Aqueous cosmetic composition comprising endolysine and trehalose
Patent Information
- Application Number
- FR2023005543
- Authority / Receiving Office
- FR · FR
- Patent Type
- Patents
- Current Assignee / Owner
- Filing Date
- 2023-06-02
- Publication Date
- 2026-03-13
- Estimated Expiration
- 2043-06-02
AI Technical Summary
Existing cosmetic formulations using endolysins to target Staphylococcus aureus face issues of stability and specificity, leading to non-specific antimicrobial action and potential skin irritation, while broad-spectrum antimicrobials risk bacterial resistance and disrupt the skin's ecological balance.
Incorporating trehalose into aqueous cosmetic compositions with endolysins derived from Staphylococcus aureus phages maintains the antimicrobial activity of endolysins over time, ensuring specificity towards Staphylococcus aureus and improving skin tolerance.
Trehalose stabilizes endolysins, maintaining their effectiveness against Staphylococcus aureus for extended periods, reducing skin irritation, and preserving the skin's beneficial microbial flora.
Abstract
Description
Title of the invention: Aqueous cosmetic composition comprising an endolysin and trehalose Technical field
[0001] The present invention relates to an aqueous composition, in particular a cosmetic composition, comprising, in a physiologically acceptable medium, at least one endolysin, in particular an endolysin derived from a Staphylococcus aureus phage and trehalose.
[0002] It also relates in particular to the implementation of a composition of the invention for preventing and / or treating a skin disorder linked to colonization by Staphylococcus aureus in an individual in need thereof, and in particular for preventing and / or treating acne and / or eczema in an individual in need thereof.
[0003] Finally, it relates to a non-therapeutic cosmetic process for caring for keratin materials, in particular the skin, comprising the topical application to these keratin materials of a composition according to the invention. Prior art
[0004] Human skin is permanently populated by a multitude of different microorganisms (bacteria, yeasts and fungi). The resident microbial flora, essential for good skin health, is made up mainly of propionibacterium (Cutibacterium acnes), staphylococci (Staphylococcus epidermidis and Staphylococcus hominis), corynebacteria, and streptococci, as well as a fungal flora mainly composed of Malassezia.
[0005] Certain dermatological disorders are most often due to the disruption of the ecological balance of the resident flora following a predominant colonization of opportunistic microorganisms not beneficial for the skin such as Staphylococcus aureus known to be associated with atopic dermatitis (eczema), oily or hyperseborrheic skin, and acne.
[0006] To rebalance this excess colonization by these opportunistic microorganisms that are not beneficial for the skin, it is common to use broad-spectrum antimicrobials or bacteriostatics. The use of these compounds, however, poses the problem of non-specificity of action targeting indifferently the undesirable opportunistic flora and the resident beneficial flora, and the problem of the risk of the appearance of bacterial resistance or imbalances by selecting resistant bacteria, as well as problems of skin tolerance (irritations, allergies, etc.).
[0007] There therefore remains a need to find new compounds having good antimicrobial efficacy without presenting the above-described drawbacks, and good skin tolerance.
[0008] It has thus been demonstrated that endolysins originating from Staphylococcus aureus phages (i.e. phages infecting Staphylococcus aureus) make it possible to specifically target S. aureus and to lyse, and therefore specifically destroy, this bacterium while preserving the resident skin flora (WO2012 / 150858 A1). However, it is well known that one of the main obstacles to the application of endolysins targeting Staphylococcus species is a problem of stability of these proteins and / or their enzymatic activity, in particular the maintenance of this activity over time.
[0009] Indeed, a significant alteration of the lytic action of these enzymes has been observed by interactions with raw materials, in particular when endolysin is introduced into formulations, particularly cosmetic ones.
[0010] There is therefore a need for an additive making it possible to preserve over time the antimicrobial activity of endolysins used in aqueous formulations, in particular cosmetic ones.
[0011] There is also a need for an additive intended (i) to promote the maintenance over time of the antimicrobial activity of endolysins used in aqueous formulations, in particular cosmetic formulations, (ii) while retaining the specificity of these endolysins for the targeted bacteria, in particular in the present invention Staphylococcus aureus.
[0012] There is also a need for an additive intended to: - to promote the maintenance over time of the antimicrobial activity of endolysins used in aqueous formulations, particularly cosmetics; - while retaining the specificity of these endolysins for the targeted bacteria, in particular in the present invention Staphylococcus aureus; and - while also allowing for good sensoriality of the composition. Statement of the invention
[0013] The present invention aims to solve at least one aforementioned technical problem.
[0014] Indeed, the inventors have now discovered that trehalose, compared to other additives, and in particular to other sugars, known in the field of formulation, in particular cosmetics, proves to be capable of allowing the maintenance of good performance in destroying Staphylococcus aureus by the associated endolysin after many months after preparation of an aqueous composition comprising it. Summary of the invention
[0015] As mentioned above, the present invention thus relates to an aqueous composition, in particular a cosmetic composition, comprising, in a physiologically acceptable medium: (i) at least one endolysin, in particular an endolysin derived from a Staphylococcus aureus phage; and (ii) trehalose.
[0016] As illustrated in the examples below, the Applicant has surprisingly discovered that a composition according to the invention, comprising an endolysin, in particular an endolysin derived from a Staphylococcus aureus phage, and trehalose, advantageously makes it possible to maintain the S. aureus destruction performance of the endolysin, even after a long period (for example 6 months) in an aqueous medium.
[0017] Thus, the present invention also relates to the implementation of a composition of the invention for preventing and / or treating a skin disorder linked to colonization by Staphylococcus aureus in an individual in need thereof, in particular for preventing and / or treating acne and / or eczema in the individual.
[0018] It further relates to a non-therapeutic cosmetic process for caring for keratin materials, in particular the skin, comprising the topical application to these keratin materials of a composition according to the invention. Detailed description
[0019] By "cosmetic" is meant a composition compatible with keratin materials, in particular the skin, mucous membranes and appendages, more particularly the skin. The composition according to the invention is non-therapeutic.
[0020] By "aqueous composition" is meant a composition comprising at least one aqueous phase, and in particular comprising at least 10% by weight of water, in particular at least 20% by weight of water, more particularly at least 30% by weight of water, even better at least 40% by weight of water relative to the total weight of the composition.
[0021] By “keratin materials” is meant in particular the skin, mucous membranes, fibers, eyelashes and appendages.
[0022] By "skin" is meant all the skin of the body, in particular the skin of the face, scalp, décolleté, neck, arms and forearms, eyelids, around the mouth or behind the ears, the hollow of the elbow, the back of the knees, hands, wrists and ankles, or more particularly, the skin of the face (in particular the forehead, nose, cheeks, chin), décolleté and neck.
[0023] A composition according to the invention comprises a physiologically acceptable medium, that is to say which has a pleasant color, odor and feel and does not generate unacceptable discomfort, that is to say tingling, tightness, redness, likely to discourage the user from applying this composition. Of course, a person skilled in the art will take care to choose a physiologically acceptable medium in such a way that the advantageous properties of the endolysin(s) of the invention are not, or not substantially, altered. Thus, by way of illustration, a physiologically acceptable medium may consist mainly of water and / or one or more organic solvent(s) miscible in water. A physiologically acceptable medium according to the invention has in particular a pH of between 4 and 8, more particularly between 4.5 and 7.5. Thus, a composition according to the invention may comprise one or more pH adjuster(s).
[0024] As used herein, the terms "treat" and "treatment" are intended to mean the alleviation of symptoms associated with a specific disorder or condition and / or the elimination of said symptoms as well as the complete disappearance of the disorder or condition in question.
[0025] In the context of the present invention, the terms "prevent" and "prevention" designate the reduction to a lesser degree of the risk or probability of occurrence of a given phenomenon. Endolysin
[0026] An aqueous composition, in particular a cosmetic composition, according to the invention is firstly characterized in that it comprises at least one endolysin.
[0027] In the embodiments described herein, the endolysin may be a native bacteriophage endolysin or a recombinant endolysin and may be any endolysin known to those skilled in the art. Herein, the terms bacteriophage lysin, bacteriophage endolysin, and endolysin are used interchangeably. An endolysin may be selected from the group of en-dolysins defined in WO2011 / 023702, WO2012 / 146738, WO2003 / 082184, WO2010 / 011960, WO2010 / 149795, WO2010 / 149792, WO2012 / 094004, WO2011 / 023702, WO2011 / 065854, WO2011 / 076432, WO2011 / 134998, WO2012 / 059545, WO2012 / 085259, WO2012146738, WO2018 / 091707, Exebacase™ (Lysin CF-301); SAL200™ or Tonabacase; Auresine™ (Sigma-Aldrich SAE0083), and Ectolysin™ P128.
[0028] In the embodiments presented herein, the endolysin is a Staphylococcus aureus-specific endolysin, i.e., it will effectively lyse Staphylococcus aureus but will not substantially lyse bacteria other than Staphylococcus aureus. In particular, an endolysin implemented according to the invention will lyse Staphylococcus aureus, but not Staphylococcus epidermidis.
[0029] Most native Staphylococcus bacteriophage endolysins with peptidoglycan hydrolase activity, such as Ply2638 endolysin, consist of a C-terminal cell wall binding domain (CBD), a central N-acetylmuramoyl-L-Alanine amidase domain, and an N-terminal Alanyl-glycyl endopeptidase domain with cysteine, in the case of Ply2638, an N-terminal gly-cylalanyl-glycine endopeptidase domain with Peptidase_M23 homology, the latter three domains each exhibiting peptidoglycan hydrolase activity with distinct target binding specificity and generally referred to as enzymatically active domains.
[0030] The endolysin may be a recombinant endolysin, such as a recombinant endolysin specific for Staphylococcus aureus, in particular a recombinant chimeric endolysin specific for Staphylococcus aureus comprising one or more heterologous domains.
[0031] In general, endolysins consist of different subunits (domains), for example, a cell wall binding domain (CBD) and one or more enzymatic domains having peptidoglycan activity, such as an amidase domain, an M23 domain, and a CHAP (cysteine, histidine-dependent amidohydrolases / peptidases) domain. An example of a Staphylococcus aureus-specific chimeric endolysin comprising one or more heterologous domains is an endolysin comprising an amidase domain of bacteriophage Ply2638, an M23 domain of lysostaphin (S. simulans), and a cell wall binding domain of bacteriophage Ply2638.
[0032] This Staphylococcus aureus-specific chimeric endolysin is a preferred endolysin and is described in detail in WO2012 / 150858. Other preferred endolysins are described in detail in WO2013 / 169104. Other preferred endolysins are described in detail in WO2016 / 142445. Other preferred endolysins are described extensively in WO2017 / 046021. Other preferred endolysins are widely described in WO2012 / 146738, WO2003 / 082184, WO2010 / 011960, WO2010 / 149795, WO2011 / 076432, WO2011 / 134998, WO2012 / 085259, WO2012146738 or WO2018 / 091707.
[0033] An implemented endolysin may comprise a domain having at least 80% sequence identity with a domain described in WO2012 / 150858, WO2013 / 169104, WO2016 / 142445, WO2017 / 046021, WO2012 / 146738, WO2003 / 082184, WO2010 / 011960, WO2010 / 149795, WO2011 / 076432, WO2011 / 134998, WO2012 / 085259, WO2012146738 or WO2018 / 091707.
[0034] An implemented endolysin may have at least 80% sequence identity with an endolysin described in WO2012 / 150858, WO2013 / 169104, WO2016 / 142445, WO2017 / 046021, WO2012 / 146738, WO2003 / 082184, WO2010 / 011960, WO2010 / 149795, WO2011 / 076432, WO2011 / 134998, WO2012 / 085259, WO2012146738, WO2018 / 091707, such as the endolysin with the reference amino acid sequence SEQ ID NO: 29 in WO2012 / 150858.
[0035] In a particular embodiment, the endolysin is an endolysin derived from a Staphylococcus aureus phage.
[0036] For the purposes of the present invention, the term “endolysin derived from a Staphylococcus aureus phage” means a native or recombinant protein such as an enzyme or nucleic acid molecule encoding it derived from one or more bacteriophage(s) capable of lysing the cell wall of bacteria of the species Staphylococcus aureus.
[0037] The endolysin comprises in particular one or more domain(s) for binding to the bacterial wall of Staphylococcus aureus and / or one or more domain(s) for lysis of the bacterial wall of Staphylococcus aureus, said binding domain(s) and domain(s) for lysis of the bacterial wall of Staphylococcus aureus being derived from one or more distinct or identical bacteriophage(s) capable of lysing the wall of bacteria of the species Staphylococcus aureus.
[0038] The endolysin used in the context of the present invention may be in native or recombinant form, in particular in recombinant form.
[0039] According to a particular embodiment, the endolysin comprises a first protein sequence comprising a domain for binding to the cell wall of species of the genus Staphylococcus.
[0040] In particular, the first protein sequence is derived from the endolysin of the bacteriophage <e>2638a of S. aureus.
[0041] For each of the amino acid or nucleic acid sequences of interest, reference sequences are described herein. The present description also encompasses amino or nucleic acid sequences (e.g., enzyme amino acid sequences), having specific percentages of amino acid or nucleotide identity with a reference sequence.
[0042] For obvious reasons, throughout the present description, a specific nucleic acid sequence or a specific amino acid sequence which respects, respectively, the nucleotide or amino acid identity considered, must further lead to obtaining a protein (or enzyme) which exhibits the desired biological activity. As used herein, the "percent identity" between two nucleic acid sequences or between two amino acid sequences is determined by comparing the two optimally aligned sequences across a comparison window.
[0043] The part of the nucleotide or amino acid sequence in the comparison window may therefore include additions or deletions (for example "holes") compared to the reference sequence (which does not include these additions or deletions) in order to obtain optimal alignment between the two sequences.
[0044] The terms "sequence homology" or "sequence identity" or "homology" or "identity" are used interchangeably in this document. For the purposes of the invention, this means that to determine the percentage of sequence homology or sequence identity of two amino acid sequences or two nucleic acid sequences, the sequences are aligned for optimal comparison purposes. In order to optimize the alignment between the two sequences, gaps may be introduced into any of the two sequences being compared. This alignment can be performed over the entire length of the sequences being compared. The alignment can also be performed over a shorter length, for example, over twenty, fifty, one hundred or more nucleic acids / bases or amino acids. Sequence identity is the percentage of identical matches between the two sequences over the reported aligned region.
[0045] Comparing sequences and determining the percentage of sequence identity between two sequences can be performed using a mathematical algorithm. Those skilled in the art know that several different computer programs are available for aligning two sequences and determining the identity between two sequences (Kruskal, JB (1983) An overview of sequence comparison In D. Sankoff and JB Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp. 1-44 Addison Wesley).
[0046] The percentage of sequence identity between two amino acid sequences or between two nucleotide sequences can be determined using the Needleman and Wunsch algorithm for aligning two sequences. (Needleman, SB and Wunsch, CD (1970) J. Mol. Biol. 48, 443-453). The algorithm allows for the alignment of both amino acid sequences and nucleotide sequences. The Needleman-Wunsch algorithm has been implemented in the computer program NEEDLE.
