Gene editing of pcsk9 or angptl3 and compositions and methods of using same for treatment of disease

The hybrid guide gene editing system with modified nucleotides and LNPs addresses the challenges of specificity and efficacy in gene editing, effectively targeting ANGPTL3 and PCSK9 to treat atherosclerotic cardiovascular disease.

GB2700667APending Publication Date: 2026-02-25VERVE THERAPEUTICS INC
View PDF 4 Cites 0 Cited by

Patent Information

Application Number
GB2025009407
Authority / Receiving Office
GB · GB
Patent Type
Applications
Current Assignee / Owner
Priority Date
2022-07-15
Filing Date
2022-09-22
Publication Date
2026-02-25

Smart Images

  • Figure 00000000_0000_ABST
    Figure 00000000_0000_ABST
Patent Text Reader

Abstract

A chemically modified polynucleotide encoding a fusion protein, wherein the chemically modified polynucleotide comprises a sequence of SEQ ID NO: 701 is claimed wherein the fusion comprises a Cas9 ni
Need to check novelty before this filing date? Find Prior Art

Description

CROSS REFERENCE TO RELATED APPLICATIONS

[0001] This application claims benefit under 35 U.S.C. § 119 from Provisional Application Serial No. 63 / 247,236, filed September 22, 2021; Provisional Application Serial No. 63 / 255,333, filed October 13, 2021; and Provisional Application Serial No. 63 / 389,679, filed July 15, 2022, the disclosures of which are incorporated herein by reference in their entirety. SUMMARY OF THE INVENTION

[0002] Described herein is an in vivo hybrid guide gene editing system comprising: (a) a gene editor protein or a component thereof comprising a nucleic acid binding domain, or a nucleic acid encoding the gene editor protein or the component thereof; and (b) a hybrid guide nucleic acid comprising (i) a spacer sequence comprising a deoxyribonucleotide and a ribonucleotide comprising a ribose, wherein a 2’ hydroxyl group of the ribose is covalently linked to a methyl group (2’-OMe), and (ii) a binding scaffold for the gene editor protein or component thereof, wherein (a) and (b) are constituent components of a pharmaceutical composition that comprises a lipid nanoparticle (LNP) containing (a) or (b), wherein the LNP comprises an amino lipid, a phospholipid, a sterol and a PEG lipid. In some embodiments, the spacer sequence corresponds to a protospacer on a target gene, and wherein the target gene is ANGPTL3. In some embodiments, the gene editor protein or the component thereof comprises a deaminase.

[0003] Described herein is an in vivo hybrid guide gene editing system comprising: (a) a gene editor protein or a component thereof comprising a nucleic acid binding domain, or a nucleic acid encoding the gene editor protein or the component thereof; and (b) a hybrid guide nucleic acid comprising (i) a spacer sequence comprising a deoxyribonucleotide and a ribonucleotide, wherein the spacer sequence corresponds to a protospacer on an ANGPTL3 gene, and (ii) a binding scaffold for the gene editor protein or component thereof, wherein (a) and (b) are constituent components of a pharmaceutical composition that comprises a lipid nanoparticle (LNP) containing (a) or (b), wherein the LNP comprises an amino lipid, a phospholipid, a sterol and a PEG lipid. In some embodiments, the gene editor protein or the component thereof comprises a deaminase. In some embodiments, the ribonucleotide comprises a ribose, and wherein the ribose comprises a 2’ hydroxyl group covalently linked to a methyl group (2’-0Me).

[0004] Described herein is an in vivo hybrid guide gene editing system comprising: (a) a gene editor protein or a component thereof comprising a nucleic acid binding domain and a deaminase, or a nucleic acid encoding the gene editor protein or the component thereof; and (b) a hybrid guide nucleic acid comprising (i) a spacer sequence comprising a deoxyribonucleotide and a ribonucleotide, and (ii) a binding scaffold for the gene editor protein or component thereof, wherein (a) and (b) are constituent components of a pharmaceutical composition that comprises a lipid nanoparticle (LNP) containing (a) or (b), wherein the LNP comprises an amino lipid, a phospholipid, a sterol and a PEG lipid. In some embodiments, the spacer sequence corresponds to a protospacer on a target gene, and wherein the target gene is ANGPTL3. In some embodiments, the ribonucleotide comprises a ribose, and wherein the ribose comprises a 2’ hydroxyl group covalently linked to a methyl group (2’-0Me).

