated into a viral particle to help facilitate the targeting of the viral particle to a specific cell type. Additionally, the viral particle can comprise VSV-G proteins that can be used, for example, to pseudotype a virus, such as a lentivirus. In some embodiments, the pseudotyped viral-like particles are pseudotyped using viral glycoproteins of a vesicular stomatitis New Jersey virus strain, a vesicular stomatitis Indiana virus strain, a vesicular stomatitis Alagoas virus strain, a vesicular stomatitis Maraba virus strain, or a vesicular stomatitis Carajas virus strain. Examples of such proteins are provided for herein. -19- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT The pseudotyped viruses comprising the mutant VSV-G proteins, such as those provided for herein, can be used in conjunction with a targeting moiety to facilitate the fusion of the pseudotyped virus with a specific cell or tissue based on the expression of the target on the cell or the tissue. As provided for herein, the targeting moiety can be linked to a Fc protein, which can be referred to a stalk protein that comprises a transmembrane domain to facilitate the attachment of the targeting moiety to the surface of the virus. In some embodiments, the Fc protein comprises a Fc effector mutation, such as those provided for herein. Unless defined otherwise, all technical and scientific terms have the same meaning as is commonly understood by one of ordinary skill in the art to which the embodiments disclosed belongs. As used herein, the terms “a” or “an” means that “at least one” or “one or more” unless the context clearly indicates otherwise. As used herein, the term “about” means that the numerical value is approximate and small variations would not significantly affect the practice of the disclosed embodiments. Where a numerical limitation is used, unless indicated otherwise by the context, “about” means the numerical value can vary by ±10% and remain within the scope of the disclosed embodiments. Additionally, where a phrase recites “about x to y,” the term “about” modifies both x and y and can be used interchangeably with the phrase “about x to about y” unless context dictates differently. As used herein, the term “individual” or “subject,” or “patient” used interchangeably, means any animal, including mammals, such as mice, rats, other rodents, rabbits, dogs, cats, swine, cattle, sheep, horses, or primates, such as humans. As used herein, the terms “comprising” (and any form of comprising, such as “comprise”, “comprises”, and “comprised”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”), or “containing” (and any form of containing, such as “contains” and “contain”), are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. Any step or composition that uses the transitional phrase of “comprise” or “comprising” can also be said to describe the same with the transitional phase of “consisting of” or “consists.” As used herein, the term “contacting” means bringing together of two elements in an in vitro system or an in vivo system. For example, “contacting” virus or vector described herein with an individual or patient or cell includes the administration of the virus to an individual or patient, such as a human, as well as, for example, introducing a compound into a sample containing a cellular or purified preparation containing the cell. -20- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT As used herein, the term “fused” or “linked” when used in reference to a protein having different domains or heterologous sequences means that the protein domains are part of the same peptide chain that are connected to one another with either peptide bonds or other covalent bonding. The domains or section can be linked or fused directly to one another or another domain or peptide sequence can be between the two domains or sequences and such sequences would still be considered to be fused or linked to one another. In some embodiments, the various domains or proteins provided for herein are linked or fused directly to one another or a linker sequences, such as the glycine / serine sequences described herein link the two domains together. A “disease” is a state of health of an animal wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal’s health continues to deteriorate. In contrast, a “disorder” in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal’s state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal’s state of health. “Effective amount” or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result or provides a therapeutic or prophylactic benefit. Such results may include, but are not limited to an amount that when administered to a mammal, causes a detectable level of immune cell activation compared to the immune cell activation detected in the absence of the composition. The immune response can be readily assessed by a plethora of art-recognized methods. The skilled artisan would understand that the amount of the composition administered herein varies and can be readily determined based on a number of factors such as the disease or condition being treated, the age and health and physical condition of the mammal being treated, the severity of the disease, the particular compound being administered, and the like. “Encoding” refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used -21- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA. “Expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., Sendai viruses, lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide. As used herein, the phrase “ex vivo” in reference to a cell being transduced, transfected or transformed ex vivo, refers to a cell being transduced, transfected or transformed outside of the subject, that is with the cells being removed from the subject before such cells are transduced, transfected or transformed. “Identity” as used herein refers to the subunit sequence identity between two polymeric molecules such as between two nucleic acid or amino acid molecules, such as, between two polynucleotide or polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid or two nucleic acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage. The identity between two amino acid or two nucleic acid sequences is a direct function of the number of matching or identical positions; e.g., if half of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions (e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical. By "substantially identical" is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). In some embodiments, such a sequence is at least 60%, 80% or 85%, or 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison. Other percentages of identity in reference to specific sequences are described herein. Sequence identity can be measured / determined using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis.53705, BLAST, -22- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT BESTFIT, GAP, or PILEUP / PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and / or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e3 and e100 indicating a closely related sequence. In some embodiments, sequence identity is determined by using BLAST with the default settings. To the extent embodiments provided for herein, includes composition comprising various proteins, these proteins may, in some instances, comprise amino acid sequences that have sequence identity to the amino acid sequences disclosed herein. Therefore, in certain embodiments, depending on the particular sequence, the degree of sequence identity is preferably greater than 50% (e.g. 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) to the SEQ ID NOs disclosed herein. In addition to these percentages, other percentages of identity are provided for herein. Identity between polypeptides can be determined by the Smith-Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty – 12 and gap extension penalty = 1. These proteins may, compared to the disclosed proteins, include one or more (e.g.1, 2, 3,4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain. Genetically-encoded amino acids are generally divided into four families: (1) acidic i.e. aspartate, glutamate; (2) basic i.e. lysine, arginine, histidine; (3) non polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e. glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In general, Substitution of single amino acids within these families does not have a major effect on the biological activity. The proteins may have one or more (e.g.1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to the disclosed protein sequences. The proteins may also include one or more (e.g.1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions (e.g. each of 1, 2, 3, 4 or 5 amino acids) relative to the disclosed protein sequences. As used herein, the phrase “in vivo” in reference to a cell being transduced, transfected or transformed in vivo, refers to a cell being transduced, transfected or transformed -23- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT in the subject without the cells being removed from the subject before such cells are transduced, transfected or transformed. “Isolated” means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell. A “lentivirus” as used herein refers to a genus of the Retroviridae family that is able to infect non-dividing cells. Non-limiting examples of lentiviruses are HIV, SIV, and FIV. Vectors or viral-like particles derived from lentiviruses can be used to transduce cells and deliver genes or other molecules and have them expressed in a cell either in vitro (ex-vivo) or in vivo. By the term “modified” as used herein, is meant a changed state or structure of a molecule or cell as provided herein. Molecules may be modified in many ways, including chemically, structurally, and functionally, such as mutations, substitutions, insertions, or deletions (e.g. internal deletions truncations). Cells may be modified through the introduction of nucleic acids or the expression of heterologous proteins. By the term “modulating,” as used herein, is meant mediating an increase or decrease in the level of a response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and / or compared with the level of a response in an otherwise identical but untreated subject. The term encompasses perturbing and / or affecting a native signal or response thereby mediating a beneficial therapeutic response in a subject, such as, a human. Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s). The term “oligonucleotide” typically refers to short polynucleotides. It will be understood that when a nucleotide sequence is represented by a DNA sequence (i.e., A, T, C, G), this also provides the corresponding RNA sequence (i.e., A, U, C, G) in which “U” replaces “T.” “Parenteral” administration of a composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques. -24- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT The term “polynucleotide” as used herein is defined as a chain of nucleotides. Furthermore, nucleic acids are polymers of nucleotides. Thus, the terms “nucleic acids” and “polynucleotides” as used herein are interchangeable. As used herein polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any methods available in the art, including, without limitation, recombinant methods, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using cloning technology and PCR, and the like, and by synthetic means. As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of a plurality of amino acid residues covalently linked by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof. Unless explicitly stated otherwise, the terms “heterologous viral structural protein” and “heterologous viral glycoprotein” as used herein are used synonymously and interchangeably. Accordingly, unless explicitly stated otherwise, an embodiment referring to a “heterologous viral structural protein” is understood to be referring to a “heterologous viral glycoprotein” and vice versa. The term “pseudotyped” or “pseudotyped viral particle”, as used herein, refers to a viral particle bearing glycoproteins derived from other viruses having envelopes or a viral vector encoding envelope glycoproteins from a virus that is different from the parental virus. The host range of the vector particles can thus be expanded or altered depending on the type of cell surface receptor used by the glycoprotein. For example, a virus can be pseudotyped with a VSV-G mutant protein as provided for herein. By the term “specifically binds,” as used herein with respect to an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross- species reactivity does not itself alter the classification of an antibody as specific. In another example, an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of -25- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT an antibody as specific. In some instances, the terms “specific binding” or “specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope “A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A” and the antibody, will reduce the amount of labeled A bound to the antibody. In some embodiments, the targeting moieties described herein that can be used to target the viral particles comprising the mutant VSV-G protein, or other viral structural proteins used to pseudotype a virus, can specifically bind to their target. The term “subject” includes living organisms, including those in which an immune response can be elicited (e.g., mammals). A “subject” or “patient,” as used therein, may be a human or non-human mammal. Non-human mammals include, for example, livestock and pets, such as ovine, bovine, porcine, canine, non-human primates, feline and murine mammals. In some embodiments, the subject is human. The term “therapeutic” as used herein means a treatment and / or prophylaxis. A therapeutic effect is obtained by suppression, remission, or eradication of a disease state. The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into a cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny. In some embodiments, the transfection, transformation, or transduction is performed or occurs in vivo. To “treat” a disease as the term is used herein, means to reduce the frequency or severity of at least one sign or symptom of a disease or disorder experienced by a subject. A “vector” is a composition of matter which comprises an isolated nucleic acid encoding a protein or a peptide. Numerous vectors are known in the art including, but not limited to, linear polynucleotides, plasmids, DNA, and RNA. Examples of viral vectors include, but are not limited to, Sendai viral vectors, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like. A “carrier” or “delivery vehicle” includes viral particles, viruses, polylysine compounds, and liposomes, which facilitate transfer of nucleic acid into cells. A carrier or delivery vehicle can also be used to deliver a protein or peptide to a cell. -26- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT Ranges: throughout this disclosure, various aspects of the embodiments can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range. Unless otherwise explicitly stated to the contrary, a range that is disclosed also includes the endpoints of the range. Heterologous Proteins In some embodiments, polypeptides are provided that are recombinant fusion proteins that comprise a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD. As used herein, the term, “an immune cell activating intracellular domain (ICD)” refers a domain that when activated can activate or enhance the number of immune cells. In some embodiments, the immune cell activating ICD comprises the ICD of hGCSF-R, or a mutant or fragment thereof. In some embodiments, the ICD of hGCSF-R comprise a substitution, an insertion or deletion. In some embodiments, the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111), or an amino acid sequence having at least 50, 60, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same. In some embodiments, the hGCSF-R ICD does not comprise the sequence of SEQ ID NO: 110. In some embodiments, the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111 and does not comprise amino acid residues 800-813, 775-813, 750-813, 725-813, or 716-813 of SEQ ID NO: 125, or a fragment thereof, positioned to the C-terminal residue of SEQ ID NO: 111. In some embodiments, the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111 and amino acid residues 716-812 of SEQ ID NO: 125, or a fragment thereof positioned to the C-terminal residue of SEQ ID NO: 111, provided that the ICD does not comprise the contiguous fragment of amino acid residues 716-813 of SEQ ID NO: 125. As used herein, the term “ligand binding extracellular domain (ECD)” refers to a domain of a protein that can bind to ligand and can act to transmit a signal through the ICD. This signal can be a signal to enhance the activation of a cell or to increase the rate of cell division to increase the number of cells. This ligand can be naturually occurring or synthetic -27- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT or made recombinantly. For example, G-CSF (granulocyte-colony stimulating factor) or human growth hormone (HGH) can be used as a ligand that can bind to the ECD to transmit the signal. For example, somatropin can be used as a ligand that can bind to an ECD that can bind to HGH. Additionally, in some embodiments, or lenograstim (Granocyte), filgrastim (Neupogen, Zarzio, Nivestim, Accofil), long acting (pegylated) filgrastim (pegfilgrastim, Neulasta, Pelmeg, Ziextenco) or lipegfilgrastim (Lonquex) can be used to as a ligand that can bind to an G-CSF that can bind to HGH. Examples of ECD are provided for herein and include, but are not limited to, G-CSFR or hGHR. Without being bound to any particular theory, when these drugs are administered to a patient expressing these polypeptides, the T cells will expand (increase in number) and lead to a greater response against the tumor. In some embodiments, the ECD is a GCSF-R ECD. In some embodiments, the GCSF-R ECD is a human GCSF-R ECD. In some embodiments, the human GCSF-R ECD comprises the amino acid sequence of SEQ ID NO: 107 or SEQ ID NO: 108. In some embodiments, the ECD comprises the ECD of human growth hormone receptor (hGH-R), or a mutant or fragment thereof. In some embodiments, the ECD of human growth hormone receptor (hGH-comprises the amino acid sequence encoded by exons 1-7 of hGH-R, or a mutant or fragment thereof. In some embodiments, the ECD of the hGH-R comprises the mutation of C259R. In some embodiments, the ECD of the hGH-R comprises an amino acid sequence of SEQ ID NO: 114 or SEQ ID NO: 115, or an amino acid sequence having at least 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same. In some embodiments, the ECD of the hGH-R comprises an amino acid sequence of SEQ ID NO: 114 or SEQ ID NO: 115 that excludes a leader sequence, or an amino acid sequence having at least 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same. In some embodiments, the ICD comprises an ICD of glycoprotein 130 (“gp130 ICD”), or a variant or fragment thereof. In some embodiments, the gp130 ICD comprises a fragment of the gp130 ICD. In some embodiments, the gp130 ICD fragment comprises a Jak1 binding site and / or a SHP-2 / STAT3 binding site. A non-limiting example of this is the amino acid sequence of SEQ ID NO: 122. Another non-limiting example of a gp130 ICD, or fragment thereof, includes the amino acid sequence of the gp130 ICD of Construct G, described in further detail herein. In some embodiments, the ICD comprises a fragment of the GCSF-R ICD. In some embodiments, the GCSF-R ICD fragment does not comprise the STAT3, SH3 and / or the SHC domains. In some embodiments, the GCSF-R ICD fragment comprises the Jak1 and / or the STAT3 binding site. In some embodiments, the ICD comprises a IL-2Rβ ICD, or a fragment -28- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT or variant thereof. In some embodiments, the IL-2Rβ ICD is a fragment of the IL-2Rβ ICD. In some embodiments, the IL-2Rβ ICD, or fragment thereof, comprises the SHC or STAT5 binding domains. In some embodiments, the ICD comprises a IL-7Rα ICD, or a fragment or variant thereof. In some embodiments, the IL-7Rα ICD is a fragment of the IL-7Rα ICD. In some embodiments, the ICD comprises a IL-7Rα ICD, or a fragment thereof, comprises a STAT5 and / or PI3K binding domain. In some embodiments, the ICD comprises a gp130 ICD, or a variant or fragment thereof, linked to an IL-2Rβ ICD, or fragment thereof. A non-limiting example of an IL-2Rβ ICD, or fragment thereof is the amino acid sequence of SEQ ID NO: 123. In some embodiments, the ICD comprises a hCCSF-R ICD, or a variant or fragment thereof, linked to an IL-7Rα ICD, or fragment thereof. A non-limiting example of an IL-7Rα ICD, or fragment thereof is the amino acid sequence of SEQ ID NO: 118. Another non-limiting example of an IL-7Rα ICD, or fragment thereof includes the amino acid sequence of the IL- 7Rα ICD of Construct E, described in further detail herein. In some embodiments, the transmembrane domain, comprises a GCSF-R, gp130, or hGH-R transmembrane domain. In some embodiments, the transmembrane domain comprises the hGCSF-R transmembrane domain, or a variant thereof. In some embodiments, the transmembrane domain comprises the gp130 transmembrane domain, or a variant thereof. Examples of gp130 transmembrane domains include, but are not limited to, an amino acid sequence of SEQ ID NO: 121. In some embodiments, transmembrane domain comprises the hGH-R transmembrane domain, or a variant thereof. In some embodiments, the polypeptide comprises an ECD that is a GCSFR-ECD, or variant thereof (e.g. as set forth herein and above); a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof (e.g. as set forth herein and above), and an immune activating ICD that is a GCSF-R ICD, or variant thereof (e.g. as set forth herein and above). In some embodiments, the polypeptide comprises an ECD that is a hGH-R-ECD, or variant thereof (e.g. as set forth herein and above); a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof (e.g. as set forth herein and above), and immune activating ICD that is a GCSF-R ICD, or variant thereof (e.g. as set forth herein and above). In some embodiments, the polypeptide comprises an ECD that is a hGH-R-ECD, or variant thereof (e.g. as set forth herein and above); a transmembrane domain that is a gp130 transmembrane domain, or variant thereof (e.g. as set forth herein and above), and immune activating ICD that comprises a gp130 ICD, or variant thereof (e.g. as set forth herein and above) and a IL-2Rβ ICD, or variant thereof (e.g. as set forth herein and above). -29- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the polypeptide comprises an ECD that is a hGH-R-ECD, or variant thereof (e.g. as set forth herein and above); a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof (e.g. as set forth herein