[0047] For the purposes of the invention, the NEEDLE program of the EMBOSS software package was used (version 2.8.0 or higher, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. LongdenJ. and Bleasby,A. Trends in Genetics 16, (6) pp276-277, http: / / emboss.bioinformatics.nl / ). For protein sequences, EBLOSUM62 is used for the substitution matrix. For nucleotide sequences, EDNAFULL is used. Optional parameters used are a gap opening penalty of 10 and a gap extension penalty of 0.5. No trailing gap penalty is added. In the Output section, Yes was indicated in response to the question "Brief identity and similarity" and "SRS pairwise" was indicated as the output alignment format.
[0048] After alignment by the NEEDLE program described above, the percentage of sequence identity between a query sequence and a sequence of the invention is calculated as follows: Number of matching positions in the alignment showing an identical amino acid or nucleotide in both sequences divided by the total length of the alignment after subtracting the total number of gaps in the alignment. The identity defined here can be obtained from NEEDLE using the NOBRIEF option and is labeled in the program output as "longest identity".
[0049] The similarity of nucleotide and amino acid sequences, i.e. the percent identity of sequences, can be determined by sequence alignments using several other known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http: / / hmmer.wustl.edu / ) or with the CLUSTAL algorithm (Thompson, JD, Higgins, DG & Gibson, TJ (1994) Nucleic Acids Res. 22, 4673-80) available for example at https: / / www.ebi.ac.uk / Tools / msa / clustalo / or the GAP program (mathematical algorithm of the University of Iowa) or the mathematical algorithm of Myers and Miller (1989 - Cabios 4: 11-17) or Clone Manager 9. The preferred parameters used are the parameters defaults as defined at https: / / www.ebi.ac.uk / Tools / msa / clustalo / .
[0050] The degree of sequence identity (sequence match) can be calculated using, for example, BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated in the BLASTN and BLASTP programs of Altschul et al (1990) J. Mol. Biol. 215, 403-410. BLAST polynucleotide searches are performed with the BLASTN program, score = 100, word length = 12, in order to obtain polynucleotide sequences homologous to the nucleic acids that encode the protein of interest.
[0051] BLAST searches on proteins are performed with the program BLASTP, score = 50, word length = 3, to obtain amino acid sequences homologous to the SHC polypeptide. To obtain gapped alignments for comparison, Gapped BLAST is used as described in Altschul et al (1997) Nucleic Acids Res. 25, 3389-3402. When using the BLAST and Gapped BLAST programs, the default settings of the respective programs are used. Sequence correspondence analysis can be complemented by established homology mapping techniques such as Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1: 154-162) or Markov random fields. Where reference is made to percentages of sequence identity in this application, such percentages are calculated relative to the total length of the longest sequence, unless otherwise indicated.
[0052] In particular embodiments, the percentage of identity between two sequences is determined using CLUSTAL O (version 1.2.4).
[0053] Thus, according to a particular embodiment, the first protein sequence comprises a protein sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference amino acid sequence SEQ ID NO: 1.
[0054] By at least 80% sequence identity between two sequences, it is meant that the first sequence may comprise 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87 %, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with the second sequence, whether amino acid sequences or nucleic acid sequences.
[0055] In particular, the first protein sequence consists of a reference amino acid sequence SEQ ID NO: 1.
[0056] The protein sequences described herein may be encoded by one or more allelic variants.
[0057] An allelic variant refers to any one of two or more alternative forms of a gene occupying the same chromosomal locus. A preferred nucleic acid variant is a nucleotide sequence that contains one or more silent mutations. Alternatively or in combination, a nucleic acid variant may also be obtained by the introduction of nucleotide substitutions, which do not result in another amino acid sequence of the polypeptide encoded by the nucleotide sequence, but which correspond to the codon usage of the host organism intended for the production of the polypeptide of the invention. According to a preferred embodiment, a nucleic acid variant encodes a polypeptide still exhibiting its biological function. More preferably, a nucleotide sequence variant encodes a polypeptide exhibiting binding to the cell wall of species of the genus Staphylococcus and / or lytic activity.Even more preferably, a nucleic acid variant encodes a polypeptide exhibiting increased binding to the cell wall of Staphylococcus species and / or lytic activity, as defined below. Nucleic acids encoding a polypeptide exhibiting binding to the cell wall of Staphylococcus species and / or lytic activity may be isolated from any microorganism.
[0058] All these variants can be obtained using techniques known to those skilled in the art, such as library screening by hybridization (Southern blotting procedures) under low to medium to high hybridization conditions. Low to medium to high stringency conditions means prehybridization and hybridization at 42°C in 5X SSPE, 0.3% SDS, 200 pg / ml sheared and denatured salmon sperm DNA, and either 25%, 35% or 50% formamide for low to medium to high stringencies respectively. Then, the hybridization reaction is washed three times for 30 minutes using for each wash 2XSSC, 0.2% SDS and at 55°C, 65°C or 75°C for low to medium to high stringencies.
[0059] According to a particular embodiment, the first protein sequence is encoded by a nucleic acid sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference nucleic acid sequence SEQ ID NO: 2.
[0060] In particular, the first protein sequence is encoded by a nucleic acid sequence consisting of a reference nucleic acid sequence SEQ ID NO: 2.
[0061] Binding of a domain to the peptidoglycan cell wall of Staphylococcus genera can be assessed using assays well known to those skilled in the art. In a preferred embodiment, an immunohistochemical technique and / or a gene fusion technique resulting in labeled constructs of either domain are used to assess the specific binding of peptides, polypeptides or proteins to the peptidoglycan cell wall of Staphylococcus genera. Signal quantification methods used in the above-mentioned immunohistochemical or fusion techniques are well known in the art.
[0062] In one embodiment, cell wall binding of Staphylococcus peptidoglycan can be quantified using a fluorescent fusion construct comprising a polypeptide comprising a domain comprised within a first protein sequence as previously described. Such a cell wall binding assay is described in detail by Loessner et al. (Molecular Microbiology 2002, 44(2): 335-349). In this assay, a solution comprising said fluorescent fusion construct or a negative control, preferably green fluorescent protein (GFP), is subjected to Staphylococcus cells, preferably S. aureus cells, more preferably S. aureus BB255, for a specified period of time, after which the cells are pelleted by centrifugation together with the bound fluorescent fusion constructs.The fluorescent signal of Staphylococcus cells exposed to a fluorescent fusion construct, subtracted from the fluorescent signal of Staphylococcus cells exposed to a negative control, preferably GPF, is a measure of cell binding for the purposes of the present invention.
[0063] Examples of evaluation of the binding of an endolysin to the cell wall of species of the genus Staphylococcus suitable according to the invention are illustrated in particular in WO 2012 / 150858 A1.
[0064] Preferably, in the context of the present text, a protein sequence will be said to comprise a peptidoglycan cell wall binding domain of the Staphylococcus genera when using this assay, an increase in the fluorescent signal of the sedimented cells is detected. The binding is preferably said to be specific. Preferably, an endolysin comprising a domain is described which has a binding capacity, as defined herein, of at least 50, 60, 70, 80, 90 or 100, 150 or 200% of the peptidoglycan cell wall binding of the endolysin <e>2638a S. aureus bacteriophage (Ply2638) encoded by the reference nucleic acid sequence SEQ ID NO: 5.
[0065] According to a particular embodiment, the cell wall binding activity of species of the genus Staphylococcus is measured by an immunohistochemical technique and / or a gene fusion technique, in particular fluorescent fusion, more particularly fusion with a green fluorescent protein.
[0066] According to a particular embodiment, the endolysin comprises a protein sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with an amino acid sequence chosen from the group consisting of the reference amino acid sequences SEQ ID NO: 3 and SEQ ID NO: 4.
[0067] According to a particular embodiment, the endolysin comprises a protein sequence encoded by a nucleic acid sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference nucleic acid sequence SEQ ID NO: 5.
[0068] In particular, the protein sequence may be encoded by a nucleic acid sequence consisting of a reference nucleic acid sequence SEQ ID NO: 5.
[0069] According to a particular embodiment, the endolysin may further comprise a heterologous protein sequence.
[0070] By "heterologous protein sequence" is meant a protein sequence, i.e., an amino acid sequence or a nucleic acid sequence encoding the protein sequence, which is not naturally found operably linked as a neighboring sequence to said first protein sequence. As used herein, the term "heterologous" may mean "recombinant." "Recombinant" refers to a genetic entity distinct from that generally found in nature. As applied to a nucleotide sequence or nucleic acid molecule, it means that said nucleotide sequence or nucleic acid molecule is the product of various combinations of cloning, restriction and / or ligation steps, and other procedures that result in the production of a construct that is distinct from a sequence or molecule found in nature.
[0071] Such protein or nucleic recombination methods are well known to those skilled in the art.
[0072] According to a particular embodiment, the endolysin comprises a heterologous protein sequence comprising a lytic domain. Preferably, said lytic domain has peptidoglycan hydrolase activity.
[0073] A “peptidoglycan hydrolase activity,” also defined herein as a “lytic activity,” may be assessed by methods well known to those skilled in the art. In one embodiment, the lytic activity may be assessed spectrophotometrically by measuring the decrease in turbidity of cell suspensions of the substrate. Preferably, the lytic activity may be assessed spectrophotometrically by measuring the decrease in turbidity of a suspension of S. aureus, the turbidity being quantified as measuring OD595 by spectrophotometry (Libra S22, Biochrom). More preferably, 200 nM of a polypeptide encoded by a nucleic acid molecule as identified herein is incubated with a suspension of S. aureus having an initial OD60o of 1 ± 0.05, as assessed by spectrophotometry (Libra S22, Biochrom), in PBS buffer pH 7.4, 120 mM sodium chloride for 30 min at 37 °C. The decrease in turbidity is calculated by subtracting the OD595 after 30 min of incubation from the OD595 before 30 min of incubation. In the context of the present text, a protein sequence will be said to comprise a lytic domain when using this assay, a decrease in turbidity of at least 10, 20, 30, 40, 50 or 60% is detected. Preferably, a decrease of at least 70% is detected. Preferably, an endolysin comprising a domain is described which exhibits a lytic activity of at least 50, 60, 70, 80, 90, 100, 150 or 200% or more of a lytic activity of the endolysin. <e>2638a S. aureus bacteriophage (Ply2638) encoded by the reference nucleic acid sequence SEQ ID NO: 5.
[0074] According to a particular embodiment, the lytic activity of endolysin is measured by spectrophotometry by measuring the decrease in turbidity of a suspension of S. aureus.
[0075] In one embodiment, the endolysin may not be encoded by an amino acid sequence comprising or consisting of an amino acid sequence selected from the group consisting of the reference amino acid sequences SEQ ID NO: 3 and SEQ ID NO: 4.
[0076] In particular, the endolysin may not be encoded by a nucleic acid sequence comprising or consisting of the reference nucleic acid sequence SEQ ID NO: 5, encoding the bacteriophage endolysin ¢2638 of S. aureus.
[0077] According to a particular embodiment, the heterologous protein sequence comprises a lytic domain, said lytic domain comprising a second and a third protein sequences, said second protein sequence comprising an M23 endopeptidase domain and said third protein sequence comprising an amidase domain.
[0078] An endopeptidase domain as used herein preferentially cleaves pentaglycine cross-bridges (Trayer, HR and Buckley, CE (1970) Molecular properties of ly-sostaphin, a bacteriolytic agent specific for Staphylococcus aureus. J Biol. Chem. 245, 4842-4846) which are found in the cell wall of Staphylococcus genera, preferably in the cell wall of S. aureus, S. simulans and S. camosus
[0079] An amidase domain as used herein preferably hydrolyzes gamma-glutamyl-containing substrates.
[0080] The functionality and activity of these domains in a polypeptide can be confirmed by the characterization of the cleavage products upon incubation of said polypeptides containing any of these domains with a purified peptidoglycan.
[0081] According to a particular embodiment, the endopeptidase and / or amidase activity of endolysin is measured by characterization of the cleavage products.
[0082] According to a particular embodiment, the endopeptidase and / or amidase activity of endolysin can be measured by measuring the optical density of the bacteria in the presence of endolysin. Such methods are notably described in Park et al. (Characterization of an endolysin, LysBPS13, from a Bacillus cereus bacteriophage, FEMS Microbiol Lett. 2012 Jul;332(l):76-83) and in Grishin et al. (A Simple Protocol for the Determination of Lysostaphin Enzymatic Activity, Antibiotics (Basel). 2020 Dec 17;9(12):917).
[0083] Preferably, each of the protein sequences and nucleotide sequences encoding the second or third domain is of bacterial or bacteriophage origin.
[0084] According to a particular embodiment, said second and third protein sequences are derived, independently of one another, from an enzyme chosen from the group consisting of bacteriophage endolysin <e>2638a of S. aureus and lysostaphin of S. simulans. In particular, one of the second and third protein sequences is derived from the endolysin of the bacteriophage <e>2638a from S. aureus and the other sequence of the second and third protein sequences is from lysostaphin from S. simulans.
[0085] According to a particular embodiment, said second protein sequence comprises at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference amino acid sequence SEQ ID NO: 6 and said third protein sequence comprises at least 80%, in particular 90%, more particularly 95% sequence identity with the reference amino acid sequence SEQ ID NO: 8.
[0086] According to a particular embodiment, said second protein sequence is encoded by a nucleic acid sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference nucleic acid sequence SEQ ID NO: 7 and said third protein sequence is encoded by a nucleic acid sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference nucleic acid sequence SEQ ID NO: 9.
[0087] According to a particular embodiment, said second protein sequence is encoded by a nucleic acid sequence consisting of the reference nucleic acid sequence SEQ ID NO: 7 and said third protein sequence is encoded by a nucleic acid sequence consisting of the nucleic acid sequence of reference SEQ ID NO: 9.
[0088] According to a particular embodiment, the endolysin comprises a protein sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with an amino acid sequence chosen from the group consisting of the reference amino acid sequences SEQ ID NO: 10, and SEQ ID NO: 11.
[0089] In particular, the endolysin may comprise a protein sequence consisting of the reference amino acid sequence SEQ ID NO: 10.
[0090] According to a particular embodiment, the endolysin comprises a protein sequence encoded by a nucleic acid sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with a reference nucleic acid sequence SEQ ID NO: 12. In particular, the endolysin may comprise a protein sequence encoded by a nucleic acid sequence consisting of a reference nucleic acid sequence SEQ ID NO: 12.
[0091] An endolysin comprising a protein sequence encoded by a reference nucleic acid sequence SEQ ID NO: 12 differs from endolysin <e>2638a S. aureus bacteriophage in that the N-terminal M23 endopeptidase domain is substituted with an M23 endopeptidase domain from S. simulons lysostaphin.
[0092] Endolysins suitable according to the invention can be obtained by any method known to those skilled in the art for producing recombinant proteins. In particular, endolysins according to the invention can be obtained by introducing one or more gene(s) of interest, such as the nucleic acid sequences described above, into the genome of a host organism via a vector.
[0093] In another aspect, a nucleic acid construct is described comprising at least one of the nucleic acid sequences as defined above. This nucleic acid construct may comprise a first nucleic acid sequence encoding a polypeptide comprising a cell wall binding domain, possibly further comprising a second and a third nucleic acid sequences as defined above.