[0005] In some embodiments, the spacer sequence comprises an unmodified ribonucleotide. In some embodiments, wherein the nucleic acid encoding the gene editor protein or the component thereof is an mRNA. In some embodiments, the gene editor protein or the component thereof comprises a single fusion protein or two or more proteins. In some embodiments, the spacer sequence comprises a phosphorothioate backbone modification (PS). In some embodiments, the spacer sequence comprises a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA)(DNA) motif. In some embodiments, the (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA)(DNA) motif is located at the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of SEQ ID NO: 30 or 31. In some embodiments, the spacer sequence comprises a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA) motif. In some embodiments, the (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA) motif is located at the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of SEQ ID NO: 28 or 29. In some embodiments, the spacer sequence comprises a (2’-OMe)PS(2’- OMe)PS(DNA)PS(DNA)(DNA)(DNA)(DNA) motif. In some embodiments, the (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(DNA)(DNA)(DNA) motif is located at the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of SEQ ID NO: 5, 11 or 12. In some embodiments, the hybrid guide nucleic acid comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of a sequence selected from the group consisting of SEQ ID Nos: 110-113. In some embodiments, the hybrid guide nucleic acid comprises a sequence with at least about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of a sequence selected from the group consisting of SEQ ID Nos: 106-109. In some embodiments, the guide nucleic acid comprises a sequence with at least about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of a sequence selected from the group consisting of SEQ ID Nos: 79-82.

[0006] In some embodiments, the nucleic acid binding domain is capable of binding to DNA. In some embodiments, the nucleic acid binding domain is capable of binding to RNA. In some embodiments, the deoxyribonucl eotide is located on position 3, 4, 6, 7 or 8 from the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises deoxyribonucleotides on positions 3, 4, 6 and 7 from the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises deoxyribonucleotides on positions 3 and 4 from the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises deoxyribonucleotides on positions 6 and 7 from the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises deoxyribonucleotides on positions 3, 4, 6, 7 and 8 from the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises one to ten deoxyribonucleotides. In some embodiments, the spacer sequence comprises one to five deoxyribonucleotides. In some embodiments, the DNA binding domain comprises a CRISPR protein or a fragment thereof. In some embodiments, the DNA binding domain comprises a catalytically impaired nuclease. In some embodiments, the DNA binding domain comprises a prime editing protein or a fragment thereof.

[0007] In some embodiments, the gene editor protein or the component thereof affects less than about 10%, about 9%, about 8%, about 7%, about 6%, about 5%, about 4%, about 3%, about 2%, or about 1% editing on all off-target sites as compared to a gene editing system comprising a corresponding gRNA without the deoxyribonucleotide. In some embodiments, the gene editor protein or the component thereof affects over about 50%, about 60%, about 70%, about 80%, about 90%, or about 95% editing on the target gene as compared to a gene editing system comprising a corresponding gRNA without the deoxyribonucleotide. In some embodiments, the gene editor protein or the component thereof affects over about 95%, about 96%, about 97%, about 98%, or about 99% editing on the target gene as compared to a gene editing system comprising a corresponding gRNA without the deoxyribonucleotide. In some embodiments, the gene editor protein or the component thereof affects from about 95% to about 99% editing on the target gene as compared to a gene editing system comprising a corresponding gRNA without the deoxyribonucleotide. In some embodiments, the LNP comprises a N-acetylgalactosamine (GalNAc) lipid receptor targeting conjugate. In some embodiments, the target gene is expressed in liver, or cells or tissues of liver origin. In some embodiments, the target gene is expressed in a non-liver organ or cells or tissues of non-liver origin.

[0008] Described herein is a method for treating or preventing an atherosclerotic cardiovascular disease in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the in vivo hybrid guide gene editing system described herein. In some embodiments, the subject is a primate. In some embodiments, the primate is human.