and above), and immune activating ICD that comprises a GCSF-R ICD, or variant thereof (e.g. as set forth herein and above) and a IL-7Rα ICD, or variant thereof (e.g. as set forth herein and above). In some embodiments, the polypeptide comprises an amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124, or a variant of any of the foregoing. In some embodiments, the variant comprises a polypeptide having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124. Examples of these domains or sequences are provided for herein in the present specification. The polypeptides with the different domains described in this section are distinct from what is known as a chimeric antigen receptor. Chimeric antigen receptors can be present in the same cell as these polypeptides, but this polypeptide would not be considered a chimeric antigen receptor by one of skill in the art. Thus, in some embodiments, the polypeptide does not comprise an antigen binding domain. For example, in some embodiments, polypeptide does not comprise an antigen binding domain that is in an scFv, Fab, or single domain antibody format. Other antigen binding domains are provided for herein, and in some embodiments, the polypeptide does not comprise an antigen binding domain in any format. One of skill in the art would not consider the ligand ECD domain the same as an antigen binding domain. Examples of domains that the polypeptide may not comprises are also described in Guedan, et al., Engineering and Design of Chimeric Antigen Receptors, Molecular Therapy: Methods & Clinical Development Vol. 12 March 2019, pp. 145-156, which is hereby incorporated by reference in its entirety. In some embodiments, these polypeptides do not comprises an ECD that comprises a binding domain that binds to a tumor antigen. In some embodiments, the polypeptide does not comprise a co-stimulatory domain. In some embodiments, the polypeptide does not comprise a CD3ζ signaling domain. In some embodiments, the polypeptide does not comprise a CD28ζ signaling domain. In some embodiments, the polypeptide does not comprise an immune receptor tyrosine-based activation motifs (ITAMs). In some embodiments, the polypeptide -30- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT does not comprise a costimulatory endodomain. In some embodiments, the polypeptide does not comprise a 4-1BB signaling or costimulatory endodomain. In some embodiments, the polypeptide does not comprise a CD28 signaling or costimulatory endodomain. In some embodiments, the polypeptide does not comprise an inducible T cell costimulator (ICOS) intracellular domain. In some embodiments, the polypeptide does not comprise a CH2, CH3, CD28, or CD8α hinge region. In some embodiments, the polypeptide comprising the ECD of G-CSFR, or a variant thereof, such as those provided for herein, does not comprise an antigen binding domain. These polypeptides can be incorporated into any of the particles provided for herein. According in some embodiments, a particle comprising the polypeptide is provided. In some embodiments, the particle is a vector (e.g., virus, a liposome, plasmid, and the like) or a cell. In some embodiments, the particle is a virus or viral vector. In some embodiments, the viral vector is a lentiviral vector, AV vector, an AAV vector, and the like. In some embodiments, the viral vector is a pseudotyped viral vector. Non-limiting examples of pseudotyped viral vector are provided for herein, but it can be pseudotyped with any viral structural protein. In some embodiments, the particle further comprises a chimeric antigen receptor, such as a chimeric antigen receptor comprising a an antigen binding domain that binds to a tumor antigen. Also provided herein are nucleic acid molecules encoding for a chimeric antigen receptor (CAR), the polypeptides, or a combination thereof. In some embodiments, the CAR is as provided for herein. In some embodiments, the CAR and the polypeptide are encoded by unique nucleic acid molecules. In some embodiments, the CAR and the polypeptide are encoded by the same nucleic acid molecule. Methods of encoding multiple proteins of interest from a single nucleic acid molecule are known in the art, and any such method is within the scope of the present disclosure. In some embodiments, the single nucleic acid molecule encodes the CAR and the polypeptide as a bicistronic molecule, wherein the CAR and the polypeptide are separated by a cleavable peptide linker. Cleavable peptide linkers are known in the art, and any such cleavable linker is within the scope of the present disclosure. In some embodiments, the cleavable peptide linker is a 2A peptide linker. In some embodiments, the nucleic acid molecule encodes for a bicistronic construct, wherein from 5’ to 3’ the nucleic acid molecule encodes for the CAR, the cleavable linker (e.g. a 2A linker), and the polypeptide. In some embodiments, the nucleic acid molecule encodes for a bicistronic construct, wherein -31- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT from 5’ to 3’ the nucleic acid molecule encodes for the polypeptide, the cleavable linker (e.g. a 2A linker), and the CAR. In some embodiments, a particle comprising the nucleic acid molecule is provided. some embodiments, the particle is a vector (e.g., virus, a liposome, plasmid, and the like) or a cell. In some embodiments, the particle is a virus or viral vector. In some embodiments, the viral vector is a lentiviral vector, AV vector, an AAV vector, and the like. In some embodiments, the viral vector is a pseudotyped viral vector. Non-limiting examples of pseudotyped viral vector are provided for herein, but it can be pseudotyped with any viral structural protein. Viral Particles Comprising Heterologous Viral Glycoprotein and Targeting Moiety In some embodiments, viral particles are provided comprising a heterologous viral glycoprotein and a targeting moiety. In some embodiments, the targeting moiety comprises a polypeptide having the formula T-S1, wherein T is a target binding domain, and S1 is a stalk portion. In some embodiments, S1 comprises a variant Fc protein, wherein the variant Fc protein comprises a transmembrane domain, such as, but not limited to a CD8 or CD28 transmembrane domain. Accordingly, in some embodiments, the stalk portion S1 comprises an N-terminus to C-terminus orientation of variant Fc – transmembrane domain. In some embodiments, the variant Fc protein comprises an effector mutation, wherein the effector mutation inhibits the interaction between the Fc protein and a Fc interacting protein, such as FcγR, C1q, FcRβ, or FcRn. In some embodiments, the S1 stalk portion is attached to the surface of the viral particle through the transmembrane domain. In some embodiments, the variant Fc protein is a variant of an IgG1 Fc, IgG2 Fc or IgG4 Fc protein. In some embodiments, the variant Fc protein comprises a variant of a sequence of SEQ ID NO: 26 (IgG1 Fc), SEQ ID NO: 27 (IgG2 Fc), or SEQ ID NO: 28 (IgG4 Fc). In some embodiments, the variant Fc protein is a variant IgG1 Fc protein (SEQ ID NO: 26). In some embodiments, the variant IgG1 Fc protein comprises one or more of the mutations that corresponds to those selected from the group consisting of: L234A, L235A, N297A, P329G, I253A, H310A, and H435A of SEQ ID NO: 26, numbered according to the EU numbering index of Kabat as described in Edelman, G M et al. “The covalent structure of an entire gammaG immunoglobulin molecule.” Proceedings of the National Academy of Sciences of the United States of America vol. 63,1 (1969): 78-85. doi:10.1073 / pnas.63.1.78, hereby incorporated by reference in its entirety. Any of the mutations L234A, L235A, N297A, -32- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT P329G, I253A, H310A, and H435A of SEQ ID NO: 26 may be present or absent and the mutations may be combined in any combination. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to L234A and L235A of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to N297A of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to P329G of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to L234A, L235A, N297A, and P329G of SEQ ID N: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to I253A of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to H310A of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to H435A of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to I253A, H310A, and H435A of SEQ ID NO: 26. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to L234A, L235A, N297A, P329G, I253A, H310A, and H435A of SEQ ID NO: 26. In some embodiments, the variant Fc protein comprising a variant IgG1 Fc protein comprises a truncation of the IgG1 Fc sequence. The truncation can comprise the deletion of any number of amino acids from the N-terminus, the C-terminus, or both of the IgG1 Fc sequence. In some embodiments, the variant Fc protein comprising a variant IgG1 Fc protein comprises a truncation of SEQ ID NO: 26. The truncation can comprises the deletion of any number of amino acids from the N-terminus, the C-terminus, or both of SEQ ID NO: 26. In some embodiments, the truncation comprises the deletion of amino acids from the N-terminus of SEQ ID NO: 26. In some embodiments, the truncation comprises the deletion of amino acids from the C-terminus of SEQ ID NO: 26. In some embodiments, the truncation comprises the deletion of amino acids from both the N-terminus and the C-terminus of SEQ ID NO: 26. In some embodiments, the truncation of SEQ ID NO: 26 comprises an amino acid sequence of SEQ ID NO: 103: EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 103) In some embodiments, the variant IgG1 Fc protein comprises one or more mutations relative to SEQ ID NO: 103 selected from the group consisting of: L19A, L20A, N82A, P114G, I38A, H95A, and H220A. It is to be understood that the positions L19, L20, N82, P114, I38, -33- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT H95, and H220 are in reference to SEQ ID NO: 103 only. The skilled artisan would readily recognize that positions L234, L235, N297, P329, I253, H310, and H435 numbered according to the EU numbering system of Kabat correspond to positions L19, L20, N82, P114, I38, H95, and H220, respectively, of SEQ ID NO: 103. Any of the mutations L19A, L20A, N82A, P114G, I38A, H95A, and H220A of SEQ ID NO: 103 may be present of absent and the mutations may be combined in any combination. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to L19A and L20A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to N82A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc comprises a mutation that corresponds to P114G of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc comprises a mutation that corresponds to L19A, L20A, N82A, and P114G of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to I38A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to H95A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to H220A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to I38A, H95A, and H220A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to L19A, L20A N82A, P114G, I38A, H95A, and H220A of SEQ ID NO: 103. In some embodiments, the variant IgG1 Fc protein comprises a mutation that corresponds to each of L18A, L19A N82A, P114G, I38A, H95A, and H220A of SEQ ID NO: 103. An exemplary variant IgG1 protein that comprises each of L18A, L19A N82A, P114G, I38A, H95A, and H220A is shown below in the amino acid sequence of SEQ ID NO: 104: EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMASRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLAQDWLNGKEY KCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNAYTQKSLSLSPGK (SEQ ID NO: 104) In some embodiments, the variant Fc protein is a variant IgG2 Fc protein (SEQ ID NO: 27). In some embodiments, the variant IgG2 Fc protein comprises one or more mutations selected from the group consisting of: N297A, P329G, I253A, H310A, and H435A as those position correspond to SEQ ID NO: 27, numbered according to the EU numbering index of Kabat. Any of the mutations N297A, P329G, I253A, H310A, and H435A of SEQ ID NO: 27 may be present or absent and the mutations may be combined in any combination. In some -34- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to N297A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to P329G of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to N297A and P329G of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to I253A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to H310A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to H435A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to I253A, H310A, and H435A of SEQ ID NO: 27. In some embodiments, the variant Fc protein comprising a variant IgG2 Fc protein comprises a truncation of the IgG2 Fc sequence. The truncation can comprise the deletion of any number of amino acids from the N-terminus, the C-terminus, or both of the IgG2 Fc sequence. In some embodiments, the variant Fc protein comprising a variant IgG2 Fc protein comprises a truncation of SEQ ID NO: 27. The truncation can comprises the deletion of any number of amino acids from the N-terminus, the C-terminus, or both of SEQ ID NO: 27. In some embodiments, the truncation comprises the deletion of amino acids from the N-terminus of SEQ ID NO: 27. In some embodiments, the truncation comprises the deletion of amino acids from the C-terminus of SEQ ID NO: 27. In some embodiments, the truncation comprises the deletion of amino acids from both the N-terminus and the C-terminus of SEQ ID NO: 27. In some embodiments, the variant Fc protein is a variant IgG4 Fc protein (SEQ ID NO: 28). In some embodiments, the variant IgG4 Fc protein comprises one or more mutations selected from the group consisting of: S228P, L235E, N297A, P329G, I253A, H310A, and H435A as those positions correspond to SEQ ID NO: 28, numbered according to the EU numbering index of Kabat. Any of the mutations S228P, L235E, N297A, P329G, I253A, H310A, and H435A of SEQ ID NO: 28 may be present or absent and the mutations may be combined in any combination. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to S228P of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to L235E of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to N297A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to P329G of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to S228P, L235E, N297A, and P329G of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds -35- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT to I253A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to H310A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to H435A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to I253A, H310A, and H435A of SEQ ID NO: 28. In some embodiments, the variant Fc protein comprising a variant IgG4 Fc protein comprises a truncation of the IgG4 Fc sequence. The truncation can comprise the deletion of any number of amino acids from the N-terminus, the C-terminus, or both of the IgG4 Fc sequence. In some embodiments, the variant Fc protein comprising a variant IgG4 Fc protein comprises a truncation of SEQ ID NO: 28. The truncation can comprises the deletion of any number of amino acids from the N-terminus, the C-terminus, or both of SEQ ID NO: 28. In some embodiments, the truncation comprises the deletion of amino acids from the N-terminus of SEQ ID NO: 28. In some embodiments, the truncation comprises the deletion of amino acids from the C-terminus of SEQ ID NO: 28. In some embodiments, the truncation comprises the deletion of amino acids from both the N-terminus and the C-terminus of SEQ ID NO: 28. In some embodiments, the stalk portion S1 comprising a variant Fc protein is given by the formula L1-Fc-L2-X1, wherein L1 is a linker or absent; Fc is the variant Fc protein; L2 is a linker or absent; and X1 is a polypeptide comprising the transmembrane domain. Accordingly, the targeting moiety comprising the formula T-S1 may also be given by the formula T-L1-Fc-L2-X1, wherein: T is a target binding domain; L1 is a linker or absent; Fc is the variant Fc protein; L2 is a linker or absent; and X1 is a polypeptide comprising the transmembrane domain. Therefore, it is to be understood that, in some embodiments, the stalk portion S1 may be given by the formula L1-Fc-L2- X1. In some embodiments, the target binding domain T is as provided for herein. In some embodiments, the variant Fc protein is as provided for herein. In some embodiments, L1 and L2 are each, independently, a polypeptide linker. In some embodiments, the polypeptide linker comprises (GGGGA)n (SEQ ID NO: 54), (GGGGS)n (SEQ ID NO: 55), (EAAAK)n (SEQ ID NO: 73), A(EAAAK)nA (SEQ ID NO: 74), (XP)n (SEQ ID NO: 75), wherein X is Ala, Lys, or Glu, GSAGSAAGSGEF (SEQ ID NO: 56), KESGSVSSEQLAQFRSLD (SEQ ID NO: 57), EGKSSGSGSESKST (SEQ ID NO: 58), AEAAAKEAAAKA (SEQ ID NO: 76), or a combination thereof, wherein each n is, independently, 1-5. In some embodiments, each n is, independently, 1. In some embodiments, each n is, independently, 2. In some embodiments, each n is, independently, 3. In some embodiments, each n is, independently, 4. In some embodiments, each n is, independently, 5. -36- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, each n is, independently, greater than 5. In some embodiments, L1 is absent. In some embodiments, L1 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 1-5. In some embodiments, L1 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 1. In some embodiments, L1 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 2. In some embodiments, L1 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 3. In some embodiments, L1 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 4. In some embodiments, L1 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55),wherein each n is, independently, 5. In some embodiments, L1is (GGGGA)n(SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, greater than 5. In some embodiments, L2 is absent. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 1-5. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 1. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 2. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 3. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 4. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, 5. In some embodiments, L2 is (GGGGA)n (SEQ ID NO: 54) or (GGGGS)n (SEQ ID NO: 55), wherein each n is, independently, greater than 5. In some embodiments, X1 comprises a polypeptide having a formula of ECD-TM- ICD, wherein ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent; TM is a transmembrane domain of a transmembrane protein; and ICD is an intracellular domain of a protein or a protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, or is absent. Accordingly, in some embodiments, the targeting moiety comprising the formula T-S1 that may also be given by the formula T-L1- Fc-L2-X1 may also be given by the formula T-L1-Fc-L2-ECD-TM-ICD, wherein T is a target binding domain; L1 is a linker or absent; Fc is the variant Fc protein; L2 is a linker or absent; ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent; TM is a transmembrane domain of a transmembrane protein; and ICD is an intracellular domain of a protein or a protein that facilitates the incorporation of the targeting moiety into the -37- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT envelope of the viral particle, or is absent. Therefore, it is to be understood that, in some embodiments, the stalk portion S1 may be given by the formula L1-Fc-L2- ECD-TM-ICD. In some embodiments, the stalk portion S1 does not comprise a variant Fc region. In some embodiments, the stalk portion S1 is given by the formula L3-X1, wherein L3 is a flexible peptide linker and X1 is a polypeptide comprising a transmembrane domain as provided for herein. Accordingly, in some embodiments, the targeting moiety comprising the formula T-S1 may also be given by the formula T-L3-X1, wherein T is a target binding domain, L3 is a flexible peptide linker, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. Therefore, it is to be understood that, in some embodiments, the stalk portion S1 may be given by the formula L3-X1. In some embodiments, the S1stalk portion is attached to the surface of the viral particle through the transmembrane domain. In some embodiments, the flexible peptide linker L3 may be any flexible peptide linker. In some embodiments, L3 is selected from the group of flexible linkers including, but not limited to, (GGGGA)n (SEQ ID NO: 54), (GGGGS)n (SEQ ID NO: 55), GSAGSAAGSGEF (SEQ ID NO: 56), KESGSVSSEQLAQFRSLD (SEQ ID NO: 57), EGKSSGSGSESKST (SEQ ID NO: 58), or any combination thereof, wherein each n is, independently, an integer selected from 1-4. In some embodiments, each n is, independently, an integer selected from 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, or 1-10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 7. In some embodiments, n is 8. In some embodiments, n is 9. In some embodiments, n is 10. In some embodiments, each n is, independently, greater than 10. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 1. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 2. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 3. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 4. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 5. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 6. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 7. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 8. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 9. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 10. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is greater than 10. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 1. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 2. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 3. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 4. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 5. In some -38- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 6. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 7. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 8. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 9. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 10. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is greater than 10. In some embodiments, L3 is GSAGSAAGSGEF (SEQ ID NO: 56). In some embodiments, L3 is KESGSVSSEQLAQFRSLD (SEQ ID NO: 57). In some embodiments, L3 is EGKSSGSGSESKST (SEQ ID NO: 58). In some embodiments, the flexible peptide linker L3 may be any flexible peptide linker. In some embodiments, L3is selected from the group of flexible linkers including, but not limited to, (GGGGA)n (SEQ ID NO: 54), (GGGGS)n (SEQ ID NO: 55), GSAGSAAGSGEF (SEQ ID NO: 56), KESGSVSSEQLAQFRSLD (SEQ ID NO: 57), EGKSSGSGSESKST (SEQ ID NO: 58), or any combination thereof, wherein each n is, independently, an integer selected from 1-4. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 1. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 2. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 3. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 4. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 1. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 2. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 3. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 4. In some embodiments, L3 is GSAGSAAGSGEF (SEQ ID NO: 56). In some embodiments, L3 is KESGSVSSEQLAQFRSLD (SEQ ID NO: 57). In some embodiments, L3 is EGKSSGSGSESKST (SEQ ID NO: 58). In some embodiments, L3 is selected from the group of flexible linkers including, but not limited to, (GGGGA)n (SEQ ID NO: 54), (GGGGS)n (SEQ ID NO: 55), GSAGSAAGSGEF (SEQ ID NO: 56), KESGSVSSEQLAQFRSLD (SEQ ID NO: 57), EGKSSGSGSESKST (SEQ ID NO: 58), or any combination thereof, wherein each n is, independently, an integer selected from 1, 2, or 4. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 4. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 1. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 2. In some embodiments, L3 is (GGGGA)n (SEQ ID NO: 54) and n is 4. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 1. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: 55) and n is 2. In some embodiments, L3 is (GGGGS)n (SEQ ID NO: -39- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 55) and n is 4. In some embodiments, L3 is GSAGSAAGSGEF (SEQ ID NO: 56). In some embodiments, L3 is KESGSVSSEQLAQFRSLD (SEQ ID NO: 57). In some embodiments, L3 is EGKSSGSGSESKST (SEQ ID NO: 58). In some embodiments, X1 comprises a polypeptide having a formula of ECD-TM- ICD, wherein ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent; TM is a transmembrane domain of a transmembrane protein; and ICD is an intracellular domain of a protein or a protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, or is absent. Accordingly, in some embodiments, the targeting moiety comprising the formula T-S1 that may also be given by the formula T-L3- X1, may also be given by the formula T-L3- ECD-TM-ICD, wherein T is a target binding domain, L3 is a flexible peptide linker ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent; TM is a transmembrane domain of a transmembrane protein; and ICD is an intracellular domain of a protein or a protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, or is absent. Therefore, it is to be understood that, in some embodiments, the stalk portion S1 may be given by the formula L3- ECD-TM-ICD. In some embodiments, the ECD is absent. In some embodiments, the ECD can be any appropriate extracellular domain or fragment thereof. In some embodiments, the ECD is from a different protein as compared to the transmembrane domain. The ECD domain can be the entire ECD domain or a fragment thereof. In some embodiments, the ECD domain is a CD8 or CD28 ECD domain, or a fragment thereof. In some embodiments, the ECD domain is a CD8 ECD domain or fragment thereof. In some embodiments, the CD8 ECD domain comprises the polypeptide of FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 59). In some embodiments, the CD8 ECD domain consists or consists essentially of the polypeptide of FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 59). In some embodiments, the ECD domain comprises a polypeptide that is 25-45 amino acids in length. In some embodiments, the ECD comprises a polypeptide that is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 59). In some embodiments, the ECD domain is a CD28 ECD domain or fragment thereof. In some embodiments, the CD28 ECD domain comprises the polypeptide of KIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 60). In some -40- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT embodiments, the CD28 ECD domain consists or consists essentially of the polypeptide of KIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 60). In some embodiments, the ECD domain comprises a polypeptide that is 25-45 amino acids in length. In some embodiments, the ECD comprises a polypeptide that is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of KIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 60). In some embodiments, the TM can be any appropriate transmembrane domain or fragment thereof. In some embodiments, the TM domain is a CD8 or CD28 TM domain or a fragment thereof. In some embodiments, the TM domain is a CD8 TM domain or fragment thereof. In some embodiments, the CD8 TMdomain comprises the polypeptide of IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 61). In some embodiments, the CD8 TM domain consists or consists essentially of the polypeptide of IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 61). In some embodiments, the TM comprises a polypeptide that is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 61). In some embodiments, the TM domain is a CD28 TM domain or fragment thereof. In some embodiments, the CD28 TM domain comprises the polypeptide of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 62). In some embodiments, the CD28 TM domain consists or consists essentially of the polypeptide of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 62). In some embodiments, the TM comprises a polypeptide that is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 62). In some embodiments, the TM domain is from the same protein as the ECD. In some embodiments, the TM domain is from a different protein as the ECD. In some embodiments, the TM domain is a CD8, or CD28 TM domain or a fragment thereof and the ECD domain is a CD8, or CD28 ECD domain or fragment thereof. In some embodiments, the TM domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 61) and the ECD domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 59). In some embodiments, the TM domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 61) and the ECD domain is at least, -41- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of KIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 60). In some embodiments, the TM domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 62) and the ECD domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 59). In some embodiments, the TM domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 62) and the ECD domain is at least, or is about, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a peptide of KIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 60). In some embodiments, the transmembrane domain is linked to an intracellular domain (ICD) of a cellular transmembrane protein, or a fragment thereof. In some embodiments, the ICD is absent. In some embodiments, the ICD is from the same or different protein as the TM domain. In some embodiments, the ICD comprises an Env incorporation motif. An Env incorporation motif is a molecule, e.g., polypeptide, that can help to facilitate the incorporation of a protein into the envelope of the virus. A non-limiting example of an Env incorporation motif is a polypeptide comprising the amino acid sequence of NRVRQGYS (SEQ ID NO: 63). This is a non-limiting example and other peptide sequences can be used, such as, but not limited to, GGTETSQVAPA (SEQ ID NO: 64). In some embodiments, the Env incorporation motif comprises an amino acid sequence of SEQ ID NO: 63, SEQ ID NO: 64, or a combination thereof. In some embodiments, the Env incorporation motif comprises an amino acid sequence of SEQ ID NO: 63. In some embodiments, the Env incorporation motif comprises an amino acid sequence of SEQ ID NO: 64. In some embodiments, the target binding domain “T” is any polypeptide or polynucleotide that may be used to bind to a desired target. In some embodiments, T is any polypeptide, polynucleotide, or fragment thereof that binds to CD7, CD8, cKit (CD117), CD4, CD3, CD5, CD6, CD2, TCR alpha, TCR beta, TCR gamma, TCR delta, CD10, CD34, CD110, CD33, CD14, CD68, CCR7, CD62L, CD25, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, or CXCR3, A glycosylated CD43 epitope expressed on acute leukemia or lymphoma but not on hematopoietic progenitors; A glycosylated CD43 epitope expressed on non-hematopoietic cancers; A kinase anchor protein 4 (AKAP-4); Adrenoceptor beta 3 (ADRB3); AFP; Anaplastic lymphoma kinase (ALK); Androgen receptor; Angiopoietin-binding cell surface -42- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT receptor 2 (Tie 2); Auto antibody to desmoglein 1 (Dsgl); Auto antibody to desmoglein 3 (Dsg3); B7H3 (CD276); Biotin; Bone marrow stromal cell antigen 2 (BST2); BST1 / CD157; Cancer / testis antigen 1 (NY-ESO-1); Cancer / testis antigen 2 (LAGE-la); Carbonic anhydrase IX (CA1X); Carcinoembryonic antigen (CEA); CCCTC-Binding Factor (Zinc Finger Protein)- Like (BORIS or Brother of the Regulator of lmprinted Sites); CCR4; CD5; CD19; CD20; CD22; CD24; CD30; CD32 (FCGR2A); CD33; CD34; CD38; CD44v6; CD72; CD79a; CD79b; CD97; CD99; CD123; CD171; CD179a; CD179b-IGLll; CD200R; CD276 / B7H3; CD300 molecule-like family member f (CD300LF); CDH1-CD324; CDH6; CDH17; CDH19; Chromosome X open reading frame 61 (CXORF61); Claudin 6 (CLDN6); Claudinl8.2 (CLD18A2 or CLDN18A.2); CMV pp65; C-MYC epitope Tag; Cripto; CS1 (also referred to as CD2 subset 1 or CRACC or SLAMF7 or CD319 or 19A24); CSF2RA (GM-CSFR-alpha); C-type lectin domain family 12 member A (CLEC12A); C-type lectin-like molecule-1 (CLL- 1 or CLECL1); Cyclin Bl; Cytochrome P450 IB 1 (CYP1B 1); DLL3; EBV-EBNA3c; EGF- bke module- containing mucin-like hormone receptor-like 2 (EMR2); Elongation factor 2 mutated (ELF2M); Ephrin B2; Ephrin type-A receptor 2 (EphA2); Epidermal growth factor receptor (EGFR); Epidermal growth factor receptor variant III (EGFRviii); Epithelial cell adhesion molecule (EPCAM); ERG; ETS translocation-variant gene 6 located on chromosome 12p (ETV6-AML); Fc fragment of IgA receptor (FCAR or CD89); Fc receptor-like 5 (FCRL5); Fibroblast activation protein alpha (FAP); FITC; Fms Like Tyrosine Kinase 3 (FLT3); Folate receptor alpha (FRa or FR1); Folate receptor beta (FRb); Follicle stimulating hormone receptor (FSHR); Fos-related antigen 1; Fucosyl-GMl; G protein coupled receptor class C group 5 member D (GPRC5D); G protein-coupled receptor 20 (GPR20); GAD; Ganglioside G2 (GD2) ; Ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(l-4 )bDGlcp(l-l)Cer); Ganglioside GM3 (aNeu5Ac(2-3)bDClalp(l- 4)bDGlcp(l-l)Cer); GD3; GFRalpha4; Glycoprotein 100 (gplOO); Glypican-3 (GPC3); Gonadotropin Hormone receptor (CGHR or GR); GpA33; GpNMB; GPRC5D; Guanylyl cyclase C (GCC); Heat shock protein 70-2 mutated (mut hsp70- 2); Hepatitis A virus cellular receptor 1 (HAVCR1); Hexasaccharide portion of globoH glycoceramide (GloboH); High molecular weight-melanoma associated antigen (HMWMAA); HIV1 envelope glycoprotein; HLA; HLA-DOA; HLA-A; HLA-A2; HLA-B; HLA-C; HLA- DM; HLA-DOB; HLA-DP; HLA-DQ; HLA-DR; HLA-G; HTLVl-Tax; Human papilloma virus E6 (HPV E6); Human papilloma virus E7 (HPV E7); Human Telomerase reverse transcriptase (hTERT); IgE; IL13Ra2; ILl lRa; Immunoglobulin lambda-like polypeptide 1 (IGLL1); Influenza A hemagglutinin (HA); Insulin-like growth factor 1 receptor (IGF-I receptor); Interleukin 11 receptor alpha (IL-llRa); Interleukin- 13 receptor subunit alpha-2 (IL- -43- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 13Ra2 or CD213A2); Intestinal carboxyl esterase; KIT (CD117); KSHV K8.1; KSHV-gH; LAMP1 ; Legumain; Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Leutenizing hormone receptor (LHR); Lewis(Y) antigen; Lews Ag; Livl; Locus K 9 (LY6K); Low conductance chloride channel; Lymphocyte antigen 6 complex; Lymphocyte antigen 75 (LY75); Lymphocyte-specific protein tyrosine kinase (LCK); Mammary gland differentiation antigen (NY-BR-1); Melanoma antigen recognized by T cells 1 (MelanA or MARTI); Melanoma- associated antigen 1 (MAGE-A1); Melanoma cancer testis antigen-1 (MAD-CT- 1); Melanoma cancer testis antigen-2 (MAD-CT-2); Melanoma inhibitor of apoptosis (ML- IAP); Mesothelin; MPL; Mucin 1 cell surface associated (MUC1); N-Acetyl glucosaminyl- transferase V (NA17); Nectin-4; Neural cell adhesion molecule (NCAM); NKG2D; NYBR1; O-acetyl-GD2 ganglioside (OAcGD2); Olfactory receptor 51E2 (OR51E2); Oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl); P53 mutant; Paired box protein Pax-3 (PAX3); Paired box protein Pax-5 (PAX5); Pannexin 3 (PANX3); PDL1; P-glycoprotein; Placenta-specific 1 (PLAC1); Platelet-derived growth factor receptor beta (PDGFR-beta); Polysialic acid; Proacrosin binding protein sp32 (OY-TES1); Prostase; Prostate carcinoma tumor antigen-1 (PCT A-l or Galectin 8); Prostate stem cell antigen (PSCA); Prostate-specific membrane antigen (PSMA); Prostatic acid phosphatase (PAP); Prostein; Protease Serine 21 (Testisin or PRSS21); Proteasome (Prosome Macropain) Subunit Beta Type 9 (LMP2); PTK7; Ras G12V; Ras Homolog Family Member C (RhoC); Rat sarcoma (Ras) mutant; Receptor for Advanced Gly cation Endproducts (RAGE-1); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Receptor tyrosine-protein kinase ERBB2 or Her-22 / neu; Renal ubiquitous 1 (RU1); Renal ubiquitous 2 (RU2); Sarcoma translocation breakpoints; Serine 2 (TMPRSS2) ETS fusion gene; Sialyl Lewis adhesion molecule (sLe); SLAMF4; SLAMF6; Slea (CA19.9 or Sialyl Lewis Antigen); Sperm protein 17 (SPA17); Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3); Stage-specific embryonic antigen-4 (SSEA-4); STEAP1; Survivin; Synovial sarcoma X breakpoint 2 (SSX2); TCR Gamma Alternate Reading Frame Protein (TARP); TCR-beta1 chain; TCR-beta2 chain; TCR-delta chain; TCR-gamma chain; TCRgamma-delta; Telomerase; TGFbetaR2; The antigen recognized by TNT antibody; Thyroid stimulating hormone receptor (TSHR); Timl- / HVCR1; Tissue Factor 1 (TF1); Tn ag; Tn antigen ((Tn Ag) or (GalNAca-Ser / Thr)); TNF receptor family member B cell maturation (BCMA); Transglutaminase 5 (TGS5); Transmembrane protease; TROP2; Tumor endothelial marker 1 (TEM1 / CD248); Tumor endothelial marker 7-related (TEM7R); Tumor protein p53 -44- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT (p53); Tumor-associated glycoprotein 72 (TAG72); Tyrosinase; Tyrosinase-related protein 2 (TRP-2); Uroplakin 2 (UPK2); Vascular endothelial growth factor receptor 2 (VEGFR2); V- myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Wilms tumor protein (WT1); or X Antigen Family Member 1A (XAGE1). In some embodiments, the targeting moiety “T” binds to CD7. In some embodiments, the target binding domain “T” binds to CD8. In some embodiments, the target binding domain “T” is an antibody. It is to be understood that in the context of the present disclosure “antibody” not only refers to a “complete” antibody comprising two identical heavy chains, two identical light chains, and two antigen binding fragments, but also refers to antibodies of any isotype, fragments of antibodies including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single chain antibodies (scAb), single domain antibodies (dAb), single domain heavy chain antibodies, single domain light chain antibodies, bi-specific antibodies, multi-specific antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein. In some embodiments, the antibody is selected from the group comprising a scFv, Fab, VHH, single domain antibody, and the like. In some embodiments, the antibody is a scFv. In some embodiments the antibody is a Fab. In some embodiments, the antibody is a VHH. In some embodiments, the antibody is a single domain antibody. In some embodiments, the viral particles provided for herein are pseudotyped viral particles. In some embodiments, the viral particles are pseudotyped using viral glycoproteins of viruses of the Paramyxoviridae family. In some embodiments, the pseudotyped viral-like particles are pseudotyped using viral glycoproteins of morbillivirus, such as Measles virus. In some embodiments, the pseudotyped viral-like particles are pseudotyped using viral glycoproteins of the Measles virus. In some embodiments, the pseudotyped viral-like particles are pseudotyped using viral glycoproteins of henipavirus, such as Nipah virus, Cedar virus, or Hendra virus. In some embodiments, the pseudotyped viral-like particles are pseudotyped using viral glycoproteins of the Nipah virus. In some embodiments, a polypeptide or an antibody as provided herein is linked via a linker to an envelope glycoprotein G or H of a virus of the Paramyxoviridae family. In some embodiments, the virus of the Paramyxoviridae family is a morbillivirus, such as Measles virus. In some embodiments, the virus of the Paramyxoviridae family is a henipavirus, such as Nipah virus, Cedar virus, or Hendra virus. As provided for herein, the viruses can be pseudotyped with a VSV-G protein, either wild-type or mutant of the same. Without being bound to any particular theory, the mutant VSV-G protein that can be used to pseudotype a virus (e.g. lentivirus) comprising a mutation -45- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT at position 182 can be used to pseudotype a virus and transduce a cell when the virus comprises a targeting moiety. This mutation inhibits or reduces the VSV-G affinity to its natural co- receptor, the LDL-R. The mutant VSV-G proteins as provided can be used, in some embodiments, to transduce a target cell and deliver a heterologous molecule to the targeted cells. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 198 as compared to SEQ ID NO: 1 or at position 182 as compared to SEQ ID NO: 2. SEQ ID NO: 1 is the full length protein and SEQ ID NO: 2 is the ectodomain of the VSV-G protein. The 16-mer signal peptide of MKCLLYLAFLFIGVNC (SEQ ID NO: 65) as shown at the N-terminus of SEQ ID NO: 1 is cleaved leaving a protein of SEQ ID NO: 2. Thus, although a mutation may be referred to in the context of SEQ ID NO: 2, it should be understood to also be made in the context of SEQ ID NO: 1, which contains the leader sequence, and thus would be a position number that is 16 more than the position recited for SEQ ID NO: 2. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a I182D mutation as compared to SEQ ID NO: 2. In some embodiments, the mutation is a I182E mutation as compared to SEQ ID NO: 2. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 198 as compared to SEQ ID NO: 10 or at position 182 as compared to SEQ ID NO: 11. SEQ ID NO: 10 is the full length protein and SEQ ID NO: 11 is the ectodomain of the VSV-G protein. The 16-mer signal peptide of MLSYLIFALVVSPILG (SEQ ID NO: 66) as shown at the N-terminus of SEQ ID NO: 10 is cleaved leaving a protein of SEQ ID NO: 11. Thus, although a mutation may be referred to in the context of SEQ ID NO: 11, it should be understood to also be made in the context of SEQ ID NO: 10, which contains the leader sequence, and thus would be a position number that is 16 more than the position recited for SEQ ID NO: 11. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a T182D mutation as compared to SEQ ID NO: 11. In some embodiments, the mutation is a T182E mutation as compared to SEQ ID NO: 11. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 198 as compared to SEQ ID NO: 12 or at position 182 as compared to SEQ ID NO: 13. SEQ ID NO: 12 is the full length protein and SEQ ID NO: 13 is the ectodomain of the VSV-G protein. The 16-mer signal peptide of MLRLFLFCFLALGAHS (SEQ ID NO: 67) as shown at the N-terminus of SEQ ID NO: 12 is cleaved leaving a protein of SEQ ID NO: 13. -46- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT Thus, although a mutation may be referred to in the context of SEQ ID NO: 13, it should be understood to also be made in the context of SEQ ID NO: 12, which contains the leader sequence, and thus would be a position number that is 16 more than the position recited for SEQ ID NO: 13. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a A182D mutation as compared to SEQ ID NO: 13. In some embodiments, the mutation is a A182E mutation as compared to SEQ ID NO: 13. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 203 as compared to SEQ ID NO: 14 or at position 182 as compared to SEQ ID NO: 15. SEQ ID NO: 14 is the full length protein and SEQ ID NO: 15 is the ectodomain of the VSV-G protein. The 21-mer signal peptide of MKMKMVIAGLILCIGILPAIG (SEQ ID NO: 68) as shown at the N-terminus of SEQ ID NO: 14 is cleaved leaving a protein of SEQ ID NO: 15. Thus, although a mutation may be referred to in the context of SEQ ID NO: 15, it should be understood to also be made in the context of SEQ ID NO: 14, which contains the leader sequence, and thus would be a position number that is 21 more than the position recited for SEQ ID NO: 15. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a V182D mutation as compared to SEQ ID NO: 15. In some embodiments, the mutation is a V182E mutation as compared to SEQ ID NO: 15. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 199 as compared to SEQ ID NO: 16 or at position 182 as compared to SEQ ID NO: 17. SEQ ID NO: 16 is the full length protein and SEQ ID NO: 17 is the ectodomain of the VSV-G protein. The 17-mer signal peptide of MTPAFILCMLLAGSSWA (SEQ ID NO: 69) as shown at the N-terminus of SEQ ID NO: 16 is cleaved leaving a protein of SEQ ID NO: 17. Thus, although a mutation may be referred to in the context of SEQ ID NO: 17, it should be understood to also be made in the context of SEQ ID NO: 16, which contains the leader sequence, and thus would be a position number that is 17 more than the position recited for SEQ ID NO: 17. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a V182D mutation as compared to SEQ ID NO: 17. In some embodiments, the mutation is a V182E mutation as compared to SEQ ID NO: 17. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 199 as compared to SEQ ID NO: 18 or at position 182 as compared to SEQ ID NO: 19. SEQ ID NO: 18 is the full length protein and SEQ ID NO: 19 is the ectodomain of the -47- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT VSV-G protein. The 17-mer signal peptide of MNFLLLTFIVLPLCSHA (SEQ ID NO: 70) as shown at the N-terminus of SEQ ID NO: 18 is cleaved leaving a protein of SEQ ID NO: 19. Thus, although a mutation may be referred to in the context of SEQ ID NO: 19, it should be understood to also be made in the context of SEQ ID NO: 18, which contains the leader sequence, and thus would be a position number that is 17 more than the position recited for SEQ ID NO: 19. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a V182D mutation as compared to SEQ ID NO: 19. In some embodiments, the mutation is a V182E mutation as compared to SEQ ID NO: 19. In some embodiments, a VSV-G protein is provided that comprises a mutation at position 199 as compared to SEQ ID NO: 20 or at position 182 as compared to SEQ ID NO: 21. SEQ ID NO: 20 is the full length protein and SEQ ID NO: 21 is the ectodomain of the VSV-G protein. The 17-mer signal peptide of MLVLYLLLSLLALGAQC (SEQ ID NO: 71) as shown at the N-terminus of SEQ ID NO: 20 is cleaved leaving a protein of SEQ ID NO: 21. Thus, although a mutation may be referred to in the context of SEQ ID NO: 21, it should be understood to also be made in the context of SEQ ID NO: 20, which contains the leader sequence, and thus would be a position number that is 17 more than the position recited for SEQ ID NO: 21. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a I182D mutation as compared to SEQ ID NO: 21. In some embodiments, the mutation is a I182E mutation as compared to SEQ ID NO: 21. As used herein, when a polypeptide is said to have a mutation as compared to a reference sequence, such comparison is based on an alignment such as using BlastP or ClustalW or ClutalOmega alignment software using default parameters. For example, position 182 can be found in SEQ ID NO: 2 and also as compared to the other strains as illustrated in FIG.3. FIG.3 illustrates a clustal alignment of the wild-type sequences of the ectodomains of the various strains of the VSV-G protein. The residue that is bolded and underlined are the residues that align to position 182 of SEQ ID NO: 2 of the various strains. SEQ ID NO: 2 refers to ectodomain of the VSV-G protein of the Indiana strain. SEQ ID NO: 11 refers to ectodomain of the VSV-G protein of the New Jersey strain. SEQ ID NO: 13 refers to ectodomain of the VSV-G protein of the Marraba strain. SEQ ID NO: 15 refers to ectodomain of the VSV-G protein of the Carajas strain. SEQ ID NO: 17 refers to ectodomain of the VSV- G protein of the Alagoa strain. SEQ ID NO: 19 refers to ectodomain of the VSV-G protein of the Cocal strain. SEQ ID NO: 21 refers to ectodomain of the VSV-G protein of the Morreton -48- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT strain. Accordingly, the residue that aligns to residues 182 as compared to SEQ ID NO: 2 can also be mutated as provided for herein. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 2 is not an alanine. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 2 is not a valine. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 2 is I182S, I182H, I182T, I182Q, or I182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 11 is T182S, T182H, T182Q, or T182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 13 is A182S, A182H, A182T, A182Q, or A182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 15 is V182S, V182H, V182T, V182Q, or V182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 17 is V182S, V182H, V182T, V182Q, or V182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 19 is V182S, V182H, V182T, V182Q, or V182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 21 is I182S, I182H, I182T, I182Q, or I182N. In some embodiments, the mutation at position 182 is not a hydrophobic residue. In some embodiments, the mutation at position 182 is a charged residue. In some embodiments, the mutation at position 182 is a negatively charged residue. Although, the mutations may be described in reference to SEQ ID NO: 1 or SEQ ID NO: 2, which is the VSV-G protein from the Indiana strain, the mutation can also be used in other strains of the VSV-G protein. For example, the mutation can be made in the New Jersey Strain of VSV-G, the Marraba strain of VSV-G, the Carajas strain of VSV-G, the Alagoa strain of VSV-G, the Cocal strain of VSV-G, or the Morreton strain of VSV-G. In some embodiments, the sequences of each are as provided herein. Examples of these can be found, for example in U.S. Patent Application Publication No. 20200216502, which is hereby incorporated by reference. For example, the wild-type full length or ectodomain of the New Jersey Strain of VSV-G are SEQ ID NO: 10 and SEQ ID NO: 11, respectively, the wild-type full length or ectodomain of Marraba strain of VSV-G are SEQ ID NO: 12 and SEQ ID NO: 13, respectively, the wild-type full length or ectodomain of Carajas strain of VSV-G are SEQ ID NO: 14 and SEQ ID NO: 15, respectively, the wild-type full length or ectodomain of Alagoa strain of VSV-G are SEQ ID NO: 16 and SEQ ID NO: 17, respectively, the wild-type full length or ectodomain of Cocal strain of VSV-G are SEQ ID NO: 18 and SEQ ID NO: 19, respectively, or the wild-type full length or ectodomain of Morreton strain of VSV-G are SEQ ID NO: 20 and SEQ ID NO: 21, respectively. -49- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT A VSV-G protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 can also comprise other mutations, such as those described in U.S. Patent Application Publication No. 20200216502, which is hereby incorporated by reference in its entirety. For example, the VSV-G protein can comprise a mutation at a position that corresponds to positions of 8, 47, 209 and / or 354 of SEQ ID NO: 2. In some embodiments, the substitution at position 8 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except Y. In some embodiments, the substitution at position 209 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except H. In some embodiments, the substitution at position 47 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution at position 354 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution is at position 47 or at position 354, or at both positions 47 and 354 are substituted by A, G, F or Q. In some embodiments, the substitution is A or Q. In some embodiments, the substitution at position 8 is an alanine, i.e., H8A. In some embodiments, the substitution at position 47 is Q or N, i.e., K47Q or K47N. In some embodiments, the protein comprises a mutation (substitution) at position 10. In some embodiments, the substitution / mutation is Q10A, Q10R, or Q10K. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 2 (or SEQ ID NO: 1 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or I182E mutation. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 11 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 11 (or SEQ ID NO: 10 if using the full length protein). In some embodiments, the polypeptide comprises a T182D or T182E mutation. In some embodiments, the VSV-G protein comprises a T182S, T182H, T182Q, or T182N mutation. -50- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 13 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 13 (or SEQ ID NO: 12 if using the full length protein). In some embodiments, the polypeptide comprises a A182D or A182E mutation. In some embodiments, the VSV-G protein comprises a A182S, A182H, A182T, A182Q, or A182N mutation. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 15 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 15 (or SEQ ID NO: 14 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 17 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 17 (or SEQ ID NO: 16 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 19 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 19 (or SEQ ID NO: 18 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 21 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 21 (or SEQ ID NO: 20 if using the full length protein). In some embodiments, -51- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT the polypeptide comprises a I182D or I182E mutation. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation. Viral Glycoproteins The mutant VSV-G proteins can be used, for example, to pseudotype a virus, such as, but not limited to a lentivirus. Accordingly, in some embodiments, a viral particle comprising a mutant VSV-G protein as provided herein are provided. In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 1. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 2 (or SEQ ID NO: 1 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or I182E mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation. In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 10. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 11 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 11 (or SEQ ID NO: 10 if using the full length protein). In some embodiments, the polypeptide comprises a T182D or T182E mutation as compared to SEQ ID NO: 11. In some embodiments, the VSV-G protein comprises a T182S, T182H, T182Q, or T182N mutation. In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 12. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 13 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 13 (or SEQ ID NO: 12 if using the full length protein). In some embodiments, the polypeptide comprises a A182D or A182E mutation as compared to SEQ ID NO: 13. In some embodiments, the VSV-G protein comprises a A182S, A182H, A182T, A182Q, or A182N mutation. -52- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 203 as compared to SEQ ID NO: 14. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 15 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 15 (or SEQ ID NO: 14 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation as compared to SEQ ID NO: 15. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation. In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 16. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 17 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 17 (or SEQ ID NO: 16 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation as compared to SEQ ID NO: 17. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation. In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 18. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 19 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 19 (or SEQ ID NO: 18 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation as compared to SEQ ID NO: 19. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation. In some embodiments, the viral particle comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 20. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 21 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 21 (or SEQ ID NO: 20 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or -53- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT I182E mutation as compared to SEQ ID NO: 21. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation. In some embodiments, the VSV-G protein further comprises a mutation at position that corresponds to positions 214 and / or 352 of SEQ ID NO: 2. In some embodiments, the residue that corresponds to position 214 of SEQ ID NO: 2 is T214. In some embodiments, the residue that corresponds to position 352 of SEQ ID NO: is T352. In some embodiments, the VSV-G protein comprises mutation that corresponds to T214N mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises mutation that corresponds to T352A mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises a T214N and T352A mutations as compared to SEQ ID NO: 2. These mutations can be combined with any other mutations as provided for herein. In some embodiments, the T214N and / or T352A mutations are combined with the I182E or I182D mutations. In some embodiments, a VSV-G protein comprises an amino acid sequence of SEQ ID NO: 22 and SEQ ID NO: 23, which combines the I182D or I182E, respectively, with the T214N and T352A mutations. The sequences are also illustrated below with the leader sequences, which are removed during protein processing. VSV-G Protein_ I196D, T230N and T368A mutations (with leader sequence and adjusted numbering) MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSDLN WHNDLIGTALQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPK YITHSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVI VQVTPHHVLVDEYTGEWVDSQFINGKCSNYICPTVHNSTTWHSDYKV KGLCDSNLDSMDITFFSEDGELSSLGKEGTGFRSNYFAYENGGKACK MQYCKHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQTSV DVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSYLAPKNPGTGPAFT IINGTLKYFETRYIRVDIAAPILSRMVGMISGTTAERELWDDWAPYEDV EIGPNGVLRTSSGYKFPLYMIGHGMLDSDLHLSSKAQVFEHPHIQDAA SQLPDDESLFFGDTGLSKNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVL RVGIHLCIKLKHTKKRQIYTDIEMNRLGK (SEQ ID NO: 24) VSV-G Protein_I182D, T214N and T352A mutations (without leader sequence) KFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLIGTALQVKMPK SHKAIQADGWMCHASKWVTTCDFRWYGPKYITHSIRSFTPSVEQCKE SIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGE -54- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT WVDSQFINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLDSMDITFFS EDGELSSLGKEGTGFRSNYFAYENGGKACKMQYCKHWGVRLPSGVW FEMADKDLFAAARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQ ETWSKIRAGLPISPVDLSYLAPKNPGTGPAFTIINGTLKYFETRYIRVDI AAPILSRMVGMISGTTAERELWDDWAPYEDVEIGPNGVLRTSSGYKFP LYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDDESLFFGDTGLS KNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKR QIYTDIEMNRLGK (SEQ ID NO: 22) VSV-G Protein with I196E, T230N and T368A mutations (with leader sequence and adjusted numbering) MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSDLN WHNDLIGTALQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPK YITHSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVI VQVTPHHVLVDEYTGEWVDSQFINGKCSNYICPTVHNSTTWHSDYKV KGLCDSNLESMDITFFSEDGELSSLGKEGTGFRSNYFAYENGGKACKM QYCKHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQTSVD VSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSYLAPKNPGTGPAFTII NGTLKYFETRYIRVDIAAPILSRMVGMISGTTAERELWDDWAPYEDVE IGPNGVLRTSSGYKFPLYMIGHGMLDSDLHLSSKAQVFEHPHIQDAAS QLPDDESLFFGDTGLSKNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVL RVGIHLCIKLKHTKKRQIYTDIEMNRLGK (SEQ ID NO: 25) VSV-G Protein with I182E, T214N and T352A mutations (without leader sequences) KFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLIGTALQVKMPK SHKAIQADGWMCHASKWVTTCDFRWYGPKYITHSIRSFTPSVEQCKE SIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGE WVDSQFINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLESMDITFFS EDGELSSLGKEGTGFRSNYFAYENGGKACKMQYCKHWGVRLPSGVW FEMADKDLFAAARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQ ETWSKIRAGLPISPVDLSYLAPKNPGTGPAFTIINGTLKYFETRYIRVDI AAPILSRMVGMISGTTAERELWDDWAPYEDVEIGPNGVLRTSSGYKFP LYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDDESLFFGDTGLS KNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKR QIYTDIEMNRLGK (SEQ ID NO: 23) -55- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT The other strains of the VSV-G protein as described herein can also comprises the mutations that correspond to T214N and / or T352A in SEQ ID NO: 2 and as illustrated in SEQ ID NO: 22 and SEQ ID NO: 23. In some embodiments, the composition comprises a mutation as described in Hwang et al., Gene Ther 2013 Aug;20(8):807-15. (Epub 2013 Jan 31), which is hereby incorporated by reference in its entirety. For example, the mutations can be. at positions 230, 368, 66, and / or 162 that corresponds to SEQ ID NO: 1. The positions will be 16 positions less as compared to SEQ ID NO: 2, when the leader sequence is removed. In some embodiments, the mutations at those positions are, for example, T230N, T368A, K66T, S162T, or any combination thereof. In some embodiments, the VSV-G protein comprises a T230N and a T368A mutation. In some embodiments, the VSV-G polypeptide comprises a K66T, S162T, T230N, and a T368A. These positions are those that correspond to the positions in the full length protein (SEQ ID NO: 1). In some embodiments, the VSV-G protein comprises T230N mutation, a T368A mutation, a K66T mutation, a S162T mutation, or any combination thereof. In some embodiments, the VSV-G protein further comprises one or more mutations in addition to the mutation that corresponds to position 182 of SEQ ID NO: 2, such as those described in U.S. Patent Application Publication No. 20200216502, which is hereby incorporated by reference in its entirety. For example, the VSV-G protein can further comprise a mutation at a position that corresponds to positions of 8, 47, 209 and / or 354 of SEQ ID NO: 2. In some embodiments, the substitution at position 8 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except Y. In some embodiments, the substitution at position 209 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except H. In some embodiments, the substitution at position 47 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution at position 354 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution is at position 47 or at position 354, or at both positions 47 and 354 are substituted by A, G, F or Q. In some embodiments, the substitution is A or Q. In some embodiments, the substitution at position 8 is an alanine, i.e., H8A. In some embodiments, the substitution at position 47 is Q or N, i.e., K47Q or K47N. In some embodiments, the protein comprises a mutation (substitution) at position 10. In some embodiments, the substitution / mutation is Q10A, Q10R, or Q10K. -56- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT Additionally, in some embodiments, instead of the VSV-G protein or mutant thereof, the viruses can be pseudotyped with other viral structural proteins. For example, the viral particle can be pseudotyped with a Spring viremia of carp virus G (SVCV-G) protein and transduce a cell when the virus comprises a targeting moiety. The Spring viremia of carp virus G protein as provided can be used, in some embodiments, to transduce a target cell and deliver a heterologous molecule to the targeted cells. In some embodiments, a Spring viremia of carp virus G protein is provided that comprises SEQ ID NO: 52. SEQ ID NO: 52 is the full length protein and SEQ ID NO: 53 is the ectodomain of the Spring viremia of carp virus G protein that has the N-terminal signal peptide removed. Accordingly, in some embodiments, the protein comprises an amino acid sequence of SEQ ID NO: 53. The Spring viremia of carp virus G protein can be used, for example, to pseudotype a virus, such as, but not limited to a lentivirus. Accordingly, in some embodiments, a viral particle comprising a Spring viremia of carp virus G protein as provided herein are provided. In some embodiments, the viral particle comprises a Spring viremia of carp virus G protein comprising SEQ ID NO: 52 or SEQ ID NO: 53 or sequence that is at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 52 or SEQ ID NO: 53. The sequence of Spring Viremia of Carp Virus – G (SEQ ID NO: 52-with leader sequence) MSIISYIAFLLLIDSNLGIPIFVPSGRNISWQPVIQPFDYQCPIHGNLPNTMGLSATKLTIK SPSVFSTDKVSGWICHAAEWKTTCDYRWYGPQYITHSIHPISPTIDECRRIIQRIASGTDED LGFPPQSCGWASVTTVSNTNYRVVPHSVHLEPYGGHWIDHEFNGGECREKVCEMKGNHSIWI TEETVQHECAKHIEEVEGIMYGNVPRGDVMYANNFIIDRHHRVYRFGGSCQMKFCNKDGIKF ARGDWVEKTAGTLTTIHDNVPKCVDGTLVSGHRPGLDLIDTVFNLENVVEYTLCEGTKRKIN KQEKLTSVDLSYLAPRIGGFGSVFRVRNGTLERGSTTYIRIEVEGPIVDSLNGTDPRTNASR VFWDDWELDGNIYQGFNGVYKGKDGKIHIPLNMIESGIIDDELQHAFQADIIPHPHYDDDEI REDDIFFDNTGENGNPVDAVVEWVSGWGTSLKFFGMTLVALILIFLLIRCCVACTYLMKRSK RPATESHEMRSLV The sequence of Spring Viremia of Carp Virus – G (SEQ ID NO: 53-without leader sequence): IPIFVPSGRNISWQPVIQPFDYQCPIHGNLPNTMGLSATKLTIKSPSVFSTDKVSGWICHAA EWKTTCDYRWYGPQYITHSIHPISPTIDECRRIIQRIASGTDEDLGFPPQSCGWASVTTVSN TNYRVVPHSVHLEPYGGHWIDHEFNGGECREKVCEMKGNHSIWITEETVQHECAKHIEEVEG IMYGNVPRGDVMYANNFIIDRHHRVYRFGGSCQMKFCNKDGIKFARGDWVEKTAGTLTTIHD NVPKCVDGTLVSGHRPGLDLIDTVFNLENVVEYTLCEGTKRKINKQEKLTSVDLSYLAPRIG GFGSVFRVRNGTLERGSTTYIRIEVEGPIVDSLNGTDPRTNASRVFWDDWELDGNIYQGFNG VYKGKDGKIHIPLNMIESGIIDDELQHAFQADIIPHPHYDDDEIREDDIFFDNTGENGNPVD -57- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT AVVEWVSGWGTSLKFFGMTLVALILIFLLIRCCVACTYLMKRSKRPATESHEMRSLV Targeting Moieties In some embodiments, the viral particle comprises a targeting moiety having the formula T-S1, wherein T is a target binding domain and S1 is a stalk portion. The targeting moiety can be used to target the viral particle comprising the mutant VSV-G protein or the SVCV-G protein to a cell that expresses the target to which the targeting moiety binds to. In some embodiments, the target binding domain is an antibody, a scFv antibody, an antigen binding domain, an ankyrin repeat (e.g., DARPIN), a VHH domain antibody, a nanobody, single domain antibody, a FN3 domain, or any combination thereof. The target binding domain can be attached to the viral surface through a variant Fc protein (e.g. L1-Fc-L2-X1) as provided for herein or through a flexible polypeptide (e.g., L3-X1) as provided for herein. In some embodiments, the targeting moiety is attached (fused or linked) an envelope glycoprotein G or H of a virus of the Paramyxoviridae family, such as a morbillivirus, such as Measles virus, or a henipavirus, such as Nipah virus, Cedar virus, or Hendra virus. In some embodiments, the targeting moiety can be attached (fused or linked) to a glycoprotein of a virus of the Rhabdoviridae family, such as a vesicular stomatitis New Jersey virus, a vesicular stomatitis Indiana virus, a vesicular stomatitis Alagoas virus, a vesicular stromatitis Maraba virus, a vesicular stomatitis Carajas virus, Parainfluenza virus, Spodoptera frugiperda rhabdovirus isolate Sf G, Drosophila obscura sigmavirus 10A, Wuhan insect virus 7, Perch virus, or Spring viremia of carp virus. In some embodiments, the VSV protein is the mutated proteins, such as those provided for herein. In some embodiments, the targeting moiety is attached to a glycoprotein of a virus of the Filoviridae family, such as Ebola virus or a glycoprotein of a virus of the Arenaviridae family, such as Machupo virus. In some embodiments, the target binding domain is a scFv. In some embodiments, the target binding domain is a single domain antibody. In some embodiments, the target binding domain is a VHH. In some embodiments, the targeting moiety binds to CD7, CD8, cKit (CD117), CD4, CD3, CD5, CD6, CD2, TCR alpha, TCR beta, TCR gamma, TCR delta, CD10, CD34, CD110, CD33, CD14, CD68, CCR7, CD62L, CD25, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, or CXCR3, A glycosylated CD43 epitope expressed on acute leukemia or lymphoma but not on hematopoietic progenitors; A glycosylated CD43 epitope expressed on non-hematopoietic cancers; A kinase anchor protein 4 (AKAP-4); Adrenoceptor beta 3 (ADRB3); AFP; Anaplastic lymphoma kinase (ALK); Androgen receptor; Angiopoietin-binding cell surface -58- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT receptor 2 (Tie 2); Auto antibody to desmoglein 1 (Dsgl); Auto antibody to desmoglein 3 (Dsg3); B7H3 (CD276); Biotin; Bone marrow stromal cell antigen 2 (BST2); BST1 / CD157; Cancer / testis antigen 1 (NY-ESO-1); Cancer / testis antigen 2 (LAGE-la); Carbonic anhydrase IX (CA1X); Carcinoembryonic antigen (CEA); CCCTC-Binding Factor (Zinc Finger Protein)- Like (BORIS or Brother of the Regulator of lmprinted Sites); CCR4; CD5; CD19; CD20; CD22; CD24; CD30; CD32 (FCGR2A); CD33; CD34; CD38; CD44v6; CD72; CD79a; CD79b; CD97; CD99; CD123; CD171; CD179a; CD179b-IGLll; CD200R; CD276 / B7H3; CD300 molecule-like family member f (CD300LF); CDH1-CD324; CDH6; CDH17; CDH19; Chromosome X open reading frame 61 (CXORF61); Claudin 6 (CLDN6); Claudinl8.2 (CLD18A2 or CLDN18A.2); CMV pp65; C-MYC epitope Tag; Cripto; CS1 (also referred to as CD2 subset 1 or CRACC or SLAMF7 or CD319 or 19A24); CSF2RA (GM-CSFR-alpha); C-type lectin domain family 12 member A (CLEC12A); C-type lectin-like molecule-1 (CLL- 1 or CLECL1); Cyclin