[0094] Also disclosed is an expression vector comprising such a nucleic acid construct. Preferably, an expression vector comprises a nucleotide sequence as mentioned above, which is operably linked to one or more control sequences, which direct the production or expression of the encoded polypeptide in a cell, subject or cell-free expression system.
[0095] An expression vector can be considered as a recombinant expression vector. This vector can consist of a plasmid, a cosmid, a bacteriophage or a virus which is transformed by the introduction of an acid molecule nucleic acid according to the invention. Such transformation vectors depending on the host organism to be transformed are well known to those skilled in the art and widely described in the literature.
[0096] Another object described in the present text is a method for the transformation of host organisms by the integration of at least one nucleic acid sequence as described, this transformation being able to be carried out by any suitable means known and widely described in the specialized literature, more particularly by the vector described above.
[0097] In another aspect, a cell is described, which comprises a nucleic acid construct or an expression vector as defined above. A cell may be any microbial, prokaryotic or eukaryotic cell, which is suitable for the expression of an endolysin suitable according to the invention. In a preferred embodiment, said cell is an E. Coli cell. In an even more preferred embodiment, said cell is E. Coli CLlblue MRF.
[0098] The obtained endolysin can then be purified according to purification methods known in the art such as column chromatography, high performance liquid chromatography, etc.
[0099] In a particular embodiment, one or more of the protein sequences as defined in the text may comprise a sequence coding for a tag to facilitate the purification of the resulting endolysin. Preferably, said tag is selected from, but is not limited to, a group consisting of a FLAG tag, a poly(His) tag, an HA tag and a Myc tag. More preferably, said tag is a 6xHis tag. Even more preferably, said tag is an N-terminal 6xHis tag identical to SEQ ID NO: 13.
[0100] Endolysins and methods for obtaining them are described in particular in application WO 2012 / 150858 A1.
[0101] An endolysin, in particular an endolysin derived from a Staphylococcus aureus phage, suitable according to the invention may be present in the composition in freshly prepared form or in lyophilized form.
[0102] In this text, "freshly prepared" is preferably defined as storage for no more than 2 days after its production at 1.63 mg / mL in a lyophilization buffer (50 mM Tris, 500 mM sucrose, 200 mM mannitol, 0.05% polysorbate 20 + 50% glycerol) at -20°C followed by thawing immediately before evaluating lytic activity in an assay as identified herein.
[0103] By "lyophilized" is meant an endolysin that has been dehydrated by lyophilization, which consists of freezing the protein and then dehydrating it to extract the water.
[0104] After lyophilization, an endolysin in lyophilized form can undergo a step of subsequent reconstitution by the addition of water. In one embodiment, lyophilization and reconstitution may be performed by dialysis against 3 changes of 300 ml of lyophilization buffer (50 mM phosphate or Tris, 500 mM sucrose, 200 mM mannitol, pH 7.4) aliquot and freezing in the gas phase of liquid nitrogen. Lyophilization may be performed under standard conditions, preferably at -40 °C and under vacuum at 75 mTorr for 60 minutes, before increasing the temperature for 5 hours at -10 °C and further increasing for 60 minutes at -10 °C at the same vacuum levels. As a final step, the temperature is preferably increased to 25 °C for 10 hours. Samples are reconstituted by the addition of water.
[0105] A composition according to the invention may comprise a content of endolysin(s), in particular endolysin(s) derived from a Staphylococcus aureus phage ranging from 0.0001% to 0.1% by weight relative to the total weight of the composition, in particular from 0.0005% to 0.01% by weight relative to the total weight of the composition, more particularly from 0.001% to 0.005% by weight relative to the total weight of the composition. Trehalose
[0106] Trehalose, an additive commonly used in the cosmetics industry, is a non-reducing disaccharide consisting of two glucose units linked by a 1,1-a-glycosidic bond of formula (I):
[0107] [Chem.l]
[0108] Trehalose may advantageously be present in a composition according to the invention in a usual content for a cosmetic composition, in particular in a usual content allowing it to play its role as a humectant in an aqueous composition of the invention, in particular in an aqueous cosmetic composition according to the invention, more particularly in a usual content allowing it to play its role as a preservative when it is the only preservative in a composition according to the invention.
[0109] A composition according to the invention may comprise a trehalose content ranging from 0.001% to 20% by weight relative to the total weight of the composition, in particular from 1% to 15% by weight, more particularly from 5% to 10% by weight relative to the total weight of the composition.
[0110] An example of trehalose suitable according to the invention is trehalose marketed under the name “TREHALOSE 100®” by the company Hayashibara®.
[0111] An aqueous composition according to the invention may be free, i.e. comprise 0% by weight relative to the total weight of the composition, of mannose and / or sucrose, in particular mannose and sucrose.
[0112] A composition according to the invention is aqueous. Thus, it comprises at least water, and optionally an organic solvent miscible in water.
[0113] In particular, a composition according to the invention may comprise a quantity of water of at least 10% by weight relative to the total weight of the composition, in particular a quantity of water ranging from 10% to 98% by weight, more particularly from 20% to 95% by weight, in particular from 30% to 90% by weight and more particularly from 35% to 85% by weight relative to the total weight of the composition.
[0114] The water may be sterile demineralized water and / or floral water and / or natural thermal or mineral water.
[0115] In the present invention, the term "water-miscible organic solvent" means an organic compound that is liquid at room temperature and whose miscibility in water is greater than 50% by weight at 25°C and atmospheric pressure.
[0116] The water-soluble solvents that can be used in a composition of the invention can also be volatile.
[0117] Among the water-miscible organic solvents that can be used in a composition of the invention, mention may be made, for example, of lower monoalcohols having from 2 to 5 carbon atoms such as ethanol and isopropanol and polyols such as propylene glycol.
[0118] According to one embodiment, a composition according to the invention may be free of lower monoalcohols having from 2 to 5 carbon atoms.
[0119] The water-miscible organic solvents may be present in the composition according to the invention in a content ranging from 5% to 20% by weight relative to the total weight of the composition, in particular from 10% to 15% by weight relative to the total weight of the composition.
[0120] According to a particular embodiment, a composition according to the invention may comprise less than 2% by weight of ethanol, in particular less than 1% by weight, more particularly less than 0.5% by weight, relative to the total weight of the composition, in particular less than 0.1% by weight of ethanol, and more particularly may be free of ethanol. Additional ingredients
[0121] In addition to the aforementioned compounds, a composition according to the invention may of course comprise one or more additional ingredient(s).
[0122] Of course, the person skilled in the art will take care to choose one or more ingredient(s) annex(es) such that the advantageous properties of the endolysin(s) of the invention are not, or not substantially, altered.
[0123] The additional ingredients are present in the compositions in a usual content for each of them in a cosmetic composition, in particular in a usual content for each of them allowing them to retain their cosmetic properties, more particularly in a usual content for each of them allowing them, when they are each the only ingredient of a composition according to the invention having this property, to retain their cosmetic property.
[0124] Thus, a composition according to the invention may comprise one or more of the following additional ingredients chosen from surfactants; fatty substances; colorants; preservatives; perfumes; pH adjusters such as organic acids such as citric acid; antioxidants; hydrophilic gelling agents such as hydroxypropylmethylcellulose; amino acids such as arginine; carbohydrates; chelating agents; sugar alcohols; cosmetic active ingredients; and mixtures thereof.
[0125] Of course, the person skilled in the art will take care to choose this or these possible additional ingredient(s) and / or their quantity in such a way that the advantageous properties of a composition according to the invention are not, or not substantially, altered by the envisaged addition.
[0126] The additional ingredient(s) other than those listed below may be present in the composition according to the invention in a concentration of between 0.001% and 20% by weight, in particular from 0.01% to 10% by weight, more particularly between 0.1% and 5% by weight relative to the total weight of the composition.
[0127] According to a particular embodiment, a composition according to the invention may comprise at least one additional ingredient chosen from an oil, an aromatic alcohol of formula (II), an organic filler, a non-ionic surfactant, and mixtures thereof. Oil
[0128] A composition according to the invention may comprise at least one oil.
[0129] For the purposes of the present invention, “oil” means a liquid compound at 25°C and atmospheric pressure (1.013.105 Pa), immiscible with water.
[0130] By "immiscible" is meant that the mixture of the same quantity of water and oil, after stirring, does not lead to a stable solution comprising only one phase, under the aforementioned temperature and pressure conditions. The observation is made by eye or by means of a phase contrast microscope if necessary, on 100 g of mixture obtained after Rayneri stirring sufficient to cause a vortex to appear within the mixture (for information 200 to 1000 rpm); the resulting mixture being left to stand, in a closed bottle, for 24 hours at room temperature before observation.
[0131] The term "hydrocarbon oil" means an oil containing mainly hydrogen and carbon atoms and optionally one or more functions chosen from hydroxyl, ester, ether, carboxylic functions. A hydrocarbon oil therefore does not contain any silicon or fluorine atoms.
[0132] By “silicone oil” is meant an oil comprising at least one silicon atom, and in particular at least one Si-O group, and more particularly an organo-polysiloxane.
[0133] By “fluorinated oil” is meant an oil comprising at least one fluorine atom.
[0134] By "apolar hydrocarbon oil" is meant a hydrocarbon oil which does not comprising only carbon and hydrogen atoms, in particular non-aromatic (also called hydrocarbon).
[0135] By “polar hydrocarbon oil” is meant hydrocarbon oils mainly comprising hydrogen and carbon atoms and one or more functions chosen from hydroxyl, ester, ether, carboxylic functions.
[0136] In particular, the composition according to the invention may comprise at least one oil chosen from volatile oils and non-volatile oils, in particular with the exception of paraffin oils.
[0137] Volatile oils
[0138] By "volatile oil" is meant an oil (or non-aqueous medium) capable of evaporating on contact with the skin in less than one hour, at room temperature and atmospheric pressure. Volatile oil is a volatile cosmetic oil, liquid at room temperature, having in particular a non-zero vapor pressure, at room temperature and atmospheric pressure, in particular, having a vapor pressure ranging from 0.13 Pa to 40,000 Pa (103 to 300 mm Hg), and in particular, ranging from 1.3 Pa to 13,000 Pa (0.01 to 100 mm Hg), and more particularly ranging from 1.3 Pa to 1300 Pa (0.01 to 10 mm Hg).
[0139] According to a particular embodiment of the invention, the volatile oils are such that the flash points are less than 120°C and the vapor pressure is less than 5 Pa, more particularly the flash point of which is less than 90°C and the vapor pressure is greater than 1 Pa, even more particularly the flash point of which is less than or equal to 60°C and the vapor pressure is greater than 5 Pa and even more particularly the flash point of which is less than 60°C and the vapor pressure is greater than 100 Pa.
[0140] The volatile oil(s) may be chosen from volatile hydrocarbon oils such as: - hydrocarbon oils having 8 to 16 carbon atoms, and in particular: a) branched C8-C16 alkanes such as isoalkanes such as iso-alkanes (also called isoparaffins) such as C8-C9 Isoparaffin, C13-C16 Isoparaffin, isododecane, isodecane, isohexadecane, and for example oils sold under the trade names Isopars or Permetyls, alone or in mixtures, in particular isododecane (also called 2,2,4,4,6-pentamethylheptane), for example marketed by INEOS, more particularly isododecane; (b) linear C6-C16 alkanes, alone or in mixtures, for example such as hexane, decane, undecane, tridecane, isoparaffins such as, or n-dodecane (C12) and n-tetradecane (C14) sold by Sasol respectively under the references PARAFOL 12-97 and PARAFOL 14-97, the undecane-tridecane mixture, the mixtures of n-undecane (Cl 1) and n-tridecane (Cl3) obtained in examples 1 and 2 of application WO 2008 / 155059 from Cognis, and their mixtures as well as the mixtures of n-undecane (C11) and n-tridecane (Cl3) Cetiol Ultimate® from BASF; (c) volatile C5-C12 cyclic, non-aromatic alkanes; - short-chain esters having 3 to 8 carbon atoms in total, such as methyl acetate, ethyl acetate, propyl acetate, n-butyl acetate or isobutyl acetate, for example sold by SOLVAY, DOW or OXEA; - volatile carbonate hydrocarbon oils of structure R' 1-OC(O)-O-R'2 in which R' 1 and R'2, identical or different, independently denote a linear, branched or cyclic C4-C8 alkyl group, in particular a linear C4-C8 alkyl group. It may be preferable for R1 and R2 to be identical. In particular R' 1 and R'2 denote a linear butyl alkyl radical, a pentyl group. Advantageously, the ether oil is chosen from dibutylcarbonate or dipentylcarbonate; - volatile ether oils of formula R1-O-R2 in which RI and R2, which are identical or different, independently denote a linear, branched or cyclic C4-C8 alkyl group, in particular a linear or branched C4-C8 alkyl group. It is preferable that RI and R2 are identical. As a linear alkyl group, mention may be made of a butyl group, a pentyl group. As a branched alkyl group, mention may be made of a 1-methylpropyl group, a 2-methylpropyl group, a t-butyl group, a 1,1-dimethylpropyl group.
[0141] In particular, the volatile hydrocarbon oil(s) are chosen from C8-C16 alkanes, in particular linear ones, and more particularly are chosen from C9-C12 alkanes, even more particularly are chosen from a mixture of C9-C12 alkanes such as VEGELIGHT SILK® marketed by BioSynthls.
[0142] The volatile oil(s) may be chosen from volatile silicone oils such as: - silicone oils comprising in particular from 2 to 7 silicon atoms, these silicone oils optionally comprising alkyl or alkoxy groups having from 1 with 10 carbon atoms. As volatile silicone oil that can be used in the invention, mention may be made, in particular, of dimethicones with viscosity 5 and 6 cSt, cyclopentadime-thylsiloxane, dodecamethylpentasiloxane, cyclohexadimethylsiloxane, octamethyl cyclotetrasiloxane, decamethyl cyclopentasiloxane, dodecamethyl cyclohexasiloxane, heptamethyl hexyltrisiloxane, heptamethyloctyl trisiloxane, hexamethyl disiloxane, octamethyl trisiloxane, decamethyl tetrasiloxane, dodecamethyl pentasiloxane, and mixtures thereof. Examples include dodecamethyl-pentasiloxane such as the reference DM-FLUID-2cs marketed by SHIN-ETSU or cyclohexadimethylsiloxane such as the reference XIAMETER PMX-0246 CYCLOHEXASILOXANE marketed by DOW CHEMICAL.
[0143] Non-volatile oils
[0144] By "non-volatile oil" is meant an oil whose vapor pressure at 25°C and atmospheric pressure is non-zero and less than 2.66 Pa, more particularly less than 0.13 Pa. For example, the vapor pressure can be measured using the static method or by the isothermal thermogravimetry effusion method, depending on the vapor pressure of the oil (OECD standard 104).
[0145] The non-volatile oil(s) may be of natural or synthetic origin, in particular natural.