[0009] Described herein is a gene editing system comprising: (a) a gene editor protein or a component thereof comprising a nucleic acid binding domain, or a nucleic acid encoding the gene editor protein or the component thereof; and (b) a hybrid guide nucleic acid comprising a spacer sequence, wherein the spacer sequence comprises a deoxyribonucleotide and a ribonucleotide comprising a ribose, and wherein a 2’ hydroxyl group of the ribose is covalently linked to a methyl group (2’-0Me).

[0010] Described herein is a gene editing system comprising: (a) a gene editor protein or a component thereof comprising a nucleic acid binding domain, or a nucleic acid encoding the gene editor protein or the component thereof; and (b) a hybrid guide nucleic acid comprising a spacer sequence, wherein the spacer sequence comprises a deoxyribonucleotide and a ribonucleotide, and wherein the spacer sequence corresponds to a protospacer on an ANGPTL3 gene.

[0011] Described herein is a gene editing system comprising: (a) a gene editor protein or a component thereof comprising a nucleic acid binding domain and a deaminase, or a nucleic acid encoding the gene editor protein or the component thereof, and (b) a hybrid guide nucleic acid comprising a spacer sequence, wherein the spacer sequence comprises a deoxyribonucleotide and a ribonucleotide.

[0012] Described herein is a hybrid guide nucleic acid for a gene editing system, wherein the hybrid guide comprises (i) a spacer sequence comprising a deoxyribonucleotide and a ribonucleotide comprising a ribose, wherein a 2’ hydroxyl group of the ribose is covalently linked to a methyl group (2’-0Me), and (ii) a binding scaffold. In some embodiments, the spacer sequence comprises a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA)(DNA) motif. In some embodiments, the (2’-OMe)PS(2’- OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA)(DNA) motif is located at the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of SEQ ID NO: 30 or 31. In some embodiments, the spacer sequence comprises a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA) motif. In some embodiments, the (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA) motif is located at the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of SEQ ID NO: 28 or 29. In some embodiments, the spacer sequence comprises a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(DNA)(DNA)(DNA) motif. In some embodiments, the (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(DNA)(DNA)(DNA) motif is located at the 5’ end of the spacer sequence. In some embodiments, the spacer sequence comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of SEQ ID NO: 5, 11 or 12. In some embodiments, the hybrid guide nucleic acid comprises a sequence with at least about 80%, about 90%, about 95%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of a sequence selected from the group consisting of SEQ ID Nos: 110-113. In some embodiments, the hybrid guide nucleic acid comprises a sequence with at least about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of a sequence selected from the group consisting of SEQ ID Nos: 106-109. In some embodiments, the guide nucleic acid comprises a sequence with at least about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, or about 100% sequence identity or sequence similarity of a sequence selected from the group consisting of SEQ ID Nos: 79-82.

[0013] Described herein is a composition comprising a Cas9 nickase, wherein the Cas9 nickase comprises a mutation, and wherein the mutation is selected from the group consisting of: N692A, M694A, Q695A, H698A, K810A, K855A, K848A, K1003A, R1060A as compared to a Cas9 nickase of SEQ ID NO: 695 In some embodiments, the Cas9 nickase comprises a sequence with at least 90% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 95% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 98% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 99% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 99.5% identity to SEQ ID NO: 695. In some embodiments, the mutation comprises N692A, M694A, Q695A and H698A as compared to the Cas9 nickase of SEQ ID NO: 695. In some embodiments, the mutation comprises K855A as compared to the Cas9 nickase of SEQ ID NO: 695. In some embodiments, the mutation comprises K848A, K1003A and R1060A as compared to the Cas9 nickase of SEQ ID NO: 695. In some embodiments, the mutation comprises K810A, K1003A, R1060A as compared to the Cas9 nickase of SEQ ID NO: 695.