Bl; Cytochrome P450 IB 1 (CYP1B 1); DLL3; EBV-EBNA3c; EGF- bke module- containing mucin-like hormone receptor-like 2 (EMR2); Elongation factor 2 mutated (ELF2M); Ephrin B2; Ephrin type-A receptor 2 (EphA2); Epidermal growth factor receptor (EGFR); Epidermal growth factor receptor variant III (EGFRviii); Epithelial cell adhesion molecule (EPCAM); ERG; ETS translocation-variant gene 6 located on chromosome 12p (ETV6-AML); Fc fragment of IgA receptor (FCAR or CD89); Fc receptor-like 5 (FCRL5); Fibroblast activation protein alpha (FAP); FITC; Fms Like Tyrosine Kinase 3 (FLT3); Folate receptor alpha (FRa or FR1); Folate receptor beta (FRb); Follicle stimulating hormone receptor (FSHR); Fos-related antigen 1; Fucosyl-GMl; G protein coupled receptor class C group 5 member D (GPRC5D); G protein-coupled receptor 20 (GPR20); GAD; Ganglioside G2 (GD2) ; Ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(l-4 )bDGlcp(l-l)Cer); Ganglioside GM3 (aNeu5Ac(2-3)bDClalp(l- 4)bDGlcp(l-l)Cer); GD3; GFRalpha4; Glycoprotein 100 (gplOO); Glypican-3 (GPC3); Gonadotropin Hormone receptor (CGHR or GR); GpA33; GpNMB; GPRC5D; Guanylyl cyclase C (GCC); Heat shock protein 70-2 mutated (mut hsp70- 2); Hepatitis A virus cellular receptor 1 (HAVCR1); Hexasaccharide portion of globoH glycoceramide (GloboH); High molecular weight-melanoma associated antigen (HMWMAA); HIV1 envelope glycoprotein; HLA; HLA-DOA; HLA-A; HLA-A2; HLA-B; HLA-C; HLA- DM; HLA-DOB; HLA-DP; HLA-DQ; HLA-DR; HLA-G; HTLVl-Tax; Human papilloma virus E6 (HPV E6); Human papilloma virus E7 (HPV E7); Human Telomerase reverse transcriptase (hTERT); IgE; IL13Ra2; ILl lRa; Immunoglobulin lambda-like polypeptide 1 (IGLL1); Influenza A hemagglutinin (HA); Insulin-like growth factor 1 receptor (IGF-I receptor); Interleukin 11 receptor alpha (IL-llRa); Interleukin- 13 receptor subunit alpha-2 (IL- -59- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 13Ra2 or CD213A2); Intestinal carboxyl esterase; KIT (CD117); KSHV K8.1; KSHV-gH; LAMP1 ; Legumain; Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Leutenizing hormone receptor (LHR); Lewis(Y) antigen; Lews Ag; Livl; Locus K 9 (LY6K); Low conductance chloride channel; Lymphocyte antigen 6 complex; Lymphocyte antigen 75 (LY75); Lymphocyte-specific protein tyrosine kinase (LCK); Mammary gland differentiation antigen (NY-BR-1); Melanoma antigen recognized by T cells 1 (MelanA or MARTI); Melanoma- associated antigen 1 (MAGE-A1); Melanoma cancer testis antigen-1 (MAD-CT- 1); Melanoma cancer testis antigen-2 (MAD-CT-2); Melanoma inhibitor of apoptosis (ML- IAP); Mesothelin; MPL; Mucin 1 cell surface associated (MUC1); N-Acetyl glucosaminyl- transferase V (NA17); Nectin-4; Neural cell adhesion molecule (NCAM); NKG2D; NYBR1; O-acetyl-GD2 ganglioside (OAcGD2); Olfactory receptor 51E2 (OR51E2); Oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl); P53 mutant; Paired box protein Pax-3 (PAX3); Paired box protein Pax-5 (PAX5); Pannexin 3 (PANX3); PDL1; P-glycoprotein; Placenta-specific 1 (PLAC1); Platelet-derived growth factor receptor beta (PDGFR-beta); Polysialic acid; Proacrosin binding protein sp32 (OY-TES1); Prostase; Prostate carcinoma tumor antigen-1 (PCT A-l or Galectin 8); Prostate stem cell antigen (PSCA); Prostate-specific membrane antigen (PSMA); Prostatic acid phosphatase (PAP); Prostein; Protease Serine 21 (Testisin or PRSS21); Proteasome (Prosome Macropain) Subunit Beta Type 9 (LMP2); PTK7; Ras G12V; Ras Homolog Family Member C (RhoC); Rat sarcoma (Ras) mutant; Receptor for Advanced Gly cation Endproducts (RAGE-1); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Receptor tyrosine-protein kinase ERBB2 or Her-22 / neu; Renal ubiquitous 1 (RU1); Renal ubiquitous 2 (RU2); Sarcoma translocation breakpoints; Serine 2 (TMPRSS2) ETS fusion gene; Sialyl Lewis adhesion molecule (sLe); SLAMF4; SLAMF6; Slea (CA19.9 or Sialyl Lewis Antigen); Sperm protein 17 (SPA17); Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3); Stage-specific embryonic antigen-4 (SSEA-4); STEAP1; Survivin; Synovial sarcoma X breakpoint 2 (SSX2); TCR Gamma Alternate Reading Frame Protein (TARP); TCR-beta1 chain; TCR-beta2 chain; TCR-delta chain; TCR-gamma chain; TCRgamma-delta; Telomerase; TGFbetaR2; The antigen recognized by TNT antibody; Thyroid stimulating hormone receptor (TSHR); Timl- / HVCR1; Tissue Factor 1 (TF1); Tn ag; Tn antigen ((Tn Ag) or (GalNAca-Ser / Thr)); TNF receptor family member B cell maturation (BCMA); Transglutaminase 5 (TGS5); Transmembrane protease; TROP2; Tumor endothelial marker 1 (TEM1 / CD248); Tumor endothelial marker 7-related (TEM7R); Tumor protein p53 -60- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT (p53); Tumor-associated glycoprotein 72 (TAG72); Tyrosinase; Tyrosinase-related protein 2 (TRP-2); Uroplakin 2 (UPK2); Vascular endothelial growth factor receptor 2 (VEGFR2); V- myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Wilms tumor protein (WT1); or X Antigen Family Member 1A (XAGE1). In some embodiments, the targeting moiety binds to CD7. In some embodiments, the targeting moiety binds to CD8. In some embodiments, the targeting moiety binds to a target that is present on a cell, such as an immune cell. In some embodiments, the cell is an immune cell, such as, but not limited to, T cell, B cell; NK cell, dendritic cell, neutrophils, macrophages, a cancer cell; or, for example, CD3+ T cell; CD4+ T cell; CD7+ T cell, CD8+ T cell; CD19+ B cell; CD19+ cancer cell; CD20+ B cell; CD20+ cancer cell; CD30+ lung epithelial cell; CD34+ haematopoietic stem cell; CD105+ endothelial cell; CD105+ haematopoietic stem cell; CD117+ haematopoietic stem cell; CD133+ cancer cell; EpCAM+ cancer cell; GluA2+ neuron; GluA4+ neuron; Haematopoietic stem cell; Hepatocyte; Her2 / Neu+ cancer cell; NKG2D+ natural killer cell; SLC1A3+ astrocyte; SLC7A10+ adipocyte. In some embodiments, the cell is a T cell. In some embodiments, the cell is a B cell. In some embodiments, the cell is a CD7+ T cell and / or CD8+ T cell. CD7 binding polypeptides In some embodiments, the targeting moiety (e.g. polypeptide) binds to CD7. In some embodiments, the polypeptide that binds to CD7 is an antibody which binds to non-human primate CD7. In some embodiments, the polypeptide that binds to CD7 is an antibody which binds to human CD7. The sequence of human CD7 (UniProtKB P09564) is as follows (SEQ ID NO: 29): MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGG LRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLS DTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGS ALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWR DKNSAACVVYEDMSHSRCNTLSSPNQYQ (SEQ ID NO: 29). In some embodiments, the CD7 that the polypeptide binds to is expressed on the surface of a cell. In some embodiments, the cell is an immune cell. In some embodiments, the immune cell is a CD7+ T cell, CD4+ T cell, CD8+ T cell, NK cell, alpha-beta T cell, gamma- delta T cell, lymphoid progenitor cell, hematopoietic stem cell, myeloid cell, monocyte, macrophage, central memory T cell, effector memory T cell, stem-cell like memory T cells, -61- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT naïve T cell, activated T cell, regulatory T cell (TReg), terminally differentiated effector memory T cell (TEMRA), resident memory T cell (TRM) or a T-cellCD8+CCR7+. In some embodiments, the antibody comprises a Fc region. The Fc region can be linked to the heavy or light chain of the antibody. In some embodiments, the Fc region is an IgG Fc. In some embodiments, the IgG is selected from IgG1, IgG2, IgG3, or IgG4. In some embodiments, the IgG fc is IgG1 Fc. In some embodiments, the antibody comprises an Fc constant region as set forth herein, such as SEQ ID NO: 26, 27, or 28 or a mutant thereof as provided for herein. In some embodiments, polypeptides (e.g. CD7-binding polypeptide) are provided herein. In some embodiments, antibodies (e.g. an anti-CD7 antibody) are provided herein. In some embodiments, the antibody is a recombinant antibody that binds to CD7. In some embodiments, the CD7 protein is a human CD7 protein. In some embodiments, the CD7 protein is a non-human CD7 protein (e.g., mouse, rat, pig, dog, non-human primate). As used herein, the term “recombinant antibody” refers to an antibody that is not naturally occurring. In some embodiments, the term “recombinant antibody” refers to an antibody that is not isolated from a human subject. In some embodiments, an antibody, or antigen binding fragment thereof is provided, wherein the antibody or antibody fragment comprises a peptide selected from the following table, which illustrate the CDRs based on Kabat numbering. Kabat CDRs Ab ID No HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 T In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy or light chain CDR as provided in the tables above. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy or light chain CDR as provided in the tables above and binds to non-human primate CD7. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy or light chain CDR as provided in the tables above and binds to human CD7. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence selected from SEQ ID NO: 33-35. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence of SEQ ID NO: 33. In some embodiments, a polypeptide, -62- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence of SEQ ID NO: 34. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence of SEQ ID NO: 35. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence selected from SEQ ID NO: 30-32. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence of SEQ ID NO: 30. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence of SEQ ID NO: 31. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence of SEQ ID NO: 32. The CDRs referenced in the embodiments throughout the present specification can be interchanged with the CDRs that are characterized by different formats, such as Chothia and IMGT. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain variable region having a LCDR1, a LCDR2, and a LCDR3, wherein the LCDR1 has a sequence of SEQ ID NO: 33, the LCDR2 has a sequence of SEQ ID NO: 34, and the LCDR3 has a sequence of SEQ ID NO: 35. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain variable region having a HCDR1, a HCDR2, and a HCDR3, wherein the HCDR1 has a sequence of SEQ ID NO: 30, the HCDR2 has a sequence of SEQ ID NO: 31, and the HCDR3 has a sequence of SEQ ID NO: 32. In some embodiments, a polypeptide, an antibody or antibody binding fragment thereof, comprises: (i) a light chain having any one of the foregoing recited combinations of LCDR1, LCDR2, and LCDR3 sequences; and (ii) a heavy chain having any one of the foregoing recited combinations of HCDR1, HCDR2, and HCDR3 sequences. The different CDR motifs can be combined in any combination including those not depicted in the table above. For example, the following embodiments are provided as non- limiting examples of such combinations. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises: (i) a light chain variable region comprising light chain CDRl, CDR2, and CDR3 sequences, wherein the light chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 33; the light chain CDR2 has the amino acid sequence of SEQ ID NO: 34; and the light chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 35; and (ii) a heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 sequences, wherein the -63- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT heavy chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 30; the heavy chain CDR2 sequence has the amino acid sequence of SEQ ID NO: 31; and the heavy chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 32; or variants of any of the foregoing. Although the preceding paragraphs may make reference to CDRs under the Kabat system the equivalent CDR sequences can be used from the IMGT and CHOTHIA designations. In some embodiments, the light chain variable region CDR1 is replaced with any of the other light chain CDR1 sequences. In some embodiments, the light chain variable region CDR2 is replaced with any of the other light chain CDR2 sequences. In some embodiments, the light chain variable region CDR3 is replaced with any of the other light chain CDR3 sequences. In some embodiments, the heavy chain variable region CDR1 is replaced with any of the other heavy chain CDR1 sequences. In some embodiments, the heavy chain variable region CDR2 is replaced with any of the other heavy chain CDR2 sequences. In some embodiments, the heavy chain variable region CDR3 is replaced with any of the other heavy chain CDR3 sequences. In some embodiments, the polypeptide comprises a heavy chain variable region peptide having one of the following sequences, or a variant thereof: SEQ ID NO: AB ID NO. Sequence L D In some embodiments, the polypeptide comprises a light chain variable region peptide having one of the following sequences, or a variant thereof: SEQ ID NO: AB ID NO. Sequence R Q In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VH peptide of SEQ ID NO: 36. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VL peptide of SEQ ID NO: 37. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VH peptide and a VL peptide, wherein the wherein the VH peptide comprises a sequence of SEQ ID NO: 36, or a variant thereof; and the VL peptide comprises a sequence of SEQ ID NO: 37, or a variant thereof. In some embodiments, a polypeptide, an antibody, or antigen binding -64- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT fragment thereof, comprises a VH peptide and a VL peptide, wherein the wherein the VH peptide comprises a sequence of SEQ ID NO: 36, or a variant thereof; and the VL peptide comprises a sequence of SEQ ID NO: 37, or a variant thereof, and the polypeptide, the antibody, or antigen binding fragment thereof, binds to non-human primate CD7. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VH peptide and a VL peptide, wherein the wherein the VH peptide comprises a sequence of SEQ ID NO: 36, or a variant thereof; and the VL peptide comprises a sequence of SEQ ID NO: 37, or a variant thereof, and the polypeptide, the antibody, or antigen binding fragment thereof, binds to human CD7. In some embodiments, the VH peptide comprises a sequence of SEQ ID NO: 36; and the VLpeptide comprises a sequence of SEQ ID NO: 37. The VH and the VL sequences can be in any format, including, but not limited to an scFv format where the VH and VL regions are linked with a peptide linker. Examples of peptide linkers that can be used to link various peptides provided for herein include, but are not limited to: (GGGGS)n (SEQ ID NO: 55), wherein each n is independently 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, the variable regions are not linked with a peptide linker. In some embodiments, the polypeptide comprises SEQ ID NO: 36 and SEQ ID NO: 37. As provided for herein, the polypeptide, antibodies, or antigen binding fragments thereof can be variants of the sequences. The sequences of the polypeptides or antibodies can be modified to yield human IgG antibodies. The conversion of the sequences provided herein can be modified to yield other types of antibodies. The CDRs can also be linked to other antibodies, proteins, or molecules to create antibody fragments that bind CD7. In some embodiments, a polypeptide or an antibody as provided herein is a targeting moiety on the surface of an engineered viral particle. In some embodiments, the targeting moiety allows for binding to a target cell. In some embodiments, the targeting moiety is a CD7 binding moiety, such as a polypeptide or an antibody as provided herein. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38: DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYAS ESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNSWPTTFGGGTKL EIKRGGGGSGGGGSGGGGSGGGGSQVQLQQPGAELVKPGASVKLSCKASGYP FTSYWIHWVKQRPGRGLEWLGRIDPNSGDTKYNEKFKNKATLTVDKSSTTAY -65- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT MQLSSLTSEDSAVYYCARSPYYSNDNSMDYWGQGTSVTVSS (SEQ ID NO: 38) or is substantially similar to SEQ ID NO: 38, or is an active fragment of SEQ ID NO: 38. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 38. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 38. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 38. In some embodiments, the target binding domain (“T”) comprises a sequence as set forth in SEQ ID NO: 38. In some embodiments, the target binding domain (“T”) as set forth in SEQ ID NO: 38 is an antibody, or an antigen binding fragment thereof. In some embodiments, the target binding domain (“T”) is an anti-CD7 antibody. In some embodiments, a polypeptide or an antibody as provided for herein is a targeting moiety on the surface of an engineered viral particle. In some embodiments, the engineered viral particle is a pseudotyped viral-like particle. In some embodiments, the targeting moiety allows for binding to a target cell. In some embodiments, the targeting moiety is a CD7 binding moiety, such as a polypeptide or an antibody as provided herein. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 39. QVQLQQPGAELVKPGASVKLSCKASGYPFTSYWIHWVKQRPGRGLEWLGRID PNSGDTKYNEKFKNKATLTVDKSSTTAYMQLSSLTSEDSAVYYCARSPYYSN DNSMDYWGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSDILLTQSPAILSVSP GERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYASESISGIPSRFSGSGS GTDFTLSINSVESEDIADYYCQQSNSWPTTFGGGTKLEIKR (SEQ ID NO: 39) or is substantially similar to SEQ ID NO: 39, or is an active fragment of SEQ ID NO: 39. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 39. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 39. In some embodiments, the target binding domain (“T”) comprises a sequence as set forth in SEQ ID NO: 39. In some embodiments, the target binding domain (“T”) as set forth in SEQ ID NO: 39 is an antibody, or an antigen binding fragment thereof. In some embodiments, the target binding domain (“T”) is an anti-CD7 antibody. In some embodiments, the anti-CD7 antibody -66- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT binds to non-human primate CD7. In some embodiments, the anti-CD7 antibody binds to human CD7. CD8 binding polypeptides In some embodiments, the targeting moiety (e.g. a polypeptide) can bind to CD8. In some embodiments, the polypeptide binds to CD8. In some embodiments, the polypeptide binds to CD8-alpha. In some embodiments, the polypeptide binds to CD8-beta. In some embodiments, the polypeptide binds to CD8 heterodimer. In some embodiments, the CD8 heterodimer comprises CD8-alpha and CD8-beta subunits. In some embodiments, the polypeptide binds to CD8-alpha homodimer. In some embodiments, the polypeptide that binds to CD8 is an antibody which binds to non-human primate CD8. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8-alpha. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8-beta. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8-alpha homodimer. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8 heterodimer. In some embodiments, the polypeptide that binds to CD8 is an antibody which binds to human CD8. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8-alpha. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8-beta. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8-alpha homodimer. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8 heterodimer. The sequence of human CD8-alpha (UniProtKB Q8TAW8) is as follows (SEQ ID NO: 40): MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTS GCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSD FRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSL RPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNR RRVCKCPRPVVKSGDKPSLSARYV (SEQ ID NO: 40). The sequence of human CD8-beta (UniProtKB Q8TD28) is as follows (SEQ ID NO: 41): MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMR IYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLT -67- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT SVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLP RPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQLYK (SEQ ID NO: 41). In some embodiments, the CD8 that the polypeptide binds to is expressed on the surface of a cell. In some embodiments, the cell is an immune cell. In some embodiments, the immune cell is a CD7+ T cell, CD4+ T cell, CD8+ T cell, NK cell, alpha-beta T cell, gamma- delta T cell, lymphoid progenitor cell, hematopoietic stem cell, myeloid cell, monocyte, macrophage, central memory T cell, effector memory T cell, stem-cell like memory T cells, naïve T cell, activated T cell, regulatory T cell (TReg), terminally differentiated effector memory T cell (TEMRA), resident memory T cell (TRM) or a T-cell CD8+CCR7+. In some embodiments, the cell is a CD8+ T cell. In some embodiments, the cell is a CD8+ cell. In some embodiments, the antibody comprises a Fc region. The Fc region can be linked to the heavy or light chain of the antibody. In some embodiments, the Fc region is an IgG Fc. In some embodiments, the IgG is selected from IgG1, IgG2, IgG3, or IgG4. In some embodiments, the IgG Fc is IgG1 Fc. In some embodiments, the antibody comprises an Fc constant region as set forth herein, such as SEQ ID NO: 26, 27, or 28 or a variant thereof. In some embodiments, polypeptides (e.g. CD8-binding polypeptide) are provided herein. In some embodiments, antibodies (e.g. an anti-CD8 antibody) are provided herein. In some embodiments, the antibody is a recombinant antibody that binds to CD8. In some embodiments, the CD8 protein is a human CD8 protein. In some embodiments, the CD8 protein is a non-human CD8 protein (e.g., mouse, rat, pig, dog, non-human primate). As used herein, the term “recombinant antibody” refers to an antibody that is not naturally occurring. In some embodiments, the term “recombinant antibody” refers to an antibody that is not isolated from a human subject. In some embodiments, an antibody, or antigen binding fragment thereof is provided, wherein the antibody or antibody fragment comprises a peptide selected from the following table, which illustrate the CDRs based on Kabat numbering. Kabat CDRs T -68- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT (SEQ ID NO: 45) thereof, comprises a heavy or light chain CDR as provided in the tables above. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy or light chain CDR as provided in the tables above and binds to non-human primate CD8. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy or light chain CDR as provided in the tables above and binds to human CD8. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence selected from SEQ ID NO: 45-47. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence of SEQ ID NO: 45. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence of SEQ ID NO: 46. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain CDR having a sequence of SEQ ID NO: 47. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence selected from SEQ ID NO: 42-44. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence of SEQ ID NO: 42. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence of SEQ ID NO: 43. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain CDR having a sequence of SEQ ID NO: 44. The CDRs referenced in the embodiments throughout the present specification can be interchanged with the CDRs that are characterized by different formats, such as Chothia and IMGT. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a light chain variable region having a LCDR1, a LCDR2, and a LCDR3, wherein the LCDR1 has a sequence of SEQ ID NO: 45, the LCDR2 has a sequence of SEQ ID NO: 46, and the LCDR3 has a sequence of SEQ ID NO: 47. In some embodiments, a polypeptide, an antibody, or antibody binding fragment thereof, comprises a heavy chain variable region having a HCDR1, a HCDR2, and a HCDR3, -69- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT wherein the HCDR1 has a sequence of SEQ ID NO: 42, the HCDR2 has a sequence of SEQ ID NO: 43, and the HCDR3 has a sequence of SEQ ID NO: 44. In some embodiments, a polypeptide, an antibody or antibody binding fragment thereof, comprises: (i) a light chain having any one of the foregoing recited combinations of LCDR1, LCDR2, and LCDR3 sequences; and (ii) a heavy chain having any one of the foregoing recited combinations of HCDR1, HCDR2, and HCDR3 sequences. The different CDR motifs can be combined in any combination including those not depicted in the table above. For example, the following embodiments are provided as non- limiting examples of such combinations. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises: (i) a light chain variable region comprising light chain CDRl, CDR2, and CDR3 sequences, wherein the light chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 45; the light chain CDR2 has the amino acid sequence of SEQ ID NO: 46; and the light chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 47; and (ii) a heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 sequences, wherein the heavy chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 42; the heavy chain CDR2 sequence has the amino acid sequence of SEQ ID NO: 43; and the heavy chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 44; or variants of any of the foregoing. Although the preceding paragraphs may make reference to CDRs under the Kabat system the equivalent CDR sequences can be used from the IMGT and CHOTHIA designations. In some embodiments, the light chain variable region CDR1 is replaced with any of the other light chain CDR1 sequences. In some embodiments, the light chain variable region CDR2 is replaced with any of the other light chain CDR2 sequences. In some embodiments, the light chain variable region CDR3 is replaced with any of the other light chain CDR3 sequences. In some embodiments, the heavy chain variable region CDR1 is replaced with any of the other heavy chain CDR1 sequences. In some embodiments, the heavy chain variable region CDR2 is replaced with any of the other heavy chain CDR2 sequences. In some embodiments, the heavy chain variable region CDR3 is replaced with any of the other heavy chain CDR3 sequences. In some embodiments, the polypeptide comprises a heavy chain variable region peptide having one of the following sequences, or a variant thereof: -70- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT SEQ ID NO: AB ID NO. Sequence 48 CD8AB1EVQLQQSGPELVKPGASVKISCKASRYTFTDYNLHWVKLSHEKSLD having one of the following sequences, or a variant thereof: SEQ ID NO: AB ID NO. Sequence 49 CD8AB1NIVLTQSPASLAVSLGQRATISCRASESVDGFGNSFMNWYQQKPGY , , , thereof, comprises a VH peptide of SEQ ID NO: 48. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VL peptide of SEQ ID NO: 49. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VH peptide and a VL peptide, wherein the wherein the VH peptide comprises a sequence of SEQ ID NO: 48, or a variant thereof; and the VL peptide comprises a sequence of SEQ ID NO: 49, or a variant thereof. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VH peptide and a VL peptide, wherein the wherein the VH peptide comprises a sequence of SEQ ID NO: 48, or a variant thereof; and the VL peptide comprises a sequence of SEQ ID NO: 49, or a variant thereof, and the polypeptide, the antibody, or antigen binding fragment thereof, binds to non-human primate CD8. In some embodiments, a polypeptide, an antibody, or antigen binding fragment thereof, comprises a VH peptide and a VLpeptide, wherein the wherein the VHpeptide comprises a sequence of SEQ ID NO: 48, or a variant thereof; and the VL peptide comprises a sequence of SEQ ID NO: 49, or a variant thereof, and the polypeptide, the antibody, or antigen binding fragment thereof, binds to human CD8. In some embodiments, the VH peptide comprises a sequence of SEQ ID NO: 48; and the VL peptide comprises a sequence of SEQ ID NO: 49. The VH and the VL sequences can be in any format, including, but not limited to an scFv format where the VH and VL regions are linked with a peptide linker. Examples of peptide linkers that can be used to link various peptides provided for herein include, but are not limited to: (GGGGS)n (SEQ ID NO: 55), wherein each n is independently 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, the variable regions are not linked -71- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT with a peptide linker. In some embodiments, the polypeptide comprises SEQ ID NO: 48 and SEQ ID NO: 49. As provided for herein, the polypeptide, antibodies, or antigen binding fragments thereof can be variants of the sequences. The sequences of the polypeptides or antibodies can be modified to yield human IgG antibodies. The conversion of the sequences provided herein can be modified to yield other types of antibodies. The CDRs can also be linked to other antibodies, proteins, or molecules to create antibody fragments that bind CD8. In some embodiments, a polypeptide or an antibody as provided herein is a targeting moiety on the surface of an engineered viral particle. In some embodiments, the targeting moiety allows for binding to a target cell. In some embodiments, the target binding domain (“T”) is a CD8 binding moiety, such as a polypeptide or an antibody as provided herein. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50: NIVLTQSPASLAVSLGQRATISCRASESVDGFGNSFMNWYQQKPGQSPKLLI YLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPYTFGG GTKLEIKRGGGGSGGGGSGGGGSGGGGSEVQLQQSGPELVKPGASVKISCKA SRYTFTDYNLHWVKLSHEKSLEWIGFIYPYNGGTGYNQKFKNKAKLTVDYSS STAYMELRSLTSVDAAVYYCARDHRYNEGVSFDYWGQGTTLTVSS (SEQ ID NO: 50) or is substantially similar to SEQ ID NO: 50, or is an active fragment of SEQ ID NO: 50. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 50. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 50. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 50. In some embodiments, the target binding domain (“T”) comprises a sequence as set forth in SEQ ID NO: 50. In some embodiments, the target binding domain (“T”) as set forth in SEQ ID NO: 50 is an antibody, or an antigen binding fragment thereof. In some embodiments, the targeting moiety is an anti-CD8 antibody. In some embodiments, a polypeptide or an antibody as provided for herein is a targeting moiety on the surface of an engineered viral particle. In some embodiments, the engineered viral particle is a pseudotyped viral-like particle. In some embodiments, the targeting moiety allows for binding to a target cell. In some embodiments, the target binding domain (“T”) is a CD8 binding moiety, such as a polypeptide or an antibody as provided herein. -72- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 51: EVQLQQSGPELVKPGASVKISCKASRYTFTDYNLHWVKLSHEKSLEWIGFIY PYNGGTGYNQKFKNKAKLTVDYSSSTAYMELRSLTSVDAAVYYCARDHRYNE GVSFDYWGQGTTLTVSSGGGGSGGGGSGGGGSGGGGSNIVLTQSPASLAVSL GQRATISCRASESVDGFGNSFMNWYQQKPGQSPKLLIYLASNLESGVPARFS GSGSRTDFTLTIDPVEADDAATYYCQQNNEDPYTFGGGTKLEIKR (SEQ ID NO: 51) or is substantially similar to SEQ ID NO: 51, or is an active fragment of SEQ ID NO: 51. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 51. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 51. In some embodiments, the target binding domain (“T”) comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 51. In some embodiments, the target binding domain (“T”) comprises a sequence as set forth in SEQ ID NO: 51. In some embodiments, the target binding domain (“T”) as set forth in SEQ ID NO: 51 is an antibody, or an antigen binding fragment thereof. In some embodiments, the targeting moiety is an anti-CD8 antibody. In some embodiments, the anti-CD8 antibody binds to non-human primate CD8. In some embodiments, the anti-CD8 antibody binds to human CD8. Targeting moieties comprising an Fc domain In some embodiments, the VH and VL polypeptides are linked to a stalk portion S1 comprising an Fc region. In some embodiments, the Fc region is as provided for herein. In some embodiments, the Fc region is a variant Fc region as provided for herein. Non-limiting mutations in the Fc region are provided for herein. In some embodiments, the variant Fc region comprises a sequence that is a variant of SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28 as provided for herein. In some embodiments, the variant of SEQ ID NO: 26 comprises one or more mutations selected from the group consisting of L234A, L235A, N297A, P329G, I253A, H310A, and H435A as provided for herein. In some embodiments, the variant of SEQ ID NO: 27 comprises one or more mutations selected from the group consisting of N297A, P329G, I253A, H310A, and H435A as provided for herein. In some embodiments, the variant of SEQ ID NO: 28 comprises one or more mutations selected from the group consisting of S228P, L235E, N297A, P329G, I253A, H310A, and H435A as provided for herein. As provided for herein, the heavy chain can be linked to a Fc region. In -73- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT some embodiments, the Fc region further comprises (e.g.linked to) a transmembrane domain. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or is absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or is absent. Examples of ECD include, but are not limited to, a CD8 and / or CD28 extracellular domain as provided for herein. Examples of TM include, but are not limited to, a CD8 and / or CD28 transmembrane domain as provided for herein. In some embodiments, X1 comprises a TM and the ECD and ICD are absent. In some embodiments, X1 comprises an ECD, a TM, and the ICD is absent. In some embodiments, X1 comprises a TM and an ICD and the ECD is absent. In some embodiments, X1 comprises an ECD, a TM, and an ICD. In any of the following embodiments, it is to be understood that the ECD, the ICD, or both may be optionally absent. Accordingly, an embodiment wherein X1 comprises a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD comprising an Env incorporation motif is understood to encompass the following X1 members: i) a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD comprising an Env incorporation motif; ii) a CD8 and / or CD28 TM, and an ICD comprising an Env incorporation motif wherein the ECD is absent; iii) a CD8 and / or CD28 ECD, and a CD8 and / or CD28 TM, wherein the ICD is absent; and iv) a CD8 and / or CD28 TM wherein both the ECD and the ICD are absent. Similarly, an embodiment wherein X1 comprises a CD8 and / or CD28 TM and an ICD comprising an Env incorporation motif is understood to encompass the following X1 members: i) a CD8 and / or CD28 TM and an ICD comprising an Env incorporation motif; and ii) a CD8 and / or CD28 TM wherein the ICD is absent. Similarly, an embodiment wherein X1 comprises a CD8 and / or CD28 ECD and a CD8 and / or CD28 TM is understood to encompass the following X1 members: i) a CD8 and / or CD28 ECD and a CD8 and / or CD28 TM; and ii) a CD8 and / or CD28 TM wherein the ECD is absent. It is to be further understood that the preceding explanation is also true in embodiments where a specific ECD, TM, or ICD are not recited. For example, an embodiment wherein X1 comprises an ECD, a CD8 and / or CD28 TM, and an ICD would be understood to encompass the following X1 members: i) an ECD, a CD8 and / or CD28 TM, and an ICD; ii) an ECD, and a CD8 and / or CD28 TM wherein the ICD is absent; iii) a CD8 and / or CD28 TM, and an ICD wherein the ECD is absent; and iv) a CD8 -74- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT and / or CD28 TM wherein the ECD and the ICD are absent. Similarly, an embodiment wherein X1 comprises a CD8 and / or CD28 TM and an ICD is understood to encompass the following X1 members: i) a CD8 and / or CD28 TM and an ICD; and ii) a CD8 and / or CD28 TM wherein the ICD is absent. Similarly, an embodiment wherein X1 comprises an ECD and a CD8 and / or CD28 TM is understood to encompass the following X1 members: i) an ECD and a CD8 and / or CD28 TM; and ii) a CD8 and / or CD28 TM wherein the ECD is absent. Unless explicitly stated, the preceding examples and explanations are applicable to any embodiments that follow. In some embodiments, X1 comprises a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, X1comprises an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, X1 comprises a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, X1 comprises an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, X1 comprises a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, X1 comprises an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, X1 comprises a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region as provided for herein. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region comprising a transmembrane domain as provided for herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or absent. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH and VL polypeptides provided herein are linked -75- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH and VL polypeptides provided herein are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH and VL polypeptides provided herein linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD are anchored to the surface of a viral particle, such as those provided for herein. In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the VH and VL polypeptides bind to an immune cell, such as those provided herein. In some embodiments, a VH peptide having a sequence as set forth in SEQ ID NO: 36 and a VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to an a stalk portion (S1) comprising Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, -76- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VHpeptide having a sequence as set forth in SEQ ID NO: 36 and VLpeptide having a sequence as set forth in SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 36 and VL peptide having a sequence as set forth in SEQ ID NO: 37 linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD are anchored to the surface of a viral particle, such as those provided for herein. In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the VH and VL polypeptides bind to an immune cell, such as those provided herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region comprising a transmembrane domain as provided for herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having -77- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or absent. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising -78- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37 linked to a stalk portion (S1) comprising an Fc region (L1-Fc- L2-X1) comprising an ECD, a TM, and an ICD are anchored to the surface of a viral particle, such as those provided for herein. In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the VH and VL polypeptides bind to an immune cell, such as those provided herein. In some embodiments, a polypeptide is provided comprising a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, -79- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37; provided that the VH peptide and a VL peptide comprises a light chain CDR having a sequence of SEQ ID NO: 33-35; and / or a heavy chain CDR having a sequence of SEQ ID NO: 30-32. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37; provided that the VH peptide and a VL peptide comprise a light chain CDR1 having a sequence of SEQ ID NO: 33; a light chain CDR2 having a sequence of SEQ ID NO: 34; a light chain CDR3 having a sequence of SEQ ID NO: 35; and / or a heavy chain CDR1 having a sequence of SEQ ID NO: 30; a heavy chain CDR2 having a sequence of SEQ ID NO: 31; and a heavy chain CDR3 having a sequence of SEQ ID NO: 32. In some embodiments, the CDRs in the VH or VL chain are as set forth in the combinations provided for herein. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37; provided that the VL peptide comprises a LCDR1 having a sequence of SEQ ID NO: 33; a LCDR2 having a sequence of SEQ ID NO: 34; and a LCDR3 having a sequence of SEQ ID NO: 35; and the VH peptide comprises a HCDR1 having a sequence of SEQ ID NO: 30; a HCDR2 having a sequence of SEQ ID NO: 31; and a HCDR3 having a sequence of SEQ ID NO: 32. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 36; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 37; provided that the VL peptide comprises a LCDR1 having a sequence of SEQ ID NO: 33, wherein the LCDR1 comprises at most 1 conservative amino acid substitution, a LCDR2 having a sequence of SEQ ID NO: 34, wherein the LCDR2 comprises at most 1 conservative -80- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT amino acid substitution, and a LCDR3 having a sequence of SEQ ID NO: 35, wherein the LCDR3 comprises at most 1 conservative amino acid substitution; and the VH peptide comprises a HCDR1 having a sequence of SEQ ID NO: 30, wherein the HCDR1 comprises at most 1 conservative amino acid substitution, a HCDR2 having a sequence of SEQ ID NO: 31, wherein the HCDR2 comprises at most 1 conservative amino acid substitution, and a HCDR3 having a sequence of SEQ ID NO: 32, wherein the HCDR3 comprises at most 1 conservative amino acid substitution. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence of SEQ ID NO: 36 and the VL peptide comprises a sequence of SEQ ID NO: 37. In some embodiments, the polypeptide as provided herein binds to non-human primate CD7. In some embodiments, the polypeptide as provided herein binds to human CD7. As provided for herein, the different polypeptides (VH or VL) described herein can be linked with a peptide linker or not linked with a peptide linker and instead for a continuous sequence. In some embodiments, the peptide linker comprises a sequence of (GGGGS)n (SEQ ID NO: 55), wherein each n is independently 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. The linked peptide format can be represented by a formula of VH-Z-VL or VL-Z-VH, wherein Z is the peptide linker. In some embodiments, Z is (GGGGS)n (SEQ ID NO: 55), wherein each n is independently 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, the polypeptide comprising the linked peptide represented by a formula of VL-Z-VH comprises a heavy chain variable region as set forth in SEQ ID NO: 36 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a light chain variable region as set forth in SEQ ID NO: 37. In some embodiments, the polypeptide comprising a VL linked via a peptide linker to a VH has the sequence as set forth below, DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYASESIS GIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNSWPTTFGGGTKLEIKRGG GGSGGGGSGGGGSGGGGSQVQLQQPGAELVKPGASVKLSCKASGYPFTSYW IHWVKQRPGRGLEWLGRIDPNSGDTKYNEKFKNKATLTVDKSSTTAYMQLS SLTSEDSAVYYCARSPYYSNDNSMDYWGQGTSVTVSS (SEQ ID NO: 38). In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to -81- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT a sequence of SEQ ID NO: 38. In some embodiments, the polypeptide comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 38. In some embodiments, the polypeptide comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 38. In some embodiments, the polypeptide comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 38. In some embodiments, the polypeptide comprises a sequence as set forth in SEQ ID NO: 38. In some embodiments, the polypeptide as set forth in SEQ ID NO: 38 is an antibody, or an antigen binding fragment thereof. In some embodiments, the antibody is an anti-CD7 antibody. In some embodiments, the anti-CD7 antibody binds to non- human primate CD7. In some embodiments, the anti-CD7 antibody binds to human CD7. In some embodiments, the polypeptide comprising the linked peptide represented by a formula of VH-Z-VL comprises a light chain variable region as set forth in SEQ ID NO: 37 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a heavy chain variable region as set forth in SEQ ID NO: 36. In some embodiments, the polypeptide comprising a VH linked via a peptide linker to a VL has the sequence as set forth below, QVQLQQPGAELVKPGASVKLSCKASGYPFTSYWIHWVKQRPGRGLEWLGRI DPNSGDTKYNEKFKNKATLTVDKSSTTAYMQLSSLTSEDSAVYYCARSPYYS NDNSMDYWGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSDILLTQSPAILSVS PGERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYASESISGIPSRFSGSGSGT DFTLSINSVESEDIADYYCQQSNSWPTTFGGGTKLEIKR (SEQ ID NO: 39). In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39. In some embodiments, the polypeptide comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 39. In some embodiments, the polypeptide comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 39. In some embodiments, the polypeptide comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 39. In some embodiments, the polypeptide comprises a sequence as set forth in SEQ ID NO: 39. In some embodiments, the polypeptide as set forth in SEQ ID NO: 39 is an antibody, or an antigen binding fragment thereof. In some embodiments, the antibody is an anti-CD7 antibody. In some embodiments, the anti-CD7 antibody binds to non- human primate CD7. In some embodiments, the anti-CD7 antibody binds to human CD7. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region, such as those provided herein. In some embodiments, the polypeptide comprises a sequence that is -82- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region, said Fc region further comprising a transmembrane domain such as those provided herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or is absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or is absent. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide -83- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 38 and comprising a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, is anchored to the surface of a viral particle, such as those provided for herein . In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the polypeptide bind to an immune cell, such as those provided herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region, such as those provided herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region, said Fc region further comprising a transmembrane domain such as those provided herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or absent. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the -84- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 39 and comprising a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, is anchored to the surface of a viral particle, such as those provided for herein . In some -85- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the polypeptide bind to an immune cell, such as those provided herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region, such as those provided herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region, said Fc region further comprising a transmembrane domain, such as those provided herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or is absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or is absent. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an -86- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 38 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprising a sequence having a sequence as set forth in SEQ ID NO: 38 and comprising a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, is anchored to the surface of a viral particle, such as those provided for herein . In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the polypeptide bind to an immune cell, such as those provided herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region, such as those provided herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region, said Fc region further comprising a transmembrane domain, such as those provided herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or absent. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and -87- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence having a sequence as set forth in SEQ ID NO: 39 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprising a sequence having a sequence as set forth in SEQ ID NO: 39 and comprising a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, is anchored to the surface of a viral particle, such as those provided for herein . In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the polypeptide bind to an immune cell, such as those provided herein. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1, wherein T is a target binding domain and S1 is a stalk portion, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98: METDTLLLWVLLLWVPGSTGDSAQVQLQQPGAELVKPGASVKLSCKASGYPFTSYWIHWVKQRPGRGLEWLGRI DPNSGDTKYNEKFKNKATLTVDKSSTTAYMQLSSLTSEDSAVYYCARSPYYSNDNSMDYWGQGTSVTVSSGGGGS GGGGSGGGGSGGGGSDILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYASESISGIPSRFSG SGSGTDFTLSINSVESEDIADYYCQQSNSWPTTFGGGTKLEIKRASGGGGSGGGGSGGGGSEPKSCDKTHTCPPCP APEAAGGPSVFLFPPKPKDTLMASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSV LTVLAQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSLSPGKKIEVMYPPPYL DNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNRVRQGYS (SEQ ID NO: 98) or is substantially similar to SEQ ID NO: 98, or is an active fragment of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T- S1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID -88- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1, wherein T is a target binding domain and S1 is a stalk portion, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 126: SAQVQLQQPGAELVKPGASVKLSCKASGYPFTSYWIHWVKQRPGRGLEWLGRIDPNSGDTKYNEKFKNKATLTV DKSSTTAYMQLSSLTSEDSAVYYCARSPYYSNDNSMDYWGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSDILLT QSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADY YCQQSNSWPTTFGGGTKLEIKRASGGGGSGGGGSGGGGSEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTL MASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLAQDWLNGKEYKCKVSN KALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSLSPGKKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSP LFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNRVRQGYS (SEQ ID NO: 126) In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 126. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 126. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 126. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence of SEQ ID NO: 126. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1, wherein T is a target binding domain and S1 is a stalk portion, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 127: QVQLQQPGAELVKPGASVKLSCKASGYPFTSYWIHWVKQRPGRGLEWLGRIDPNSGDTKYNEKFKNKATLTVDKS STTAYMQLSSLTSEDSAVYYCARSPYYSNDNSMDYWGQGTSVTVSSGGGGSGGGGSGGGGSGGGGSDILLTQSP AILSVSPGERVSFSCRASQSIGTSIHWYQQRTNDSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQ QSNSWPTTFGGGTKLEIKRASGGGGSGGGGSGGGGSEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMAS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLAQDWLNGKEYKCKVSNKAL GAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSLSPGKKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFP GPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNRVRQGYS (SEQ ID NO: 127) -89- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 127. In some embodiments, the polypeptide provided for herein comprising the formula of T- S1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 127. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 127. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence of SEQ ID NO: 127. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1, wherein T is a target binding domain and S1is a stalk portion, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25- 283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1, wherein T is a target binding domain comprising a VH and a VL, and S1 is a stalk portion, -90- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284- 634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-S1 comprises an amino acid sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, and wherein the stalk portion “S1” of the polypeptide corresponds to amino acids 284-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1, wherein T is a target binding domain, L1 is a polypeptide linker or is absent, Fc is a variant Fc domain as provided for herein, L2 is a polypeptide linker or is absent, and X1 is a polypeptide comprising a transmembrane domain, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: -91- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25- 283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543- 634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-X1 comprises an amino acid sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1, wherein T is a target binding domain comprising a VH and a VL, L1 is a polypeptide linker or is absent, Fc is a variant Fc domain as provided for herein, L2 is a polypeptide linker or is absent, and X1 is a polypeptide comprising a transmembrane domain, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302- 542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence that is at least 90% identical to a sequence -92- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2is absent, and X1corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-X1 comprises an amino acid sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, and X1 corresponds to amino acids 543-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD, wherein T is a target binding domain, L1 is a polypeptide linker or is absent, Fc is a variant Fc domain as provided for herein, L2 is a polypeptide linker or is absent, ECD is an extracellular domain, TM is a transmembrane domain, and ICD is an intracellular domain comprising a env incorporation motif, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: -93- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-ECD-TM-ICD comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-ECD-TM-ICD comprises an amino acid sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD, wherein T is a target binding domain comprising a VH and a VL, L1 -94- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT is a polypeptide linker or is absent, Fc is a variant Fc domain as provided for herein, L2 is a polypeptide linker or is absent, ECD is an extracellular domain, TM is a transmembrane domain, and ICD is an intracellular domain comprising a env incorporation motif, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-ECD-TM-ICD comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T- L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent ECD comprises amino acids -95- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid of SEQ ID NO: 98, wherein the VH of the target binding domain corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises amino acids 284-301 of SEQ ID NO: 98, Fc comprises amino acids 302-542 of SEQ ID NO: 98, L2 is absent ECD comprises amino acids 543-584 of SEQ ID NO: 98, TM comprises amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD, wherein T is a target binding domain, L1 is a polypeptide linker or is absent, Fc is a variant Fc domain as provided for herein, L2 is a polypeptide linker or is absent, ECD is an extracellular domain, TM is a transmembrane domain, and ICD is an intracellular domain comprising a env incorporation motif, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide comprises an amino acid sequence SEQ ID NO: 39 and corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-ECD-TM-ICD comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide comprises an amino acid sequence SEQ ID NO: 39 and corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino -96- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585- 612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide comprises an amino acid sequence SEQ ID NO: 39 and corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627- 634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide comprises an amino acid sequence SEQ ID NO: 39 and corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613- 634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-ECD-TM-ICD comprises an amino acid sequence of SEQ ID NO: 98, wherein the target binding domain “T” of the polypeptide comprises an amino acid sequence SEQ ID NO: 39 and corresponds to amino acids 25-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ -97- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627- 634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD, wherein T is a target binding domain comprising a VH and a VL, L1 is a polypeptide linker or is absent, Fc is a variant Fc domain as provided for herein, L2 is a polypeptide linker or is absent, ECD is an extracellular domain, TMis a transmembrane domain, and ICD is an intracellular domain comprising a env incorporation motif, comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain comprises an amino acid sequence of SEQ ID NO: 36 and corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain comprises an amino acid sequence of SEQ ID NO: 37 and corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 90% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain comprises an amino acid sequence of SEQ ID NO: 36 and corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain comprises an amino acid sequence of SEQ ID NO: 37 and corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and -98- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613- 634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc- L2-ECD-TM-ICD comprises an amino acid sequence that is at least 95% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain comprises an amino acid sequence of SEQ ID NO: 36 and corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain comprises an amino acid sequence of SEQ ID NO: 37 and corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627- 634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence that is at least 98% identical to a sequence of SEQ ID NO: 98, wherein the VH of the target binding domain comprises an amino acid sequence of SEQ ID NO: 36 and corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain comprises an amino acid sequence of SEQ ID NO: 37 and corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627-634 of SEQ ID NO: 98. In some embodiments, the polypeptide provided for herein comprising the formula of T-L1-Fc-L2-ECD-TM-ICD comprises an amino acid sequence of SEQ ID NO: 98, wherein the VH of the target binding domain comprises an amino acid sequence of SEQ ID NO: 36 and corresponds to amino acids 25-150 of SEQ ID NO: 98, the VL of the target binding domain comprises an amino acid sequence of SEQ ID NO: 37 and -99- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT corresponds to amino acids 172-283 of SEQ ID NO: 98, L1 comprises an amino acid sequence of SEQ ID NO: 72 and corresponds to amino acids 284-301 of SEQ ID NO: 98, Fc comprises an amino acid sequence of SEQ ID NO: 104 and corresponds to amino acids 302-542 of SEQ ID NO: 98, L2 is absent, ECD comprises an amino acid sequence of SEQ ID NO: 60 and corresponds to amino acids 543-584 of SEQ ID NO: 98, TM comprises an amino acid sequence of SEQ ID NO: 62 and corresponds to amino acids 585-612 of SEQ ID NO: 98, and ICD comprises amino acids 613-634 of SEQ ID NO: 98, wherein the env incorporation motif comprises an amino acids sequence of SEQ ID NO: 63 and corresponds to amino acids 627- 634 of SEQ ID NO: 98. In some embodiments, a VHpeptide having a sequence as set forth in SEQ ID NO: 48 and a VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a -100- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT sequence as set forth in SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide having a sequence as set forth in SEQ ID NO: 48 and VL peptide having a sequence as set forth in SEQ ID NO: 49 linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD are anchored to the surface of a viral particle, such as those provided for herein. In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, the VH and VL peptides bind to an immune cell, such as those provided herein. In some embodiments, the VHpeptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region further comprising a transmembrane domain. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or is absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or is absent. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to -101- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to an a stalk portion (S1) comprising Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env -102- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 are linked to a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the VH peptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VLpeptide comprising a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49 linked to a stalk portion (S1) comprising an Fc region (L1-Fc- L2-X1) comprising an ECD, a TM, and an ICD are anchored to the surface of a viral particle, such as those provided for herein. In some embodiments, the identities of L1, Fc, L2, ECD, TM, and ICD are as provided for herein. In some embodiments, VH and VL peptides bind to an immune cell, such as those provided herein. In some embodiments, a polypeptide is provided comprising a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49; provided that the VH peptide and a VL peptide comprises a light chain CDR having a sequence of SEQ ID NO: 45-47; and / or a heavy chain CDR having a sequence of SEQ ID NO: 42-44. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: -103- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT 49; provided that the VH peptide and a VL peptide comprise a light chain CDR1 having a sequence of SEQ ID NO: 45; a light chain CDR2 having a sequence of SEQ ID NO: 46; a light chain CDR3 having a sequence of SEQ ID NO: 47; and / or a heavy chain CDR1 having a sequence of SEQ ID NO: 42; a heavy chain CDR2 having a sequence of SEQ ID NO: 43; and a heavy chain CDR3 having a sequence of SEQ ID NO: 44. In some embodiments, the CDRs in the VH or VL chain are as set forth in the combinations provided for herein. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VLpeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49; provided that the VL peptide comprises a LCDR1 having a sequence of SEQ ID NO: 45; a LCDR2 having a sequence of SEQ ID NO: 46; and a LCDR3 having a sequence of SEQ ID NO: 47; and the VH peptide comprises a HCDR1 having a sequence of SEQ ID NO: 42; a HCDR2 having a sequence of SEQ ID NO: 43; and a HCDR3 having a sequence of SEQ ID NO: 44. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 48; and the VL peptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 49; provided that the VL peptide comprises a LCDR1 having a sequence of SEQ ID NO: 45, wherein the LCDR1 comprises at most 1 conservative amino acid substitution, a LCDR2 having a sequence of SEQ ID NO: 46, wherein the LCDR2 comprises at most 1 conservative amino acid substitution, and a LCDR3 having a sequence of SEQ ID NO: 47, wherein the LCDR3 comprises at most 1 conservative amino acid substitution; and the VH peptide comprises a HCDR1 having a sequence of SEQ ID NO: 42, wherein the HCDR1 comprises at most 1 conservative amino acid substitution, a HCDR2 having a sequence of SEQ ID NO: 43, wherein the HCDR2 comprises at most 1 conservative amino acid substitution, and a HCDR3 having a sequence of SEQ ID NO: 44, wherein the HCDR3 comprises at most 1 conservative amino acid substitution. In some embodiments, the polypeptide comprises a VH peptide and a VL peptide, wherein the VH peptide comprises a sequence of SEQ ID NO: 48 and the VL peptide comprises a sequence of SEQ ID NO: 49. -104- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the polypeptide as provided herein binds to non-human primate CD8. In some embodiments, the polypeptide as provided herein binds to human CD8. As provided for herein, the different polypeptides (VH or VL) described herein can be linked with a peptide linker or not linked with a peptide linker and instead for a continuous sequence. In some embodiments, the peptide linker comprises a sequence of (GGGGS)n (SEQ ID NO: 55), wherein each n is independently 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. The linked peptide format can be represented by a formula of VH-Z-VL or VL-Z-VH, wherein Z is the peptide linker. In some embodiments, Z is (GGGGS)n (SEQ ID NO: 55), wherein each n is independently 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, the polypeptide comprising the linked peptide represented by a formula of VL-Z-VH comprises a heavy chain variable region as set forth in SEQ ID NO: 48 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a light chain variable region as set forth in SEQ ID NO: 49. In some embodiments, the polypeptide comprising a VL linked via a peptide linker to a VH has the sequence as set forth below, NIVLTQSPASLAVSLGQRATISCRASESVDGFGNSFMNWYQQKPGQSPKLLIY LASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPYTFGGGT KLEIKRGGGGSGGGGSGGGGSGGGGSEVQLQQSGPELVKPGASVKISCKASR YTFTDYNLHWVKLSHEKSLEWIGFIYPYNGGTGYNQKFKNKAKLTVDYSSST AYMELRSLTSVDAAVYYCARDHRYNEGVSFDYWGQGTTLTVSS (SEQ ID NO: 50). In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50. In some embodiments, the polypeptide comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 50. In some embodiments, the polypeptide comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 50. In some embodiments, the polypeptide comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 50. In some embodiments, the polypeptide comprises a sequence as set forth in SEQ ID NO: 50. In some embodiments, the polypeptide as set forth in SEQ ID NO: 50 is an antibody, or an antigen binding fragment thereof. In some embodiments, the antibody is an anti-CD8 antibody. In some embodiments, the anti-CD8 antibody binds to non- human primate CD8. In some embodiments, the anti-CD8 antibody binds to human CD8. -105- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT In some embodiments, the polypeptide comprising the linked peptide represented by a formula of VH-Z-VL comprises a light chain variable region as set forth in SEQ ID NO: 49 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a heavy chain variable region as set forth in SEQ ID NO: 48. In some embodiments, the polypeptide comprising a VH linked via a peptide linker to a VL has the sequence as set forth below, EVQLQQSGPELVKPGASVKISCKASRYTFTDYNLHWVKLSHEKSLEWIGFIYP YNGGTGYNQKFKNKAKLTVDYSSSTAYMELRSLTSVDAAVYYCARDHRYN EGVSFDYWGQGTTLTVSSGGGGSGGGGSGGGGSGGGGSNIVLTQSPASLAVS LGQRATISCRASESVDGFGNSFMNWYQQKPGQSPKLLIYLASNLESGVPARFS GSGSRTDFTLTIDPVEADDAATYYCQQNNEDPYTFGGGTKLEIKR (SEQ ID NO: 51). In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 51. In some embodiments, the polypeptide comprises a sequence that is at least 90% identical to a sequence of SEQ ID NO: 51. In some embodiments, the polypeptide comprises a sequence that is at least 95% identical to a sequence of SEQ ID NO: 51. In some embodiments, the polypeptide comprises a sequence that is at least 99% identical to a sequence of SEQ ID NO: 51. In some embodiments, the polypeptide comprises a sequence as set forth in SEQ ID NO: 51. In some embodiments, the polypeptide as set forth in SEQ ID NO: 51 is an antibody, or an antigen binding fragment thereof. In some embodiments, the antibody is an anti-CD8 antibody. In some embodiments, the anti-CD8 antibody binds to non- human primate CD8. In some embodiments, the anti-CD8 antibody binds to human CD8. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region, such as those provided herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region, said Fc region further comprising a transmembrane domain, such as those provided herein. In some embodiments, the Fc region further comprising a transmembrane domain has a formula of L1-Fc-L2-X1, wherein L1 is a linker as provided for herein or is absent, Fc is a variant Fc region as provided for herein, L2 is a linker as provided for herein or is absent, and X1 is a polypeptide comprising a transmembrane domain as provided for herein. As provided for herein, X1 may comprises a polypeptide having the formula ECD-TM-ICD, -106- IPTS / 128569702.2 DOCKET NO: INH-023WO PATENT wherein ECD is an extracellular domain, or a fragment thereof as provided for herein or is absent, TM is a transmembrane domain as provided for herein, and ICD is an intracellular domain as provided for herein or is absent. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a CD8 and / or CD28 TM, and an ICD In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a CD8 and / or CD28 TM, and an ICD. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region (L1-Fc-L2-X1) comprising an ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided for herein. In some embodiments, the polypeptide comprises a sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO: 50 and comprises a stalk portion (S1) comprising an Fc region (L1- Fc-L2-X1) comprising a CD8 and / or CD28 ECD, a TM, and an ICD, wherein the ICD comprises an env incorporation motif as provided f...