[0146] Among the non-volatile oils, we can cite: - non-volatile fluorinated oils which may in particular be chosen from fluorinated polyethers, as well as from fluorosilicone oils, fluorinated silicones as described in document EP-A-847752; - the non-volatile silicone oils may in particular be chosen from non-volatile silicones with the following INCI names: dimethicone, dimethiconol, trimethyl pentaphenyl trisiloxane, tetramethyl tetraphenyl trisiloxane, diphenyl dimethicone, tri-methylsiloxyphenyl dimethicone, phenyltrimethicone, diphenylsiloxy phenyl tri-methicone; as well as mixtures thereof. These products are notably marketed under the names PH-1555 HRI Cosmetic Fluid (Trimethyl Pentaphenyl Trisiloxane), Dow Corning 556 Cosmetic Grade Fluid (Phenyltrimethicone) by Dow Corning; Diphenyl Dimethicone such as products KF-54, KF54HV, KF-50-300CS, KF-53 d, KF-50-100CS or Diphenylsiloxy Phenyl Trimethicone KF56 A marketed by Shin Etsu, marketed by Shin Etsu; products Belsil PDM 1000, Belsil PDM 20 marketed by Wacker Chemie (Trimethylsiloxy Phenyl Dimethicone), alone or in mixtures; - non-volatile apolar hydrocarbon oils which may in particular be chosen from linear or branched compounds, of mineral or synthetic origin such as for example: i) squalane such as the NEOSSANCE SQUALANE reference marketed by AMYRIS, isoeicosane, ii) mixtures of linear hydrocarbons, saturated, particularly C14-C30, more particularly C15-C28, such as mixtures whose INCI names are for example the following: (C15-C19)alkane, (C18-C21)Alkane, (C21-C28)alkane, such as for example the products Gemseal 40, Gemseal 60, Gemseal 120 marketed by Total, Emogreen L19 marketed by SEPPIC, Emogreen L15 marketed by SEPPIC, iii) polybutenes, hydrogenated or not, such as for example products from the Indopol range marketed by the company INEOS Oligomers, products with the INCI name HYDROGENATED POLY-ISOBUTENE; iv) polyisobutenes, hydrogenated or not, in particular hydrogenated such as for example the non-volatile compounds of the Parléam® range marketed by the company NIPPON OIL FATS, v) polydecenes, hydrogenated or not, such as for example the non-volatile compounds of the PURESYN® range marketed by the company Exxonmobil), vi) decene / butene copolymers, butene / isobutene copolymers and vii) their mixtures; - polar non-volatile hydrocarbon oils which can be chosen from: (i) fatty alcohols, saturated, unsaturated, linear or branched, C10-C26, liquid at room temperature (25°C), in particular mono-alcohols. In particular, C10-C26 alcohols are fatty alcohols, in particular branched when they comprise at least 16 carbon atoms; in particular, the fatty alcohol comprises from 10 to 24 carbon atoms, and more particularly from 12 to 22 carbon atoms, such as in particular lauryl alcohol, isostearyl alcohol, oleyl alcohol, 2-butyloctanol, 2-undecyl pentadecanol, 2-hexyldecyl alcohol, isocetyl alcohol, octyldodecanol and mixtures thereof; (ii) triglycerides consisting of esters of fatty acids and glycerol, in particular the fatty acids of which may have chain lengths varying from C4 to C36, and in particular from C18 to C36, these oils being able to be linear or branched, saturated or unsaturated;Examples include heptanoic or octanoic triglycerides, caprylic / capric acid triglycerides; vegetable oils such as wheat germ, sunflower, grape seed, sesame, corn, apricot kernel, castor, shea, avocado, olive, soybean, sweet almond, palm, rapeseed, cotton, hazelnut, macadamia, jojoba, alfalfa, poppy, pumpkin, squash, blackcurrant, evening primrose, millet, barley, quinoa, rye, safflower, candlenut, passionflower, musk rose, peanut, coconut, argan, passionflower, kaya; the liquid fraction of shea butter, and the liquid fraction of cocoa butter; as well as their mixtures; ; iii) linear aliphatic hydrocarbon esters of formula RC(O)-OR' in which RC(O)-O- represents the carboxylic acid residue containing from 2 to 40 carbon atoms, and R' represents a hydrocarbon chain containing from 1 to 40 carbon atoms, aliphatic hydrocarbon esters of alkylene glycol, in particular ethylene glycol or propylene glycol; the total number of carbon atoms advantageously being at least 10. Examples of such esters include, for example, isoamyl laurate, cetostearyl octanoate, isopropyl stearate or isostearate, ethyl palmitate, 2-ethylhexyl palmitate, isostearyl isostearate, octyl stearate, isostearyl heptanoate, octanoates, decanoates or ricinoleates of alcohols or polyalcohols such as propylene glycol dioctanoate, cetyl octanoate, coco caprylate caprate, tridecyl octanoate, 2-ethylhexyl palmitate, alkyl benzoate, polyethylene glycol diheptanoate, diethyl 2-propylene glycol hexanoate and mixtures thereof, hexyl laurate, neopentanoic acid esters such as isodecyl neopentanoate, isotridecyl neopentanoate, isostearyl neopentanoate, octyl-2-docecyl neopentanoate, isononanoic acid esters such as isononyl isononanoate, isotridecyl isononanoate, octyl isononanoate,oleyl erucate; lauroyl isopropyl sarcosinate, diisopropyl sebacate, isocetyl stearate, isodecyl neopentanoate, isostearyl behenate, myristyl myristate; and mixtures thereof; , iv) hydroxylated esters such as polyglycerol-2 triisostearate; (v) aromatic esters such as tridecyl trimellitate, C12-C15 alcohol benzoate, 2-phenyl ethyl ester of benzoic acid, butyl octyl salicylate; (vi) linear fatty acid esters having a total carbon number ranging from 35 to 70 such as pentaerythrityl tetrapelargonate; (vii) esters of fatty alcohols or branched C24-C28 fatty acids such as triisoarachidyl citrate, pentaerythrityl tetraisononanoate, glyceryl triisostearate, glyceryl tri-2-decyl tetradecanoate, pentaerythrityl tetraisostearate, polyglyceryl-2-tetraisostearate or pentaerythrityl-2-tetradecyl tetradecanoate; (viii) polyesters obtained by condensation of unsaturated fatty acid dimer and / or trimer and diol such as those with the INCI name dilinoleic acid / butanediol copolymer, dilinoleic acid / propanediol copolymer; polyesters obtained by condensation of fatty acid dimer and diol dimer such as dimer dilinoleyl dimer dilinoleate; (ix) synthetic ether of formula R1-O-R2 in which R1 and R2, which may be identical or different, independently denote a linear, branched or cyclic C6-C24 alkyl group, in particular a C6-C18 alkyl group, and more particularly a C8-C12 alkyl group. It may be preferable for R1 and R2 to be identical.As a linear alkyl group, there may be mentioned a hexyl group, a heptyl group, an octyl group, a nonyl group, a decyl group, an undodyl group, a dodecyl group, a tridecyl group, a tetradecyl group, a pentadecyl group, a hexadecyl group, a heptadecyl group, an octadecyl group, a nonadecyl group, an eicosyl group, a behenyl group, a docosyl group, a tricosyl group and a . tetracosyl group. As a branched alkyl group, there may be mentioned a 1,1-dimethylpropyl group, a 3-methylhexyl group, a 5-methylhexyl group, an ethylhexyl group, a 2-ethylhexyl group, a 5-methyloctyl group, a 1-ethylhexyl group, a 1-butylpentyl group, a 2-butyloctyl group, an isotridecyl group, a 2-pentylnonyl group, a 2-hexyldecyl group, an isostearyl group, a 2-heptylundecyl group, a 2-octyldodecyl group, a 1,3-dimethylbutyl group, a 1-(1-methylethyl)-2-methylpropyl group, a 1,1,3,3-tetramethylbutyl group, a 3,5,5-trimethylhexyl group, a 1-(2-methylpropyl)-3-methylbutyl group, a 3,7-dimethyloctyl group, and a 2-(1,3,3-trimethylbutyl)-5,7,7-trimethyloctyl group. As a cyclic alkyl group, there may be mentioned a cyclohexyl group, a 3-methylcyclohexyl group and a 3,3,5-trimethylcyclohexyl group., dilauryl ether, diisostearyl ether, dioctyl ether, no-nylphenyl ether, dodecyl dimethylbutyl ether, cetyl dimethylbutyl ether, cetyl isobutyl ether and mixtures thereof. Among the non-volatile ether oils, we can cite dicaprylyl ether, such as the reference CETIOL OE marketed by BASF; . x) carbonates of formula R8-OC(O)-O-R9, with R8 and R9, identical or different, represent a C4 to C12 alkyl chain, and in particular from C6 to C10, linear or branched; the carbonate oils may be dicaprylyl carbonate (or dioctyl carbonate), marketed under the name Cetiol CC® by the company BASF, di(ethyl-2-hexyl) carbonate, marketed under the name TEGOSOFT DEC® by the company Evonik, dipropylheptyl carbonate (Cetiol 4 Ail from BASF), dibutyl carbonate; di-neopentyl carbonate; dipentyl carbonate; di-neoheptyl carbonate; di-heptyl carbonate; di-isononyl carbonate; or di-nonyl carbonate; and more particularly dioctyl carbonate; (xi) vinylpyrrolidone copolymers such as vinylpyrrolidone / 1-hexadecene copolymer (INCI name); (xii) higher C6-C26 fatty acids liquid at room temperature (25°C) such as oleic acid, linoleic acid, linolenic acid, or isostearic acid; and (xiii) mixtures thereof.
[0147] According to a particular embodiment, the composition comprises at least one oil chosen from volatile C8-C16 alkane hydrocarbon oils, non-volatile silicone oils, non-volatile apolar hydrocarbon oils with the exception of paraffin oils, non-volatile polar hydrocarbon oils as defined above, and mixtures thereof, more particularly chosen from non-volatile polar hydrocarbon oils and mixtures thereof.
[0148] According to a particular embodiment, the composition comprises at least one oil chosen from non-volatile polar hydrocarbon oils, more particularly, the composition according to the invention comprises at least one oil chosen from polar hydrocarbon non-volatile oils and does not comprise apolar hydrocarbon non-volatile oils, even more particularly the composition according to the invention comprises at least one oil chosen from polar hydrocarbon non-volatile oils and does not comprise apolar hydrocarbon non-volatile oils, fluorinated non-volatile oils, silicone non-volatile oils, or volatile oils.
[0149] According to a particular embodiment, the polar hydrocarbon non-volatile oils are chosen from: (i) fatty alcohols, saturated, unsaturated, linear or branched, C10-C26, liquid at room temperature (25°C), in particular mono-alcohols. In particular, C10-C26 alcohols are fatty alcohols, in particular branched when they comprise at least 16 carbon atoms; more particularly, the fatty alcohol comprises from 10 to 24 carbon atoms, and even more particularly from 12 to 22 carbon atoms, such as in particular lauryl alcohol, isostearyl alcohol, oleyl alcohol, 2-butyloctanol, 2-undecyl pentadecanol, 2-hexyldecyl alcohol, isocetyl alcohol, octyldodecanol and mixtures thereof; ii) triglycerides consisting of fatty acid esters of glycerol, in particular the fatty acids of which may have chain lengths varying from C4 to C36, and in particular from C18 to C36, these oils being able to be linear or branched, saturated or unsaturated; by way of examples, mention may in particular be made of heptanoic or octanoic triglycerides, caprylic / capric acid triglycerides; vegetable oils such as wheat germ, sunflower, grape seed, sesame, corn, apricot kernel, castor, shea, avocado, olive, soybean, sweet almond, palm, rapeseed, cotton, hazelnut, macadamia, jojoba, alfalfa, poppy, pumpkin, squash, blackcurrant, evening primrose, millet, barley, quinoa, rye, safflower, candlenut, passionflower, musk rose, peanut, coconut, argan, passionflower, kaya; the liquid fraction of shea butter, and the liquid fraction of cocoa butter;as well as their mixtures; ; iii) linear aliphatic hydrocarbon esters of formula RC(O)-OR' in which RC(O)-O- represents the carboxylic acid residue containing from 2 to 40 carbon atoms, and R' represents a hydrocarbon chain containing from 1 to 40 carbon atoms, aliphatic hydrocarbon esters of alkylene glycol, in particular ethylene glycol or propylene glycol; the total number of carbon atoms being advantageously at least 10. Examples of such esters include, for example, isoamyl laurate, cetostearyl octanoate, isopropyl stearate or isostearate, ethyl palmitate, 2-ethylhexyl palmitate, isostearyl isostearate, octyl stearate, isostearyl heptanoate, octanoates, decanoates or ricinoleates of alcohols or polyalcohols such as propylene glycol dioctanoate, cetyl octanoate, coco caprylate caprate, tridecyl octanoate, palmitate ethyl 2-hexyl, alkyl benzoate, polyethylene glycol diheptanoate, propylene glycol diethyl 2-hexanoate and mixtures thereof, hexyl laurate, neopentanoic acid esters such as isodecyl neopentanoate, isotridecyl neopentanoate, isostearyl neopentanoate, octyl-2-docecyl neopentanoate, isononanoic acid esters such as isononyl isononanoate, isotridecyl isononanoate, octyl isononanoate, oleyl erucate; lauroyl isopropyl sarcosinate, diisopropyl sebacate, isocetyl stearate, isodecyl neopentanoate, isostearyl behenate, myristyl myristate; and mixtures thereof; ix) synthetic ether of formula R1-O-R2 in which RI and R2, identical or different, independently denote a linear, branched or cyclic C6-C24 alkyl group, in particular a C6-C18 alkyl group, and more particularly a C8-C12 alkyl group. It may be preferable for RI and R2 to be identical. As a linear alkyl group, mention may be made of a hexyl group, a heptyl group, an octyl group, a nonyl group, a decyl group, an undodyl group, a dodecyl group, a tridecyl group, a tetradecyl group, a pentadecyl group, a hexadecyl group, a heptadecyl group, an octadecyl group, a nonadecyl group, an eicosyl group, a behenyl group, a docosyl group, a tricosyl group and a tetracosyl group.As a branched alkyl group, there may be mentioned a 1,1-dimethylpropyl group, a 3-methylhexyl group, a 5-methylhexyl group, an ethylhexyl group, a 2-ethylhexyl group, a 5-methyloctyl group, a 1-ethylhexyl group, a 1-butylpentyl group, a 2-butyloctyl group, an isotridecyl group, a 2-pentylnonyl group, a 2-hexyldecyl group, an isostearyl group, a 2-heptylundecyl group, a 2-octyldodecyl group, a 1,3-dimethylbutyl group, a 1-(1-methylethyl)-2-methylpropyl group, a 1,1,3,3-tetramethylbutyl group, a 3,5,5-trimethylhexyl group, a 1-(2-methylpropyl)-3-methylbutyl group, a 3,7-dimethyloctyl group, and a 2-(1,3,3-trimethylbutyl)-5,7,7-trimethyloctyl group. As a cyclic alkyl group, there may be mentioned a cyclohexyl group, a 3-methylcyclohexyl group and a 3,3,5-trimethylcyclohexyl group., dilauryl ether, diisostearyl ether, dioctyl ether, no-nylphenyl ether, dodecyl dimethylbutyl ether, cetyl dimethylbutyl ether, cetyl isobutyl ether and mixtures thereof. Among the non-volatile ether oils, we can cite dicaprylyl ether, such as the reference CETIOL OE marketed by BASF; . x) carbonates of formula R8-OC(O)-O-R9, with R8 and R9, identical or different, represent a C4 to C12 alkyl chain, and in particular from C6 to C10, linear or branched; the carbonate oils may be dicaprylyl carbonate (or dioctyl carbonate), marketed under the name Cetiol CC® by the company BASF, di(ethyl-2-hexyl) carbonate, marketed under the name TEGOSOFT DEC® by Evonik, dipropylheptyl carbonate (Cetiol 4 Ail from BASF), dibutyl carbonate; di-neopentyl carbonate; dipentyl carbonate; di neoheptyl carbonate; di-heptyl carbonate; di-isononyl carbonate; or di-nonyl carbonate; and more particularly dioctyl carbonate; More particularly, the polar hydrocarbon non-volatile oils are chosen from: ii) triglycerides consisting of fatty acid esters of glycerol, in particular the fatty acids of which may have chain lengths varying from C4 to C36, and in particular from C18 to C36, these oils being able to be linear or branched, saturated or unsaturated; by way of examples, mention may in particular be made of heptanoic or octanoic triglycerides, caprylic / capric acid triglycerides; vegetable oils such as wheat germ, sunflower, grape seed, sesame, corn, apricot kernel, castor, shea, avocado, olive, soybean, sweet almond, palm, rapeseed, cotton, hazelnut, macadamia, jojoba, alfalfa, poppy, pumpkin, squash, blackcurrant, evening primrose, millet, barley, quinoa, rye, safflower, candlenut, passionflower, musk rose, peanut, coconut, argan, passionflower, kaya; the liquid fraction of shea butter, and the liquid fraction of cocoa butter;as well as their mixtures. ;
[0150] According to a particular embodiment, the composition comprises at least one oil chosen from the group consisting of: - polar non-volatile hydrocarbon oils of the triglyceride type consisting of esters of fatty acids and glycerol, in particular the fatty acids of which may have chain lengths varying from C4 to C36, and in particular from C18 to C36, these oils being able to be linear or branched, saturated or unsaturated, chosen from soybean oil, jojoba seed oil, shea butter olein, capric acid and caprylic acid triglycerides, and mixtures thereof, - volatile C8-C16 alkane oils, such as C9-C12 alkanes and isoparaffin, - non-volatile apolar oils such as squalane, - non-volatile polar hydrocarbon oils of synthetic ether type of formula R1-O-R2 in which R1 and R2, identical or different, independently denote a linear, branched or cyclic C6-C24 alkyl group, in particular a C6-C18 alkyl group, and more particularly a C8-C12 alkyl group, such as dicaprylyl ether, - non-volatile silicone oils such as dimethicone, - non-volatile polar hydrocarbon oils of the fatty alcohol type, saturated, unsaturated, linear or branched, C10-C26, liquid at room temperature (25°C) such as octyldodecanol, - non-volatile polar hydrocarbon oils of the carbonate type of formula R8-OC(O)-O-R9, with R8 and R9, identical or different, representing a C4 to C12 alkyl chain, in particular C6 to C10, linear or branched such as di-caprylyl carbonate and - their mixtures.
[0151] According to a particular embodiment, the oil is selected from the group consisting of octyldodecanol, soybean oil, shea butter olein, dicaprylyl carbonate, dimethicone, jojoba oil, isoparaffin, isononyl isonanoate, caprylic / capric acid triglycerides, C9-C12 alkanes, squalane, dicaprylyl ether, and mixtures thereof.
[0152] According to a particular embodiment, the oil is chosen from the group consisting of soybean oil, shea butter olein, jojoba oil, isononyl isonanoate, caprylic / capric acid triglycerides, and mixtures thereof.
[0153] According to a particular embodiment, the composition is free of paraffin oils, that is to say that the composition comprises 0% of paraffin oils.
[0154] The oils according to the invention may advantageously be present in a composition according to the invention in a usual content for a cosmetic composition, in particular in a usual content allowing them to play their cosmetic role in a composition of the invention, in particular in a cosmetic composition according to the invention, more particularly in a usual content allowing them to play their cosmetic role when they are the only ones to play this role in a composition according to the invention.
[0155] The oil can play different cosmetic roles such as that of consistency factor, holding of an emulsion in the cold, or providing the smooth appearance of the composition, in particular in the case of an emulsion. It can also participate in facilitating the spreading and sliding of the composition on the skin, as well as its penetration. Finally, the oil can act on the skin by its occlusive effect, its lubricating effect (to the touch) or its emollient / moisturizing effect.
[0156] A composition according to the invention may comprise a total oil content ranging from 1% to 80% by weight relative to the total weight of the composition, in particular from 2% to 60% by weight relative to the total weight of the composition, more particularly from 5% to 40% by weight, even more particularly from 10% to 30% by weight relative to the total weight of the composition.
[0157] By total oil content(s), we mean the sum of the contents of each of the previously mentioned oils present in the composition, or, when only one of these oils is present in the composition, we mean the content of this oil. Aromatic alcohols
[0158] A composition according to the invention may, in addition, comprise at least one alcohol aromatic of formula (II) one of its salts, in particular its base salts, organic or mineral, one of its optical isomers, one of its geometric isomers or one of its solvates such as hydrates:
[0159] [Chem.2] in which - R1 represents a group selected from the group consisting of: a) linear or branched hydroxy(CrC4)alkyl, in particular a hydroxy(CrC2)alkyl group, b) a group selected from -OR5, -C(O)R6, -C(O)OR7, and -(CH2)nC(H)(R8)-C(O)R9, with : R5 representing a linear or branched (C3-C4)alkyl group, optionally substituted by one or more hydroxyl group(s) (OH), R6 representing a hydrogen atom or a linear or branched (Ci-C4)alkyl group, a phenyl or a benzyl, optionally substituted by one or more hydroxyl group(s), R7 representing a linear or branched (Ci-C4)alkyl group, a phenyl or a benzyl, optionally substituted by one or more hydroxyl group(s), R8 representing a hydrogen atom or a linear or branched (Ci-C4)alkyl group such as methyl or ethyl, in particular R8 representing a hydrogen atom; R9 representing a hydrogen atom, or a (CrCi2)alkyl group, linear or branched, in particular linear, optionally substituted by one or more hydroxyl group(s) or a (C2-Ci2)alkenyl group, linear or branched, in particular linear, optionally substituted by one or more hydroxyl group(s), n is 0, 1 or 2, in particular n is 1 - R2 represents a hydrogen atom; a halogen atom, in particular a chlorine atom; or a hydroxyl group; and - R3 represents a hydrogen atom or a group chosen from hydroxyl and linear or branched (Ci-C6)alkoxy, in particular (CrC4)alkoxy such as methoxy -OCH3 ethoxy -OC2H5 in particular R3 represents a hydrogen atom or an ethoxy group; and - R4 is a hydrogen atom or a hydroxyl group; it being understood that at least one of the groups R1, R2, R3 or R4 carries or represents a hydroxyl group.
[0160] More particularly, the aromatic alcohol(s) of formula (II) of the invention are such that: - when R1 represents a -C(O)OR7 group then R2 is an -OH group; - when R1 represents a -C(O)R6 group then at least one of R2, R3 and R4 is an -OH group; - when R1 represents a group -(CH2)n -C(H)(R8)-C(O)R9 then R2 is a group -OH.
[0161] In particular, the aromatic alcohol may have the following formula (II):
[0162] [Chem.3] in which R1 is selected from the group consisting of a group: i) linear or branched hydroxy(Ci-C4)alkyl, in particular a hydroxy(CrC2)alkyl group such as hydroxymethyl or hydroxyethyl, ii) a group -OR5 with R5 representing a (C3-C4)hydroxyalkyl group, in particular -OR5 representing -O-CH2-CH(OH)-CH2OH, iii) a group -C(O)R6 with R6 representing a linear or branched (CrC4)alkyl group, in particular -C(O)R6 representing -C(O)-CH3, iv) a group -C(O)OR7 with R7 representing a linear or branched (CrC4)alkyl group, in particular R7 representing a methyl, ethyl, propyl, isopropyl, butyl, isobutyl, or benzyl group, and (v) a group -CH2-CH2-C(O)R9 with R9 representing a linear or branched (Ci-C6)alkyl group, in particular -CH2-CH2-C(O)R9 representing a group -CH2-CH2-C(O)CH 3 ; R2 is selected from the group consisting of a hydrogen atom; a halogen atom, in particular a chlorine atom; and a hydroxyl group; R3 is a hydrogen atom, a methoxy or ethoxy group; and R4 is a hydrogen atom or a hydroxyl group; it being understood that at least one of the groups R1, R2 or R4 carries or represents a hydroxyl group.
[0163] Such compounds play the role of preservatives, in particular in cosmetic compositions. Some also play the role of perfumes, in particular in cosmetic compositions.
[0164] By “organic or mineral base salt” is meant the salts of bases or alkaline agents as defined below.Examples of basic salts include alkali metal hydroxides such as sodium, potassium and lithium hydroxides; alkaline earth metal hydroxides such as calcium and magnesium hydroxides; hydroxides of other metals, such as aluminum and zinc hydroxides; ammonia and organic amines such as unsubstituted or hydroxy-substituted mono-, di- or tri-alkylamines; dicyclohexylamines; tributylamines; pyridine; N-methyl-N-ethylamine; diethylamine; triethylamine; mono-, bis- or tris-(2-hydroxy-alkylamines) such as mono-, bis- or tris-(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, tris-(hydroxymethyl)methylamine; N,N-di-alkyl-N-(hydroxyalkyl)-amines, such as N,N-dimethyl-N-(2-hydroxyethyl)amine; N-methyl-D-glucamine; and amino acids such as arginine and lysine.
[0165] For the purposes of the present invention, the term “alkyl group”, “alkyl group” or “alkyl radical” means a saturated, linear or branched monovalent hydrocarbon radical, in particular the methyl, ethyl, propyl, isopropyl, butyl, tert-butyl radicals, substituted or unsubstituted.
[0166] By "hydroxyalkyl group" is meant a linear or branched saturated hydrocarbon group comprising at least one -OH group. A hydroxy(Ci-C4)alkyl group is a linear or branched saturated C1-C4 hydrocarbon radical comprising at least one -OH group, in particular comprising a single -OH group. A hydroxy(Ci-C2)alkyl group is a linear or branched saturated C1-C2 hydrocarbon radical comprising at least one -OH group, in particular comprising a single -OH group.
[0167] According to a particular embodiment, the hydroxy(CrC4)alkyl group is selected from the group consisting of hydroxymethyl, 2-hydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, l-(hydroxymethyl)-2-methylpropyl, 2-hydroxybutyl, 3-hydroxybutyl, 4-hydroxybutyl, 2,3-dihydroxypropyl, l-(hydroxymethyl)-2-hydroxyethyl, 2,3-dihydroxybutyl, 3,4-dihydroxybutyl and 2-(hydroxymethyl)-3-hydroxypropyl. In particular, the hydroxy(Ci-C4)alkyl group is hydroxymethyl or 2-hydroxyethyl.
[0168] By "halogen atom" is meant one of the chemical elements of the 17th group of the periodic table of elements, namely fluorine, chlorine, bromine, iodine. In particular, the halogen atom is the chlorine atom.
[0169] According to a particular embodiment, R1 is chosen from the group consisting of (C i-C2)hydroxyalkyl, 2-hydroxyethyl, hydroxymethyl, a -O-CH2 -CH(OH)-CH2OH group, a -CH2-CH2-C(O)-CH3 group, and a -C(O)-OCH3 group> R2 is selected from the group consisting of a hydrogen atom, a halogen atom, in particular a chlorine atom, and a hydroxyl group, R3 is selected from the group consisting of a hydrogen atom and a -O-C2 -H5 group, and R4 is a hydrogen atom.
[0170] According to one embodiment, R1 represents a hydroxy(Ci-C4)alkyl group, more particularly a hydroxy(Ci-C2)alkyl group, R2 represents a hydrogen atom, R3 represents a hydrogen atom and R4 represents a hydrogen atom.
[0171] According to a particular embodiment, R1 represents a 2-hydroxyethyl, R2 represents a hydrogen atom, R3 represents a hydrogen atom and R4 represents a hydrogen atom.
[0172] According to a particular embodiment, R1 represents a hydroxymethyl, R2 represents a hydrogen atom, R3 represents a hydrogen atom, and R4 represents a hydrogen atom.
[0173] According to a particular embodiment, R1 represents a -OR5 group with R5 representing a linear or branched (C3-C4) alkyl group substituted by one or more hydroxyl group(s), R2 represents a halogen atom, R3 represents a hydrogen atom, and R4 represents a hydrogen atom. More particularly, R1 represents a -OR5 group with R5 representing a linear (C3-C4)alkyl group substituted by 2 hydroxyl groups, R2 represents a halogen atom, R3 represents a hydrogen atom, and R4 represents a hydrogen atom.
[0174] According to a particular embodiment, R1 represents a group -O-CH2 -CH(OH)-CH2OH, R2 represents a chlorine atom, R3 represents a hydrogen atom and R4 represents a hydrogen atom.
[0175] According to a particular embodiment, R1 represents a group -(CH2)nC(H)(R)8 -C(O)R9, with R8 representing a hydrogen atom or a methyl or ethyl group, and R9 representing a linear (CrCi2)alkyl group optionally substituted by a hydroxyl group or a (C2-Ci2)alkenyl group optionally substituted by a hydroxyl group, and n is as defined above, in particular n is 1, R2 represents a hydroxyl group, R3 represents a group -OCH3 or -OC2H5 and R4 represents a hydrogen atom. More particularly, R1 represents a group -CH2 -CH2-C(O)R9, R9 representing a linear (Ci-C12)alkyl group, in particular a (Ci - C6) linear alkyl such as methyl, R2 represents a hydroxyl group, R3 represents a -OC2H5 group, and R4 represents a hydrogen atom.
[0176] According to a particular embodiment, R1 represents a -C(O)OR7 group, with R7 representing a linear or branched (Ci-C4)alkyl group, a phenyl or a benzyl, optionally substituted by one or more hydroxyl group(s), R2 represents a hydroxyl group, R3 represents a hydrogen atom and R4 represents a hydrogen atom.
[0177] According to a particular embodiment, R1 represents a -C(O)-OCH3 group, R2 represents a hydroxyl group, R3 represents a hydrogen atom and R4 represents a hydrogen atom.
[0178] According to a particular embodiment, the aromatic alcohol of formula (II) is chosen from the group consisting of phenylethyl alcohol; benzyl alcohol; chlorphenesin (also called 3-(4-Chlorophenoxy)-1,2-propanediol); zingerone; ethylzingerone (also called 4-(3-ethoxy-4-hydroxyphenyl)butan-2-one); vanillin; parabens in particular (Ci-C6)alkylparabens or arylparabens in particular methylparaben, ethylparaben, propylparaben, isopropylparaben, butylparaben, isobutylparaben or benzylparaben; their salts and their mixtures.
[0179] According to a particular embodiment, the aromatic alcohol of formula (II) is chosen from the group consisting of phenylethyl alcohol; benzyl alcohol; chlorphenesin (also called 3-(4-Chlorophenoxy)-1,2-propanediol); zingerone; ethylzingerone (also called 4-(3-ethoxy-4-hydroxyphenyl)butan-2-one); parabens, in particular methylparaben; their salts, and their mixtures.