Claims

DOCKET NO: INH-023WO PATENT What is Claimed:

1. A particle or composition comprising one or more nucleic acid molecules encoding for: a) a chimeric antigen receptor (CAR); and b) a polypeptide comprising: i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD.

2. The particle of claim 1, wherein the immune cell activating ICD comprises the ICD of hGCSF-R, or a mutant or fragment thereof.

3. The particle of claim 2, wherein the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111, or an amino acid sequence having at least 50, 60, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same.

4. The particle of claim 3, wherein the hGCSF-R ICD does not comprise the sequence of SEQ ID NO:

110.

5. The particle of claim 2, wherein the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111 and does not comprise amino acid residues 800-813, 775-813, 750-813, 725-813, or 716-813 of SEQ ID NO: 125, or a fragment thereof, positioned to the C-terminal residue of SEQ ID NO:

111.

6. The particle of claim 2, wherein the hGCSF-R ICD comprises a sequence of SEQ ID NO: 111 and amino acid residues 716-812 of SEQ ID NO: 125, or a fragment thereof positioned to the C-terminal residue of SEQ ID NO: 111, provided that the ICD does not comprise the contiguous fragment of amino acid residues 716-813 of SEQ ID NO:

125.

7. The particle of claim 1, wherein the ECD is a GCSF-R ECD, optionally wherein the GCSF-R ECD is a human GCSF-R ECD comprising the amino acid sequence of SEQ ID NO: 107 or SEQ ID NO:

108. -258- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT 8. The particle of claim 1, wherein the ECD comprises the ECD of human growth hormone receptor (hGH-R), or a mutant or fragment thereof, wherein the ECD of human growth hormone receptor (hGH-R) comprises the amino acid sequence encoded by exons 1-7 of hGH-R, or a mutant or fragment thereof.

9. The particle of claim 8, wherein the ECD of the hGH-R comprises the mutation of C259R.

10. The particle of claim 8, wherein the ECD of the hGH-R comprises an amino acid sequence of SEQ ID NO: 114 or SEQ ID NO: 115, or an amino acid sequence having at least 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to the same.

11. The particle of claim 1, wherein the ICD comprises an ICD of glycoprotein 130 (“gp130 ICD”), or a variant or fragment thereof.

12. The particle of claim 1, wherein the ICD comprises a fragment of the GCSF-R ICD, wherein the GCSF-R ICD fragment does not comprise the STAT3, SH3 and / or the SHC domains.

13. The particle of claim 1, wherein the ICD comprises a IL-2Rβ ICD, or a fragment or variant thereof.

14. The particle of claim 1, wherein the ICD comprises a IL-7Rα ICD, or a fragment or variant thereof.

15. The particle of claim 1, wherein the ICD comprises a gp130 ICD, or a variant or fragment thereof, linked to an IL-2Rβ ICD, or fragment thereof. -259- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT 16. The particle of claim 1, wherein the transmembrane domain, comprises a GCSF-R, gp130, or hGH-R transmembrane domain.

17. The particle of claim 1, wherein the polypeptide comprises: a) an ECD that is a GCSFR-ECD, or variant thereof ; a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof ; and an immune activating ICD that is a GCSF-R ICD, or variant thereof; b) an ECD that is a hGH-R-ECD, or variant thereof ; a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof ; and immune activating ICD that is a GCSF-R ICD, or variant thereof; c) an ECD that is a hGH-R-ECD, or variant thereof; a transmembrane domain that is a gp130 transmembrane domain, or variant thereof; and an immune activating ICD that comprises a gp130 ICD, or variant thereof and a IL-2Rβ ICD, or variant thereof; or d) an ECD that is a hGH-R-ECD, or variant thereof; a transmembrane domain that is a GCSF-R transmembrane domain, or variant thereof; and an immune activating ICD that comprises a GCSF-R ICD, or variant thereof and a IL-7Rα ICD, or variant thereof.

18. The particle of claim 1, wherein the polypeptide comprises an amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124, or a variant of any of the foregoing.

19. The particle of claim 18 wherein the variant comprises a polypeptide having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO:

124.

20. The particle of claim 1, wherein the CAR comprises an antigen binding domain that binds to CD20.

21. The particle of claim 20, wherein the CAR comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, at least 90% -260- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, at least 95% identity to SEQ ID NO: 99, at least 99% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, or at least 100% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO:

129.

22. The particle of any one of claims 1-21, wherein the particle is a vector, a virus, a liposome, a plasmid, or a cell.

23. The particle of any one of claims 1-22, wherein the particle is a viral vector, wherein the viral vector is a lentiviral vector, AV vector, an AAV vector, and the like.

24. A nucleic acid molecule, including an isolated nucleic acid molecule, encoding a polypeptide comprising: i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD.

25. The nucleic acid molecule of claim 24, wherein the nucleic acid molecule encodes for the polypeptide of any one of claims 1-19.

26. The nucleic acid molecule of claim 24, wherein the polypeptide comprises an amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124, or a variant of any of the foregoing.

27. The nucleic acid molecule of claim 26 wherein the variant comprises a polypeptide having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 16, or SEQ ID NO:

20.

28. The nucleic acid molecule of any one of claims 24-27, wherein the nucleic acid molecule further encodes for a chimeric antigen receptor (CAR). -261- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT 29. A viral particle comprising a heterologous viral glycoprotein, a targeting moiety, and one or more nucleic acid molecules encoding for one or more heterologous molecules of interest, wherein the targeting moiety comprises a polypeptide having the formula T-S1, wherein T is a target binding domain and S1 is a stalk portion, and wherein the nucleic acid molecule encoding for a heterologous molecules of interest is the nucleic acid molecule of any one of claims 24-28.

30. The viral particle of claim 29, wherein the target binding domain (T) binds to CD7, CD8, cKit (CD117), CD4, CD3, CD5, CD6, CD2, TCR alpha, TCR beta, TCR gamma, TCR delta, CD10, CD34, CD110, CD33, CD14, CD68, CCR7, CD62L, CD25, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, or CXCR3, A glycosylated CD43 epitope expressed on acute leukemia or lymphoma but not on hematopoietic progenitors; A glycosylated CD43 epitope expressed on non-hematopoietic cancers; A kinase anchor protein 4 (AKAP-4); Adrenoceptor beta 3 (ADRB3); AFP; Anaplastic lymphoma kinase (ALK); Androgen receptor; Angiopoietin-binding cell surface receptor 2 (Tie 2); Auto antibody to desmoglein 1 (Dsgl); Auto antibody to desmoglein 3 (Dsg3); B7H3 (CD276); Biotin; Bone marrow stromal cell antigen 2 (BST2); BST1 / CD157; Cancer / testis antigen 1 (NY-ESO-1); Cancer / testis antigen 2 (LAGE-la); Carbonic anhydrase IX (CA1X); Carcinoembryonic antigen (CEA); CCCTC- Binding Factor (Zinc Finger Protein)-Like (BORIS or Brother of the Regulator of lmprinted Sites); CCR4; CD5; CD19; CD20; CD22; CD24; CD30; CD32 (FCGR2A); CD33; CD34; CD38; CD44v6; CD72; CD79a; CD79b; CD97; CD99; CD123; CD171; CD179a; CD179b- IGLll; CD200R; CD276 / B7H3; CD300 molecule-like family member f (CD300LF); CDH1- CD324; CDH6; CDH17; CDH19; Chromosome X open reading frame 61 (CXORF61); Claudin 6 (CLDN6); Claudinl8.2 (CLD18A2 or CLDN18A.2); CMV pp65; C-MYC epitope Tag; Cripto; CS1 (also referred to as CD2 subset 1 or CRACC or SLAMF7 or CD319 or 19A24); CSF2RA (GM-CSFR-alpha); C-type lectin domain family 12 member A (CLEC12A); C-type lectin-like molecule-1 (CLL-1 or CLECL1); Cyclin Bl; Cytochrome P450 IB 1 (CYP1B 1); DLL3; EBV-EBNA3c; EGF-bke module- containing mucin-like hormone receptor-like 2 (EMR2); Elongation factor 2 mutated (ELF2M); Ephrin B2; Ephrin type-A receptor 2 (EphA2); Epidermal growth factor receptor (EGFR); Epidermal growth factor receptor variant III (EGFRviii); Epithelial cell adhesion molecule (EPCAM); ERG; ETS translocation-variant -262- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT gene 6 located on chromosome 12p (ETV6-AML); Fc fragment of IgA receptor (FCAR or CD89); Fc receptor-like 5 (FCRL5); Fibroblast activation protein alpha (FAP); FITC; Fms Like Tyrosine Kinase 3 (FLT3); Folate receptor alpha (Fra or FR1); Folate receptor beta (FRb); Follicle stimulating hormone receptor (FSHR); Fos-related antigen 1; Fucosyl-GMl; G protein coupled receptor class C group 5 member D (GPRC5D); G protein-coupled receptor 20 (GPR20); GAD; Ganglioside G2 (GD2) ; Ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2- 3)bDGalp(l-4 )bDGlcp(l-l)Cer); Ganglioside GM3 (aNeu5Ac(2-3)bDClalp(l- 4)bDGlcp(l- l)Cer); GD3; GFRalpha4; Glycoprotein 100 (gplOO); Glypican-3 (GPC3); Gonadotropin Hormone receptor (CGHR or GR); GpA33; GpNMB; GPRC5D; Guanylyl cyclase C (GCC); Heat shock protein 70-2 mutated (mut hsp70-2); Hepatitis A virus cellular receptor 1 (HAVCR1); Hexasaccharide portion of globoH glycoceramide (GloboH); High molecular weight-melanoma associated antigen (HMWMAA); HIV1 envelope glycoprotein; HLA; HLA- DOA; HLA-A; HLA-A2; HLA-B; HLA-C; HLA-DM; HLA-DOB; HLA-DP; HLA-DQ; HLA- DR; HLA-G; HTLVl-Tax; Human papilloma virus E6 (HPV E6); Human papilloma virus E7 (HPV E7); Human Telomerase reverse transcriptase (hTERT); IgE; IL13Ra2; Ill lRa; Immunoglobulin lambda-like polypeptide 1 (IGLL1); Influenza A hemagglutinin (HA); Insulin-like growth factor 1 receptor (IGF-I receptor); Interleukin 11 receptor alpha (IL-llRa); Interleukin- 13 receptor subunit alpha-2 (IL-13Ra2 or CD213A2); Intestinal carboxyl esterase; KIT (CD117); KSHV K8.1; KSHV-gH; LAMP1 ; Legumain; Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Leutenizing hormone receptor (LHR); Lewis(Y) antigen; Lews Ag; Livl; Locus K 9 (LY6K); Low conductance chloride channel; Lymphocyte antigen 6 complex; Lymphocyte antigen 75 (LY75); Lymphocyte-specific protein tyrosine kinase (LCK); Mammary gland differentiation antigen (NY-BR-1); Melanoma antigen recognized by T cells 1 (MelanA or MARTI); Melanoma- associated antigen 1 (MAGE-A1); Melanoma cancer testis antigen-1 (MAD-CT-1); Melanoma cancer testis antigen-2 (MAD-CT-2); Melanoma inhibitor of apoptosis (ML-IAP); Mesothelin; MPL; Mucin 1 cell surface associated (MUC1); N-Acetyl glucosaminyl-transferase V (NA17); Nectin-4; Neural cell adhesion molecule (NCAM); NKG2D; NYBR1; O-acetyl-GD2 ganglioside (OacGD2); Olfactory receptor 51E2 (OR51E2); Oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl); P53 mutant; Paired box protein Pax-3 (PAX3); Paired box protein Pax-5 (PAX5); Pannexin 3 (PANX3); PDL1; P-glycoprotein; Placenta-specific 1 (PLAC1); Platelet-derived growth factor receptor beta (PDGFR-beta); Polysialic acid; Proacrosin binding protein sp32 (OY-TES1); Prostase; Prostate carcinoma -263- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT tumor antigen-1 (PCT A-l or Galectin 8); Prostate stem cell antigen (PSCA); Prostate-specific membrane antigen (PSMA); Prostatic acid phosphatase (PAP); Prostein; Protease Serine 21 (Testisin or PRSS21); Proteasome (Prosome Macropain) Subunit Beta Type 9 (LMP2); PTK7; Ras G12V; Ras Homolog Family Member C (RhoC); Rat sarcoma (Ras) mutant; Receptor for Advanced Gly cation Endproducts (RAGE-1); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Receptor tyrosine-protein kinase ERBB2 or Her-22 / neu; Renal ubiquitous 1 (RU1); Renal ubiquitous 2 (RU2); Sarcoma translocation breakpoints; Serine 2 (TMPRSS2) ETS fusion gene; Sialyl Lewis adhesion molecule (sLe); SLAMF4; SLAMF6; Slea (CA19.9 or Sialyl Lewis Antigen); Sperm protein 17 (SPA17); Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3); Stage-specific embryonic antigen-4 (SSEA-4); STEAP1; Survivin; Synovial sarcoma X breakpoint 2 (SSX2); TCR Gamma Alternate Reading Frame Protein (TARP); TCR-beta1 chain; TCR-beta2 chain; TCR-delta chain; TCR-gamma chain; TCRgamma-delta; Telomerase; TGFbetaR2; The antigen recognized by TNT antibody; Thyroid stimulating hormone receptor (TSHR); Timl- / HVCR1; Tissue Factor 1 (TF1); Tn ag; Tn antigen ((Tn Ag) or (GalNAca-Ser / Thr)); TNF receptor family member B cell maturation (BCMA); Transglutaminase 5 (TGS5); Transmembrane protease; TROP2; Tumor endothelial marker 1 (TEM1 / CD248); Tumor endothelial marker 7-related (TEM7R); Tumor protein p53 (p53); Tumor-associated glycoprotein 72 (TAG72); Tyrosinase; Tyrosinase-related protein 2 (TRP-2); Uroplakin 2 (UPK2); Vascular endothelial growth factor receptor 2 (VEGFR2); V- myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Wilms tumor protein (WT1); or X Antigen Family Member 1A (XAGE1).

31. The viral particle of claim 30, wherein the target binding domain (T) binds to CD7.

32. The viral particle of claim 31, wherein the target binding domain (T) that binds to CD7 comprises a polypeptide comprising a sequence having at least 90% sequence identity to SEQ ID NO: 38 or SEQ ID NO: 39, having at least 95% sequence identity to SEQ ID NO: 38 or SEQ ID NO: 39, having at least 99% sequence identity to SEQ ID NO: 38 or SEQ ID NO: 39, or a sequence as set forth in SEQ ID NO: 38 or SEQ ID NO:

39.

33. The viral particle of any one of claims 29-32, wherein the heterologous viral glycoprotein is a VSV-G polypeptide.

34. The viral particle of claim 33, wherein the VSV-G polypeptide comprises a sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO:

25. -264- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT 35. A viral particle comprising a heterologous viral glycoprotein, a targeting moiety, and a nucleic acid molecule encoding for a heterologous molecule of interest, wherein; the heterologous viral glycoprotein comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 23 or SEQ ID NO: 25, having at least 95% identity of SEQ ID NO: 23 or SEQ ID NO: 25, having at least 99% identity to SEQ ID NO: 23 or SEQ ID NO: 25, or having at least 100% identity to SEQ ID NO: 23 or SEQ ID NO: 25; the targeting moiety comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 98, SEQ ID NO: 126, or SEQ ID NO: 127, at least 95% identity to SEQ ID NO: 98, SEQ ID NO: 126, or SEQ ID NO: 127, at least 99% identity to SEQ ID NO: 98, SEQ ID NO: 126, or SEQ ID NO: 127, or at least 100% identity to SEQ ID NO: 98, SEQ ID NO: 126, or SEQ ID NO: 127; and wherein the nucleic acid molecule encoding for a heterologous molecule of interest encodes for a chimeric antigen receptor and a polypeptide comprising: i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD.

36. The viral particle of claim 35, wherein the CAR comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, at least 90% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, at least 95% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, at least 99% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO: 129, or at least 100% identity to SEQ ID NO: 99, SEQ ID NO: 128, or SEQ ID NO:

129.

37. The viral particle of claim 35 or 36, wherein the polypeptide encoded by the nucleic acid molecule comprises an amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124, or a variant of any of the foregoing.

38. The viral particle of any one of claims 35-37, wherein the chimeric antigen receptor and the polypeptide are encoded by separate nucleic acid molecules. -265- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT 39. The viral particle of any one of claims 35-37, wherein the chimeric antigen receptor and the polypeptide are encoded by the same nucleic acid molecule.

40. The viral particle of claim 39, wherein the chimeric antigen receptor and the polypeptide are separated by a sequence encoding for a cleavable peptide, such as a 2A peptide.

41. A method of infecting, transfecting or transducing a cell, the method comprising contacting the cell with a particle of any one of claims 1-23 or a viral particle of any one of claims 29-40.

42. A method of delivering one or more heterologous molecules of interest to a cell, the method comprising contacting the cell with a particle of any one of claims 1-23 or a viral particle of any one of claims 29-40, wherein the viral particle comprises a nucleic acid molecule encoding the heterologous molecule of interest.

43. The method of claim 41 or 42, wherein the method further comprises administering to the cell or to the subject one or more compounds that bind to the ECD of the polypeptide encoded by the one or more nucleic acid molecules, such as but not limited to, somatropin, G-CSF, lenograstim (Granocyte), filgrastim (Neupogen, Zarzio, Nivestim, Accofil), long acting (pegylated) filgrastim (pegfilgrastim, Neulasta, Pelmeg, Ziextenco) or lipegfilgrastim (Lonquex).

44. A method of treating a disease or disorder in a subject, the method comprising administering to the subject a particle of any one of claims 1-23 or a viral particle of any one of claims 29-40, wherein the viral particle comprises a nucleic acid molecule encoding a heterologous molecule of interest to treat the disease or disorder, wherein the nucleic acid molecule encoding a heterologous molecule of interest is the nucleic acid molecule of any one of claims 24-28.

45. A method of treating a disease or disorder in a subject, the method comprising: i) administering to the subject a particle of any one of claims 1-23 or a viral particle of any one of claims 29-40, and -266- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT ii) administering to the subject an effective amount of one or more compounds capable of binding to the ECD of human GCSFR, thereby treating the disease or disorder, wherein the viral particle comprises one or more nucleic acid molecules encoding one or more heterologous molecules of interest to treat the disease or disorder, wherein the one or more nucleic acid molecules encoding one or more heterologous molecules of interest is the one or more nucleic acid molecules of any one of claims 24-28.

46. A method of treating a disease or disorder in a subject, the method comprising: i) administering to the subject a particle of any one of claims 1-23 or a viral particle of any one of claims 29-40, and ii) administering to the subject an effective amount of one or more compounds capable of binding to the ECD of human GHR, thereby treating the disease or disorder, wherein the viral particle comprises one or more nucleic acid molecules encoding one or more heterologous molecules of interest to treat the disease or disorder, wherein the one or more nucleic acid molecules encoding one or more heterologous molecules of interest is the one or more nucleic acid molecules of any one of claims 24-28.

47. A method of treating a disease or disorder in a subject, the method comprising: i) administering to the subject a viral particle of any one of claims 29-40, and ii) administering to the subject an effective amount of one or more compounds capable of binding to the ECD of human GHR, thereby treating the disease or disorder, wherein the viral particle comprises a nucleic acid molecule encoding a heterologous molecule of interest to treat the disease or disorder, wherein the nucleic acid molecule or a plurality of nucleic acid molecules encoding a heterologous molecule of interest encodes for a chimeric antigen receptor and a polypeptide comprising: i) a ligand binding extracellular domain (ECD); ii) an immune cell activating intracellular domain (ICD); and iii) a transmembrane domain linking the ECD to the ICD.

48. The method of claim 47, wherein the CAR comprises an amino acid sequence having -267- IPTS / 128569702.2DOCKET NO: INH-023WO PATENT at least 85% identity to SEQ ID NO: 99, at least 90% identity to SEQ ID NO: 99, at least 95% identity to SEQ ID NO: 99, at least 99% identity to SEQ ID NO: 99, or at least 100% identity to SEQ ID NO:

99.

49. The method of claim 47 or 48, wherein the polypeptide encoded by the nucleic acid molecule comprises an amino acid sequence of SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 119, SEQ ID NO: 120, or SEQ ID NO: 124, or a variant of any of the foregoing.

50. A method of delivering one or more heterologous molecules to a target cell, the method comprising contacting the cell with a particle of any one of claims 1-23 or a viral vector or particle of any one of claims 29-40, wherein the particle comprises one or more nucleic acid molecules encoding the one or more heterologous molecules. -268- IPTS / 128569702.2

Images