[0180] The composition according to the invention comprises in particular a total content of aromatic alcohol(s) of formula (II) ranging from 0.01% to 3% by weight relative to the total weight of the composition, in particular from 0.05% to 1.5% by weight, and more particularly from 0.1% to 1.0% by weight, relative to the total weight of the composition.
[0181] By total content of aromatic alcohol(s) of formula (II), we mean the sum of the contents of each of the aromatic alcohol(s) of formula (II), present in the composition, or, when only one aromatic alcohol of formula (II) is present in the composition, we mean the content of this aromatic alcohol of formula (II). Organic fillers
[0182] A composition according to the invention may further comprise one or more organic filler agent(s).
[0183] For the purposes of the present invention, the term “organic filler” is understood to mean colorless or white, solid particles of any form, of organic, natural or synthetic nature, which are in an insoluble form and dispersed in the middle of the composition.
[0184] The composition according to the invention may further comprise at least one organic filler chosen from an unmodified starch, an N-acylated amino acid, their salts, and their mixtures.
[0185] Unmodified starches
[0186] The composition according to the present invention may comprise one or more unmodified starch(es).
[0187] For the purposes of the present invention, the term "unmodified starch" means a native starch or a starch which has not undergone any chemical or physical modification, in particular by one or more of the following reactions: pregelatinization, oxidation, crosslinking, esterification, etherification, amidation, heat treatments.
[0188] The unmodified starch molecules that can be used in the present invention can originate from all plant sources of starch, in particular cereals and tubers; more particularly, they can be starches from corn, rice, cassava, barley, potato, wheat, sorghum, peas, oats.
[0189] According to a particular embodiment, the unmodified starch is chosen from corn starches, rice starches, potato starches, and mixtures thereof, in particular the unmodified starch is chosen from corn or potato starches.
[0190] According to a particular embodiment, the composition according to the invention is completely free of tapioca starch, in particular, the composition according to the invention is completely free of unmodified tapioca starch.
[0191] According to a particular embodiment, the unmodified starch used in the composition of the present invention is a corn starch such as that marketed under the name BEAUTE-BY-ROQUETTE ST005 by the company ROQUETTE.
[0192] The starch(es) may be present in the composition according to the invention in a content ranging from 0.1% to 10% by weight, in particular from 0.5% to 5% by weight, more particularly from 1% to 2.5% by weight, such as 1%, 1.5% or 2% by weight, relative to the total weight of the composition.
[0193] N-acylated amino acids and their salts
[0194] A composition according to the present invention may comprise one or more N-acylated amino acids, their salts, and their mixtures.
[0195] The term “salt” of an N-acylated amino acid according to the invention means a salt formed by an inorganic or organic acid or an inorganic or organic base.
[0196] Examples of acid salts include sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, isonicotinate, lactate, salicylate, tartrate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gen- tisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, glutamate and aspartate.
[0197] Examples of basic salts include alkali metal hydroxides such as sodium, potassium and lithium; alkaline earth metal hydroxides such as calcium and magnesium; other metal hydroxides such as aluminum and zinc; ammonia and organic amines such as unsubstituted or hydroxy-substituted mono-, di- or tri-alkylamines; dicyclohexylamines; tributyl amines; pyridine; N-methyl-N-ethylamine; diethylamine; triethylamine; mono-, bis- or tris-(2-hydroxy-alkylamines) such as mono-, bis- or tris-(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, tris-(hydroxymethyl)methylamine, N,N-di-alkyl-N-(hydroxyalkyl)-amines, such as N,N-dimethyl-N-(2-hydroxyethyl)amine; N-methyl-D-glucamine; and amino acids such as arginine and lysine.
[0198] The N-acylated amino acids suitable as organic filler according to the invention comprise at least one acyl group having from 8 to 22 carbon atoms, in particular a 2-ethyl hexanoyl, caproyl, lauroyl, myristoyl, palmitoyl, stearoyl or cocoyl group, in particular lauroyl.
[0199] The amino acid may be, for example, lysine, glutamic acid or alanine, preferably lysine.
[0200] The amino acid may be of D or L configuration, in particular L.
[0201] According to a particular embodiment of the invention, the C8-C22 N-acylated amino acids are chosen from lauroyl lysine, its salts and mixtures thereof, in particular N-lauroyl-L-lysine, its salts and mixtures thereof.
[0202] N-lauroyl-L-lysine is notably marketed under the name AMIHOPE LL® by the company AJINOMOTO.
[0203] The N-acylated amino acid(s) and their salts may be present in the composition according to the invention in a content ranging from 0.1% to 15% by weight, in particular from 1% to 10% by weight, more particularly from 2% to 4% by weight, such as 3% by weight, relative to the total weight of the composition.
[0204] The organic filler(s) may be present in the composition according to the invention in a total content ranging from 0.1% to 15% by weight, in particular from 0.5% to 10% by weight, more particularly from 1% to 4% by weight relative to the total weight of the composition.
[0205] A composition according to the invention may comprise one or more endolysin(s) according to the invention and one or more organic filler(s) in an endolysin(s) / organic filler(s) mass ratio of between 0.0001 and 0.04 and in particular of between 0.0002 and 0.004, more particularly of between 0.0006 and 0.002. Nonionic surfactants
[0206] The composition according to the invention may further comprise at least one non-ionic surfactant, in particular chosen from non-ionic surfactants comprising one or more carbohydrate residue(s), non-ionic surfactants of the C6-C30 fatty acid alkanolamide type.
[0207] For the purposes of the present invention, the term "surfactant" means any compound that modifies the surface tension between two surfaces. Surfactant compounds are amphiphilic molecules, that is to say they have two parts of different polarity, one lipophilic (which retains fatty substances) is apolar, the other hydrophilic (miscible in water) is polar. They thus make it possible to solubilize two immiscible phases, by interacting with one apolar (that is to say lipophilic and therefore hydrophobic), by its hydrophobic part; while with the other phase which is polar, it will interact by its hydrophilic part.
[0208] By "non-ionic surfactant" is meant a surfactant which does not have a net charge (does not ionize in water).
[0209] Non-ionic surfactant comprising one or more carbohydrate residue(s)
[0210] The composition according to the invention may further comprise at least one non-ionic surfactant comprising one or more carbohydrate residue(s).
[0211] For the purposes of the present invention, the term “carbohydrate” means a compound of the sugar or carbohydrate type, corresponding to a molecule essentially composed of carbon, hydrogen and oxygen atoms.
[0212] According to a particular embodiment, the carbohydrate residue(s) is (are) monosaccharides comprising 5 to 6 carbon atoms, more particularly chosen from glucose, fructose, xylose or galactose, even more particularly glucose.
[0213] According to a particular embodiment, the non-ionic surfactant(s) comprising one or more carbohydrate residue(s) is (are) chosen from: (i) esters of sugar(s) and fatty acid(s) such as (poly)esters of glycerol, glucose or alkylglucose and fatty acid having a linear or branched, saturated or unsaturated hydrocarbon chain, C6-C22, in particular C16-20; (ii) ethers of sugar(s) and fatty alcohol(s) such as alkyl(poly)glycosides; and (iii) mixtures thereof.
[0214] According to a particular embodiment, the non-ionic surfactant(s) comprising one or more carbohydrate residue(s) is (are) chosen from alkyl(poly)glycosides and (poly)esters of glycerol, glucose or alkylglucose and fatty acid having a linear or branched, saturated or unsaturated hydrocarbon chain, in C6-C22, in particular in C16-20, and mixtures thereof. - Alkyl(poly)glycoside
[0215] Non-ionic surfactants of the alkyl(poly)glycoside type are in particular represented by the following general formula (III):
[0216] [Chem 4]
[0217] R1O-(R2O)t-(G)v (III) in which: - R1 represents a linear or branched alkyl or alkenyl radical containing 6 to 24 carbon atoms, in particular 8 to 20 carbon atoms, or an alkylphenyl radical whose linear or branched alkyl radical contains 6 to 24 carbon atoms, in particular 8 to 20 carbon atoms; - R2 represents an alkylene radical containing 2 to 4 carbon atoms, - G represents a sugar unit comprising 5 to 6 carbon atoms, -1 denotes a value ranging from 0 to 10, in particular from 0 to 4, - v denotes a value ranging from 1 to 15, in particular from 1 to 4.
[0218] According to a particular embodiment, the alkyl(poly)glycoside surfactants are compounds of the formula described above in which: - R1 denotes a saturated or unsaturated, linear or branched alkyl radical containing from 8 to 20 carbon atoms, - R2 represents an alkylene radical containing 2 to 4 carbon atoms, -1 denotes a value ranging from 0 to 3, in particular equal to 0, - G denotes glucose, fructose or galactose, in particular glucose; - the degree of polymerization, that is to say the value of v, which can range from 1 to 15, in particular from 1 to 4; the average degree of polymerization being more particularly between 1 and 2.
[0219] The glucosidic bonds between the sugar units are generally of the 1-6 or 1-4 type, in particular of the 1-4 type.
[0220] As examples of alkyl(poly)glycoside, mention may be made of caprylyl / capryl glucoside such as the product marketed under the name ORAMIX CG 110L® by the company SEPPIC; decyl glucoside marketed under the name SORBITHIX L-100® by the company APPLECHEM; arachidylglucoside glucoside optionally mixed with arachidyl alcohol and behenyl alcohol, marketed for example under the name MONTANOV 202® by the company SEPPIC; ce-tylstearyl glucoside optionally mixed with cetylstearyl alcohol, marketed for example under the name MONTANOV 68MB® by the company SEPPIC, under the name EMULGADE PL 68 / 50® by the company BASF and under the names TEGO CARE CG 90 MB® by the company EVONIK GOLDSCHMIDT; cocoglucoside such as the product marketed under the name LAMESOFT PO65® by the company BASF; octyldodecyl xyloside such as marketed for example under the name FLUIDANOV 20X by the company SEPPIC.
[0221] The alkyl(poly)glycoside can be used in a mixture with at least one fatty alcohol, in particular a fatty alcohol having from 6 to 24 carbon atoms, and more particularly from 8 to 20 carbon atoms.
[0222] For example, it is possible to jointly use a fatty alcohol and an alkyl(poly)glycoside whose alkyl part is identical to that of the fatty alcohol selected.
[0223] The fatty alcohol / alkyl polyglycoside emulsifying mixtures as defined above are known as such. They are described in particular in applications WO 92 / 06778, WO 95 / 13863 and WO 98 / 47610 and prepared according to the preparation methods indicated in these documents.
[0224] Among the fatty alcohol / alkyl(poly)glycoside mixtures, we can cite the products sold by the company SEPPIC under the name MONTANOV® such as the following mixtures: - Arachidyl alcohol and behenyl alcohol / arachidylglucoside- MONTANOV 202® - Cetylstearyl alcohol / Cetylstearylglucoside - MONTANOV 68MB®.
[0225] In a particular embodiment, the composition according to the invention comprises a surfactant of alkyl(poly)glycoside type chosen from caprylyl / capryl glucoside, arachidyl glucoside, and mixtures thereof.
[0226] In a particular embodiment, the composition according to the invention does not comprise decyl glucoside.
[0227] - (polv)Glycerol esters of glucose or alkvlglucose and fatty acid
[0228] The (poly)esters of glycerol of glucose or alkylglucose and fatty acid having a linear or branched, saturated or unsaturated, C6-C22 hydrocarbon chain are in particular (poly)esters of glycerol of alkylglucose and fatty acid having a linear and saturated C6-C22, in particular C16-20, more particularly C18, hydrocarbon chain.
[0229] Among the (poly)esters of glycerol of glucose or alkylglucose and fatty acid having a linear or branched, saturated or unsaturated, C6-C22 hydrocarbon chain, polyglyceryl-3 methylglucose distearate is particularly preferred.
[0230] Among the commercial products, we can cite the product sold by the company, EVONIK GOLDSCHMIDT under the name TEGO CARE 450.
[0231] The non-ionic surfactant(s) comprising one or more carbohydrate residue(s) may be present in the composition according to the invention in a content ranging from 0.01 to 10% by weight, in particular in a content ranging from 0.05 to 8% by weight, more particularly in a content ranging from 0.1 to 5% by weight relative to the total weight of the composition, more particularly still in a content ranging from 0.2 to 3% by weight relative to the total weight of the composition.
[0232] A composition according to the invention may comprise one or more endolysin(s) according to the invention and one or more non-ionic surfactant(s) comprising one or more carbohydrate residue(s) according to the invention in a mass ratio of endolysin(s) / non-ionic surfactant(s) comprising one or more carbohydrate residue(s) of between 0.0001 to 0.5 and in particular of between 0.0002 and 0.1, more particularly of between 0.0004 and 0.05, even better of between 0.0006 to 0.02.
[0233] C6-C30 fatty acid alkanolamides
[0234] The composition according to the invention may also contain at least one non-ionic surfactant chosen from C6-C30 fatty acid alkanolamides.
[0235] Such surfactants may be chosen from mono-alkanolamides and dialkanolamides of formula (IV):
[0236] [Chem 5]
[0237] R'CONR2R3 (IV) in which: R1 is a linear or branched, saturated or unsaturated hydrocarbon group having from 6 to 30 carbon atoms, R2 and R3, independently, are hydrogen or a linear or branched, saturated or unsaturated alkanol group having 1 to 10 carbon atoms, provided that only one of R2 or R3 is hydrogen.
[0238] Examples of this type of surfactant include lauric acid monoethanolamide, lauric acid diethanolamide, lauric acid monopropanolamide, lauric acid monoisopropanolamide, myristic acid monoethanolamide, myristic acid diethanolamide, palmitic acid monoethanolamide, stearic acid monoethanolamide (stearamide MEA), acid monoethanolamide, oleic acid diethanolamide, oleic acid monoisopropanolamide, coconut oil fatty acid monoethanolamide (cocamide MEA), coconut oil fatty acid monopropanolamide, coconut oil fatty acid monoisopropanolamide (cocamide MIPA), erucic acid diethanolamide, palm vegetable oil fatty acid monoethanolamide, and mixtures thereof.
[0239] According to a particular embodiment in formula (IV), R1 is a linear or branched, saturated or unsaturated hydrocarbon group having from 8 to 18 carbon atoms,
[0240] R2 and R3, independently, are hydrogen or a linear or branched, saturated or unsaturated alkanol group having 2 to 5 carbon atoms, provided that only one of R2 or R3 is hydrogen.
[0241] According to a particular embodiment, in formula (IV), R2 is hydrogen, and R3 is a linear or branched saturated alkanol group having 2 to 5 carbon atoms.
[0242] According to a particular embodiment, the appropriate C6-C30 fatty acid alkanolamide of formula (IV) is chosen from coconut oil fatty acid monoethanolamide (INCI: cocamide MEA or cocamide monoethanolamine), coconut oil fatty acid monoisopropanolamide (INCI: cocamide MIPA or cocamide monoisopropanolamine), and mixtures thereof.
[0243] Such products are available, for example, coconut oil fatty acid monoethanolamide (cocamide MEA) marketed under the name COMPERLAN® 100 by the company COGNIS (BASF), coconut oil fatty acid monoisopropanolamide (cocamide MIPA) marketed under the trade name EMPILAN® CIS by the company Innospec active Chemicals.
[0244] According to a particular embodiment, said C6-C30 fatty acid alkanolamide is cocamide mono-isopropanolamine.
[0245] The C6-C30 fatty acid alkanolamide according to the present invention may be present in an amount ranging from 0.5% to 10% by weight, more particularly from 0.1% to 5% by weight, relative to the total weight of the composition.
[0246] According to a particular embodiment, a composition according to the invention comprises a quantity of less than 2% by weight relative to the total weight of the composition of solid fatty acid(s) at room temperature (25°C), more particularly a composition according to the invention comprises a quantity of less than 1% by weight relative to the total weight of the composition of solid fatty acid(s) at room temperature (25°C), i.e. or even is free (0% by weight relative to the total weight of the composition) of solid fatty acid at room temperature (25°C), and in particular does not comprise stearic acid.
[0247] According to a particular embodiment, a composition according to the invention comprises an amount of less than 0.5% by weight relative to the total weight of the composition of benzoic acid, and / or its salts, in particular benzoates of alkali or alkaline earth metals such as sodium benzoate, of sorbic acid and / or its salts, in particular sorbate of alkali or alkaline earth salt including potassium sorbate, more particularly less than 0.1% by weight or even is free (0% by weight relative to the total weight of the composition) of benzoic acid and / or its salts including sodium benzoate, and of sorbic acid and / or its salts including potassium sorbate.
[0248] According to a particular embodiment, a composition according to the invention comprises an amount of less than 0.1% in total amount by weight relative to the total weight of the composition of carrageenan, gellan gum, scleroglucan gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar, hydrogenated soy lecithin, sodium alginate, poly- acrylamidomethyl propane sulfonic acid, carbomer, cellulose, sodium polyacrylate, konjac gum, agar, and caesalpinia spinosa gum, more particularly according to one embodiment of the invention the composition is free (0% by weight relative to the total weight of the composition) of carrageenan, gellan gum, scleroglucan gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar, hydrogenated soy lecithin, sodium alginate, polyacrylamidomethyl propane sulfonic acid, carbomer, cellulose, sodium polyacrylate, konjac gum, agar, and Caesalpinia spinosa gum.
[0249] According to a particular embodiment, a composition according to the invention comprises an amount of less than 0.5% in total amount by weight relative to the total weight of the composition of anionic surfactant, more particularly the composition is free of anionic surfactant (0% by weight relative to the total weight of the composition).
[0250] According to a particular embodiment, a composition according to the invention comprises an amount less than or equal to 0.5% in total amount by weight relative to the total weight of the composition of cationic surfactant, more particularly the composition is free of cationic surfactant (0% by weight relative to the total weight of the composition).
[0251] According to a particular embodiment, a composition according to the invention comprises an amount less than or equal to 0.5% in total amount by weight relative to the total weight of the composition of amphoteric surfactant, more particularly the composition is free of amphoteric surfactant (0% by weight relative to the total weight of the composition).
[0252] According to a particular embodiment, a composition according to the invention comprises an amount less than or equal to 0.5% in total amount by weight relative to the total weight of the composition of zwitteronic surfactant, more particularly is free of zwitteronic surfactant (0% by weight relative to the total weight of the composition).
[0253] According to a particular embodiment, a composition according to the invention comprises an amount of less than 0.5% in total amount by weight relative to the total weight of the composition of anionic, cationic, amphoteric and zwitterionic surfactant, more particularly in an amount of less than 0.1% in total amount by weight relative to the total weight of the composition of anionic, cationic, amphoteric and zwitterionic surfactant, even more particularly an amount of less than 0.01% in total amount by weight relative to the total weight of the composition of anionic, cationic, amphoteric and zwitterionic surfactant, better still according to a particular embodiment the composition is free of anionic, cationic surfactant, amphoteric, and zwitterionic (0% by weight relative to the total weight of the composition).
[0254] According to a particular embodiment, a composition according to the invention comprises an amount less than 0.5% in total amount by weight relative to the total weight of the composition of glyceryl stearate citrate, of alkyl sulfate such as sodium lauryl sulfate, of alkyl ether sulfate such as sodium laureth sulfate, of disodium co-coamphodiacetate, of polyglycerol esters and fatty acid such as polyglyceryl-4-isostearate, of polyglyeryl-4-diisostearate polyhydroxy stearate sebacate, and of sodium stearate, glyceryl stearate citrate, of alkyl sulfate such as sodium lauryl sulfate, of alkyl ether sulfate such as sodium laureth sulfate, of disodium cocoam-phodiacetate, of polyglycerol esters and fatty acid such as polyglyceryl-4-isostearate and polyglyeryl-4-diisostearate polyhydroxystearate sebacate, and sodium stearate.
[0255] According to a particular embodiment, a composition according to the invention comprises an amount of less than 1% by weight relative to the total weight of the composition of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica, more particularly comprises an amount of less than 0.5% by weight relative to the total weight of the composition of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica, or is even free (0% by weight relative to the total weight of the composition) of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica.
[0256] According to a particular embodiment, a composition according to the invention comprises an amount of less than 0.1% by weight relative to the total weight of the composition of solid fatty acid at room temperature (25°C), and in particular does not comprise stearic acid; of benzoic acid, and / or its salts, in particular benzoates of alkali or alkaline earth metals such as sodium benzoate, of sorbic acid and / or its salts, in particular sorbate of alkali or alkaline earth salt including potassium sorbate; carrageenan, gellan gum, sclerotium glucan gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar, hydrogenated soy lecithin, sodium alginate, polyacrylamidomethyl propane sulfonic acid, carbomer, sodium polyacrylate, konjac gum, agar, and caesalpinia spinosa gum;glyceryl stearate citrate, alkyl sulfate such as sodium lauryl sulfate, alkyl ether sulfate such as sodium laureth sulfate, disodium cocoamphodiacetate, polyglycerol fatty acid esters such as polyglyceryl-4-isostearate and polyglyceryl-4-diisostearate polyhydroxystearate sebacate, and sodium stearate; kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin, and mica. ;
[0257] An aqueous composition according to the invention can be presented in all the galenic forms normally used in the cosmetic field, such as for example in the form of an aqueous gel, a lotion, a mousse, a micellar water, a cream, a paste or a serum.
[0258] A composition according to the invention is in particular suitable for topical administration.
[0259] Thus, a composition according to the invention can comprise all the constituents usually used in the application and topical administration envisaged.
[0260] An aqueous composition according to the invention may advantageously be in the form of an emulsion, in particular obtained by dispersing an aqueous phase in a fatty phase (W / O) or a fatty phase in an aqueous phase (O / W), of liquid or semi-liquid consistency of the milk type, or of soft consistency, or even of multiple emulsion (W / O / W or O / W / O). These compositions are prepared according to the usual known methods.
[0261] More particularly, a composition according to the invention may be intended for topical application and preferably may be in the form of an emulsion, preferably an oil-in-water emulsion. Preferably, such an emulsion is not intended to be rinsed after application.
[0262] A composition according to the invention is preferably intended to be applied to skin.
[0263] Preferably, the skin is the skin of the face, scalp, décolleté, neck, arms or forearms, or even more preferably, the skin of the face (in particular the forehead, nose, cheeks, chin), décolleté and neck.
[0264] The composition may alternatively have the form of a care or makeup product for the face and / or body, and be packaged for example in the form of a cream in a pot or a fluid in a tube or in a pump bottle or in a dropper bottle.
[0265] The composition according to the invention can be manufactured by any known process generally used in the cosmetic field.
[0266] The ingredients are mixed before being shaped, in the order and under conditions easily determined by those skilled in the art.
[0267] According to a particular embodiment of the invention, other agents intended to enhance the appearance and / or texture of the skin may also be added to the composition according to the invention. Uses and methods
[0268] According to one of its aspects, the present invention relates to the cosmetic use, in particular topical, of an aqueous composition according to the invention for preventing and / or treating a skin disorder linked to colonization by Staphylococcus aureus in a individual in need thereof, and in particular to prevent and / or treat acne and / or eczema in an individual in need thereof.
[0269] According to another of its aspects, the present invention relates to a non-therapeutic cosmetic process for caring for keratin materials, in particular the skin, comprising the topical application to these keratin materials of an aqueous composition according to the invention.
[0270] A skin may in particular be skin with acne or at risk of acne and / or skin with eczema or at risk of eczema. Thus, as indicated above, a skin disorder linked to colonization of the skin by S. aureus in an individual is in particular chosen from eczema, acne or acne and eczema.
[0271] The cosmetic uses and methods considered according to the invention are non-therapeutic.
[0272] The cosmetic uses and methods of the invention are preferably implemented by administering topically a composition according to the invention.
[0273] Topical administration consists of the external application to the skin of cosmetic compositions according to the usual techniques for using these compositions.
[0274] By way of illustration, the cosmetic use or process according to the invention may be implemented by topical application, for example daily, of at least one aqueous composition according to the invention, which may for example be formulated in the form of a cream, gel, serum, lotion, emulsion or cleansing milk.
[0275] The application can be repeated for example 1 to 2 times daily over one day or more and generally over a prolonged period of at least 3 days, at least 4 weeks, or even 4 to 15 weeks, with where appropriate one or more periods of interruption.
[0276] According to one embodiment, the application is daily (once a day) and generally over a prolonged period of at least 3 days, at least 4 weeks, or even 4 to 15 weeks, with, where appropriate, one or more periods of interruption.
[0277] According to one embodiment, the cosmetic treatment method according to the invention may comprise a single application.
[0278] Throughout the description, including the claims, the expressions "between ... and ..." and "ranging from ... to ..." must be understood inclusively, unless otherwise specified.
[0279] The following examples illustrate the present invention without limiting its scope.
[0280] In the examples, unless otherwise indicated, the temperature is ambient (20°C), and expressed in degrees Celsius, and the pressure is atmospheric pressure. Examples: Compositions tested and preparation
[0281] The different compositions tested below are described in Table 1 below.
[0282] [Tables 1] Ingredients Trehalose in water (8%) (composition according to the invention) Sucrose in water (8%) (outside the invention) Mannose in gel (1%) (outside the invention) TREHALOSE (TREHALOSE 100 from HAYASHIBARA) 8 / / SUCROSE / 8 / MANNOSE / / 1 PRESERVATIVE 0.2 0.2 / Endolysin of sequence SEQ ID NO: 10 0.002565 0.002565 0.002565 WATER qs 100 qs 100 / WATER, PROPYLENE GLYCOL, HYDROPHILIC GELATING AGENT / / qs 100
[0283] Table 1
[0284] A preservative was added to the systems to avoid any contamination during storage time and thus to carry out the various stability tests.
[0285] The trehalose and sucrose samples were prepared in a beaker with magnetic stirring at room temperature. All ingredients were poured into the beaker and kept stirring until the trehalose or sucrose was completely dissolved, approximately 15 minutes.
[0286] The mannose-based samples were prepared in a beaker with mechanical stirring at room temperature using a deflocculator. All ingredients except the hydrophilic gelling agent were poured into the beaker and kept stirring until completely homogenized. The hydrophilic gelling agent was then sprinkled, with stirring, into the beaker. Everything was kept stirring until the hydrophilic gelling agent thickened and dissolved completely, approximately 30 min.
[0287] The different ingredients of these three compositions are present in usual contents for each of them in an aqueous cosmetic composition, in particular in a usual content for each of them allowing it to play its role in an aqueous composition of the invention, in particular in a composition aqueous cosmetic according to the invention. Protocol (experimental conditions)
[0288] Preparation of the working suspension of Staphylococcus aureus (S. aureus^ from an ATCC 6538 lyophilisate (according to the recommendations of standard NF EN 12353).
[0289] The lyophilisate is rehydrated in Trypticase soy broth, inoculated onto Trypticase soy agar (TSA plates) and then incubated for 24 hours at 32.5°C. The cells are then recovered and resuspended in a commercial cryoprotective solution with cryobeads for storage at -80°C for up to 14 months (stock for long-term storage).
[0290] From a cryobead of this -80°C stock, a subculture is carried out on a TSA slant agar which is then incubated for 24 hours at 32.5°C to obtain the stock culture. This stock culture is stored at 4°C for a maximum of 9 weeks. The working culture is obtained by subculture of the stock culture on Trypticase soy agar then incubation for 24 hours at 35°C. The working suspension is prepared by suspending the cells of this working culture in a trypton salt diluent. This suspension is calibrated between 1 and 3x108 CFU (colony forming units) / mL by absorbance measurement at 620nm.
[0291] Evaluation of the antimicrobial activity of samples against S. aureus
[0292] The three formulas in Table 1 above were tested.
[0293] At T=1 week and T=26 weeks from the manufacture of the formulas, 20 gram aliquots of each formula are inoculated with 0.2 mL of a calibrated suspension of S. aureus. After homogenization, the level of microorganisms present in the product represents a concentration of S. aureus of 106 CFU per gram of product, i.e. a 1% inoculation of a suspension at 108 CFU per mL (the inoculum level is determined by spreading the suspension on Trypticase soy agar plates and incubating for 24 hours at 35°C). After t=30 minutes and t=60 minutes of contact at room temperature (20°C ± 3°C), 1 gram of the mixture is weighed and then 9.0 mL of Eugon LT100 supp broth is added and then mixed until completely homogenized. This mixture is then serially diluted in Eugon LT 100 supp broth until dilution of 1 / 100.
[0294] The dilutions are spread on Trypticase soy agar plates and incubated at 35°C for 48 hours until the surviving colonies of S. aureus are counted.
[0295] The antimicrobial activity on S. aureus is expressed as a logarithmic reduction relative to the initial level and associated with the activity of the active compound which is the endolysin of sequence SEQ ID NO: 10 by comparing the counts of surviving S. aureus in formula with and without the endolysin of sequence SEQ ID NO: 10.
[0296] This method is an adaptation of the challenge test method described in the standard “ISO 11930 Cosmetics - Microbiology - Evaluation of the antimicrobial protection of a cosmetic product”. Results and conclusions
[0297] The results are expressed as logarithmic reduction of Staphylococcus aureus compared to the inoculated rate. The reductions are thus between 0 log (no antimicrobial activity observed in the tested condition or complete loss of the activity of the endolysin of sequence SEQ ID NO: 10) and -5.4 log (maximum decrease observable in the test conditions or maintenance of the activity of the endolysin in the tested conditions). For values close to 0, no Staphylococcus aureus was destroyed. For values of -5.4, 99.9996% of the Staphylococcus aureus population was destroyed. The tested formula is therefore particularly active when the values approach -5.4.
[0298] A first evaluation of the antimicrobial activity of endolysin was carried out at T1 (1 week after the manufacture of the formulas), and a second was carried out at T26 (26 weeks of storage - or approximately 6 months after the manufacture of the formulas). This evaluation was carried out at these two times according to the protocol described above, i.e. the measurement of the activity of endolysin in formula after t=30 minutes of contact and t=1 hour of S. aureus / formula contact.
[0299] The results are provided in Table 2 below.
[0300] [Tables2] Contact time Log reduction t30min Log reduction tlh Formula tested Storage time (Weeks) 25 °C 25 °C Trehalose in water (8%) 1 -4.9 -5.4 Trehalose in water (8%) 26 -1.4 -2.4 Sucrose in water (8%) 1 -5.1 -5.4 Sucrose in water (8%) 26 -0.2 -0.3 Mannose in micron gel (1%) 1 -5.5 -5.5 Mannose in micron gel (1%) 26 -0.2 -0.5
[0301] Table 2
[0302] The results show that the activity of the endolysin of sequence SEQ ID NO: 10 is greater than 99% (Log reduction < -2) of destruction of S. Aureus colonies at 26 weeks / 25°C for the system comprising 8% trehalose (1 h of contact). The Trehalose is thus able to maintain over time the antibacterial performance against S. aureus of endolysin as shown by the Log reduction results in Table 2.
[0303] The equivalent with sucrose shows significantly more activity low at 26 weeks (6 months) under the same conditions. The system with the lower sugar concentration mannose also exhibits significantly lower activity under the same conditions.
[0304] Surprisingly, the results thus show that the combination of endolysin of sequence SEQ ID NO: 10 with trehalose allows better maintenance of antibacterial activity against S. aureus over time, compared to the combination of endolysin with other sugars. Sequence Listing
[0305] SEP ID NO: 1 CBD-2638 (protein)
[0306] WKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYD EQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK
[0307] SEP ID NO: 2 CBD-2638 (nucleic) 0308 AGGGCGAAACTGTATACATGCCGGTACGCACATGGGACGCTAAAACTGGT AAAGTTGGTAAGTTGTGGGGCGAATTAAATAA
[0309] SEP ID NO: 3 Ply2638 (protein)
[0310] MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRA FDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSM RFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGL AMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKITAPKPSIQGVVIHND YGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVLWYHPTDYVEWHCG NQWANANLIGFEVCESYPGRISDKLFLENEEATLKVAADVMKSYGLPVNRNT VRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYDGGKLE VSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAP EGIITRYKGPWTGHPQAGVLQKGQTIKYDEVQKFDGHVWVSWETFEGETVY MPVRTWDAKTGKVGKLWGEIK
[0311] SEP ID NO: 4 Ply2638 (protéique)
[0312] MRGSHHHHHHGSMLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENG INYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDN DWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKD AKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKIT APKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVL WYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEATLKVAAD VMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYF IKRIKHYYDGGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIW YKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEVQKFDGHVW VSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK
[0313] SEP ID NO: 5 Ply2638 (nucléique)
[0314] ATGCTAACTGCTATTGACTATCTTACGAAAAAGGTTGGAAAATATCATC TGACCCTCGCACTTACGATGGTTACCCTAAAAAACTACGGCTACAGAAATTA CCATGAAAACGGCATTAATTATGATGAGTTTTGTGGTGGTTATCATATAGACG TTTTGATGTTTACAGTAACGAAACTAAACGACGTGCCTGCTGTTACTAGCGG AACAGTTATTGAAGCAAACGATTACGGTAATTTTGGTGGTACATTCGTTAT TAGAGAGGCTAACGATAACGATTGGATATATGGGCATCTACAACGTGGCTC AATGCGATTTGTTGTAGGCGACAAAGTCAATCAAGGTGACATTATTGGTT ACAAAGGTAATAGCAACTATTACGACAATCCTATGAGTGTACATTTACATTT ACAATTACGCCCTAAAAGAGCAAAGAAAGATGAAAATCACAAGTAGTGTGTTGCTATGGAAAAATATGACATTACAAATTTAAATGCTAAACAAG ATAAATCAAAGATGGGACGTGAAAGGTTTGAAACATATCTATTCAAAC CATATTAAAGGTAACAAGATTACAGCACCAAAAACTAGTATTCAAGGTGTG GTCATCCACAATGATTATGGTAGTATGACACCTAGTCAATACTTACCATGG TTATATGCACGTGAGAATAACGGTACACACGTTAACGGTTGGGCTAGTGTT TATGCAAATAGAAACGAAGTGCTTTGGTATCATCCGACAGACTACGTAGAG TGGCATTGTGGTAATCAATGGGCAAATGCTAACTTAATCGGATTTGAAGTG TGTGAGTCGTATCCTGGTAGAATCTCGGACAAATTATTCTTAGAAATGAA GAAGCGACATTGAAAGTAGCTGCGGATGTGAATGAAGTCGTACGGATTACC AGTTAATCGCAACACTGTACGTCTGCATAACGAATTCTTCGGAACTTCTTGTCCACATCGTTCGTGGGACTTGCATGTTGGCAAAGGTGAGCCTTACACAACT ACTAATATTAATAAAATGAAAGACTACTTCATCAAACGCATCAAACAATTA TATGACGGTGGAAAGCTAGAAGTAAGCAAAGCAGCAACTATCAAACAATC TGACGTTAAGCAAGAAGTTAAAAAGCAAGCAAACAAATCAATC CAACAGATTGGAAACAGAATAAGATGGCATTTGGTATAAAGCTGAACAT GCTTCGTTCACAGTGACAGCACCAGAGGGAATTATCCAAGATACAAAGG TCCTTGGACTGGTCACCCAAGCTGGTGTTACAAAAGGTCAAACGATTAATATGATGAGGTTCAAAAATTTGATTGGGGGGGGTT AACGTTTGAGGGCGAAACTGTATACATGCCGGTACGCACATGGGACGCTA AAACTGGTAAAGTTGGTAAGTTGTGGGGCGAAATTAAATAA
[0315] SEP ID NO: 6 M23-LST (protein)
[0316] AATHEHS AQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISS GKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQIIIG WSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGY
[0317] SEP ID NO: 7 M23-LST (Nucleic)
[0318] GCTGCAACACATGAACATTCAGCACAATGGTTGAATAATTACAAAAAAG GATATGGTTACGGTCCTTATCCATTAGGTATAATGGCGGTATGCACTACG GAGTTGATTTTTTTGAATATTGGAACACAGTAAAAGCTATTTCAAGCG GAAAATAGTTGAAGCTGGAGAGAGGAGGAGGAGGATTGAGGATTAAAT GGTCTTATTGAAAATGATGGAGTGCATAGACAATGGTATATGCATCTAAGT AAATATAATGTTAAAGTAGGAGATTATGTCAAAGCTGGTCAAATAATCGGT TGGTCTGGAAGCACTGGTTATTCTACAGCACCACATTTCACTTCCAAAGA ATGGTTAATTCATTTTCAAATCCAACTCACTCCATTCATTCATTCATTCAG A GAGCGCAGGATAT
[0319] SEP ID NO: 8 Ami-2638 (protein)
[0320] NKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANR NEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEATLK VAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVTNKTGTTKGNI MKDYFIKRIKHYDG
[0321] SEP ID NO: 9 Ami-2638 (nucleic acid)
[0322] GGTAACAAGATTACAGCACCAAAACCTAGTATTCAAGGTGTGGTCATCCA CAATGATTATGGTAGTATGACACCTAGTCAATACTTACCATGGTTATATGC ACGTGAGAATAACGGTACACACGTTAACGGTTGGGCTAGTGTTTATGCAAA TAGAAACGAAGTCAGCTACCTACCTAGTTGATTGAGTTGAGGTCACGTAACGGTTGGGCTAGTGATTGCAAA TGGTAATCAATGGGCAAATGCTAACTTAATCGGATTTGAAGTGTGTGAGTC GTATCCTGGTAGAATCTCGGACAAATTATTCTTAGAAAATGAAGAAGCGAC ATTGAAAGTAGCTGCGGATGTGATGAAGTCCGTACGGATTACCAGTTAATCG CACACACTGTACGTCTGAAGTCGTATCGATTCCATTCGTTTC TCGTGGGACTTGCATGTTGGCAAAGGTGAGCCTTACAACTACTATATT AATAAAATGAAAGACTACTTCATCAAACGCATCAAAACATTATTATGACGGT
[0323] SEP ID NO: 10 M23-LST Ami2638 CBD2638 (protéique)
[0324] AATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVIGSNIGTPVFSFM GKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQIIG WSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGYGKAGGTVTPTPNT GELLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSN HIKGNKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVY ANRNEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEA TLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNI NKMKDYFIKRIKHYYDGGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDW KQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEV QKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK
[0325] SEOIDNO: 11 M23-LST Ami2638 CBD2638 (protéique)
[0326] MRGSHHHHHHGSAATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDF FMNIGTPVKAISSGKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVK VGDYVKAGQIIGWSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGYG KAGGTVTPTPNTGELLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKN GSVKELKHIYSNHIKGNKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENN GTHVNGWASVYANRNEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPG RISDKLFLENEEATLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDL HVGKGEPYTTTNINKMKDYFIKRIKHYYDGGKLEVSKAATIKQSDVKQEVKK QEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGV LQKGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDACTGKVGKLWG EIK
[0327] SEP ID NO: 12 M23-LST Ami2638 CBD2638 (nucleic acid)
[0328] GCTGCAACACATGAACATTCAGCACAATGGTTGAATAATTACAAAAAAG GATATGGTTACGGTCCTTATCCATTAGGTATAATGGCGGTATGCACTACG GAGTTGATTTTTTTGAATATTGGAACACAGTAAAAGCTATTTCAAGCG GAAAAATAGTTGAAGCTGGTTGGAGTAATTACGGAGGAGGTAATCAAATA GGTCTTATTGAAAATGATGGAGTGCATAGACAATGGTATATGCATCTAAGT AAATATAATGTTAAAGTAGGAGATTATGTCAAAGCTGGTCAAATAATCGGT TGGTCTGGAAGCACTGGTTATTCTACAGCACCACATTTACACTTCCAAAGA ATGGTTAATTCATTTTCAAATTCAACTGCCCAAGATCCAATGCCTTTCTTAA AGAGCGCAGGATATGGAAAAGCAGGTGGTACAGTAACTCCAACGCCGAAT ACAGGTGAGCCTCTTACGCCCTAAAGACGCAAAGAAAGATGAAAAATCACA AGTATGTAGTGGTTTGGCTATGGAAAAATATGACATTACAAATTTAAATGC TAAACAAGATAAATCAAAGAATGGGAGCGTGAAAGAGTTGAAACATATCT ATTCAAACCATATTAAAGGTAACAAGATTACAGCACCAAAACCTAGTATTC AAGGTGTGGTCATCCACAATGATTATGGTAGTATGACACCTAGTCAATACT TACCATGGTTATATGCACGTGAGAATAACGGTACACACGTTAACGGTTGGG CTAGTGTTTATGCAAATAGAAACGAAGTGCTTTGGTATCATCCGACAGACT ACGTAGAGTGGCATTGTGGTAATCAATGGGCAAATGCTAACTTAATCGGAT TTGAAGTGTGTGAGTCGTATCCTGGTAGAATCTCGGACAAATTATTCTTAG AAAATGAAGAAGCGACATTGAAAGTAGCTGCGGATGTGATGAAGTCGTAC GGATTACCAGTTAATCGCAACACTGTACGTCTGCATAACGAATTCTTCGGA ACTTCTTGTCCACATCGTTCGTGGGACTTGCATGTTGGCAAAGGTGAGCCTT ACACAACTACTAATATTAATAAAATGAAAGACTACTTCATCAAACGCATCAAACATTATTATGACGGTGGAAAGCTAGAAGTAAGCAAAGCAGCAACTATC AAACAATCTGACGTTAAGCAAGAAGTTAAAAAGCAAGAAGCAAAACAAAT TGTGAAAGCAACAGATTGGAAACAGAATAAAGATGGCATTTGGTATAAAG CTGAACATGCTTCGTTCAGTGACAGCACCAGAGGGAATTATCCAAGAT ACAAAGGTCCTTGGACTGGTCACCCAAGCTGGTGTTACAAAAAGGTC AAACGATTAAATATGATGGAAACAGAATTAGTTGTTGGAT CGTGGGAAACGTTTGAGGGCGAAACTGTATACATGCCGGTACGCACATGG GACGCTAAAACTGGTAAAGTTGGTAAGTTGTGGGGCGAAATTAAATAA.
[0329] SEP ID NO: 13 N-terminal 6xHis label
[0330] MRGSHHHHHHGS< / e> < / e> < / e> < / e> < / e> < / e>
Claims
Claims
1. Aqueous composition, in particular cosmetic, comprising, in a physiologically acceptable medium: (i) at least one endolysin; and (ii) trehalose.
2. The composition of claim 1, wherein the endolysin is an endolysin derived from a Staphylococcus aureus phage.
3. A composition according to claim 1 or 2, wherein the endolysin comprises a first protein sequence comprising a cell wall binding domain of species of the genus Staphylococcus.
4. A composition according to claim 3, wherein the first protein sequence is derived from bacteriophage endolysin <e>2638a of S. aureus.
5. A composition according to claim 3 or 4, wherein the first protein sequence comprises a protein sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference amino acid sequence SEQ ID NO:
1.
6. A composition according to any one of claims 1 to 4, wherein the endolysin comprises a protein sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the group consisting of the reference amino acid sequences SEQ ID NO: 3 and SEQ ID NO:
4.
7. A composition according to any one of claims 3 to 5, wherein said endolysin further comprises a heterologous protein sequence.
8. The composition of claim 7, wherein the heterologous protein sequence comprises a lytic domain, said lytic domain comprising a second and a third protein sequence, said second protein sequence comprising an M23 endopeptidase domain and said third protein sequence comprising an amidase domain.
9. A composition according to claim 8, wherein said second and third protein sequences are derived, independently of one another, from an enzyme selected from the group consisting of bacteriophage endolysin <e>2638a from S. aureus and lysostaphin from S. simulons, in particular one of the second and third protein sequences from the bacteriophage endolysin <e>2638a of S. aureus and the other sequence of the second and third protein sequences from lysostaphin of S. simulans
10. A composition according to claim 8 or 9, wherein said second protein sequence comprises at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with the reference amino acid sequence SEQ ID NO: 6 and said third protein sequence comprises at least 80%, in particular 90%, more particularly 95% sequence identity with the reference amino acid sequence SEQ ID NO:
8.
11. A composition according to any one of claims 1 to 4 and 6 to 9, wherein the endolysin comprises a protein sequence comprising at least 80%, in particular at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the group consisting of the reference amino acid sequences SEQ ID NO: 10, and SEQ ID NO: 11, in particular the endolysin comprises a protein sequence consisting of the reference amino acid sequence SEQ ID NO:
10.
12. Composition according to any one of claims 1 to 11, in which the endolysin is present in a content ranging from 0.0001% to 0.1% by weight relative to the total weight of the composition, in particular from 0.0005% to 0.01% by weight relative to the total weight of the composition, more particularly from 0.001% to 0.005% by weight relative to the total weight of the composition.
13. Composition according to any one of claims 1 to 12, in which the trehalose is present in a content ranging from 0.001% to 20% by weight relative to the total weight of the composition, in particular from 1% to 15% by weight relative to the total weight of the composition, more particularly from 5% to 10% by weight relative to the total weight of the composition.
14. A composition according to any one of claims 1 to 13, the composition being suitable for topical administration.
15. Composition according to any one of claims 1 to 14 for its use in the prevention and / or treatment of a skin disorder linked to colonization by Staphylococcus aureus in an individual in need thereof, in particular for preventing and / or treating acne and / or eczema in the individual.
16. A composition for use according to claim 15, wherein the composition is suitable for topical administration.
17. Non-therapeutic cosmetic process for the care of keratin materials, in particular the skin, comprising the topical application to these keratin materials of a composition according to any one of claims 1 to 14.< / e> < / e> < / e>