[0014] Described herein is a composition comprising a nucleic acid encoding a Cas9 nickase, wherein the nucleic acid encoding the Cas9 nickase comprises a mutation, and wherein the mutation is selected from the group consisting of: AAC at codon 692 is mutated to GCC, AUG at codon 694 is mutated to GCC, CAG at codon 695 is mutated to GCC, CAC at codon 698 is mutated to GCC, AAG at codon 855 is mutated to GCC, AAG at codon 810 is mutated to GCC, AAG at codon 848 is mutated to GCC, AAG at codon 1003 is mutated to GCC, and CGG at codon 1060 is mutated to GCC as compared to a nucleic acid of SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 90% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 95% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 98% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 99% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 99.5% identity to SEQ ID NO: 694. In some embodiments, the mutation comprises AAC at codon 692 is mutated to GCC, AUG at codon 694 is mutated to GCC, CAG at codon 695 is mutated to GCC and CAC at codon 698 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694. In some embodiments, the mutation comprises AAG at codon 855 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694. In some embodiments, the mutation comprises AAG at codon 878 is mutated to GCC, AAG at codon 1003 is mutated to GCC, and CGG at codon 1060 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694. In some embodiments, the mutation comprises AAG at codon 810 is mutated to GCC, AAG at codon 1003 is mutated to GCC, and CGG at codon 1060 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694.

[0015] Described herein is a gene editing system comprising: (a) a Cas9 nickase, and (b) a guide RNA comprising a spacer corresponding to protospacer sequence on a target gene and a binding scaffold for the Cas9 nickase, wherein the Cas9 nickase comprises a mutation, wherein the mutation is selected from the group consisting of: N692A, M694A, Q695A, H698A, K810A, K855A, K848A, K1003A, R1060A as compared to a Cas9 nickase of SEQ ID NO: 695. In some embodiments, the gene editing system comprises a deaminase. In some embodiments, the gene editing system comprises a polymerase. In some embodiments, the polymerase is a reverse transcriptase. In some embodiments, the target gene is PCSK9. In some embodiments, the target gene is ANGPTL3. In some embodiments, the Cas9 nickase comprises a sequence with at least 90% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 95% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 98% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 99% identity to SEQ ID NO: 695. In some embodiments, the Cas9 nickase comprises a sequence with at least 99.5% identity to SEQ ID NO: 695. In some embodiments, the mutation comprises N692A, M694A, Q695A and H698A as compared to the Cas9 nickase of SEQ ID NO: 695. In some embodiments, the mutation comprises K855A as compared to the Cas9 nickase of SEQ ID NO: 695. In some embodiments, the mutation comprises K848A, K1003A and R1060A as compared to the Cas9 nickase of SEQ ID NO: 695. In some embodiments, the mutation comprises K810A, K1003A, R1060A as compared to the Cas9 nickase of SEQ ID NO: 695.

[0016] Described herein is a gene editing system comprising: (a) a nucleic acid encoding a Cas9 nickase, and (b) a guide RNA comprising a spacer corresponding to protospacer sequence on a target gene and a binding scaffold for the Cas9 nickase, wherein the nucleic acid encoding the Cas9 nickase comprises a mutation, wherein the mutation is selected from the group consisting of: AAC at codon 692 is mutated to GCC, AUG at codon 694 is mutated to GCC, CAG at codon 695 is mutated to GCC, CAC at codon 698 is mutated to GCC, AAG at codon 855 is mutated to GCC, AAG at codon 810 is mutated to GCC, AAG at codon 848 is mutated to GCC, AAG at codon 1003 is mutated to GCC, and CGG at codon 1060 is mutated to GCC as compared to a nucleic acid of SEQ ID NO: 694. In some embodiments, the gene editing system comprises a nucleic acid encoding a deaminase. In some embodiments, the gene editing system comprises a nucleic acid encoding a polymerase. In some embodiments, the polymerase is a reverse transcriptase. In some embodiments, the target gene is PCSK9. In some embodiments, the target gene is ANGPTL3. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 90% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 95% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 98% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 99% identity to SEQ ID NO: 694. In some embodiments, the nucleic acid encoding the Cas9 nickase comprises a sequence with at least 99.5% identity to SEQ ID NO: 694. In some embodiments, the mutation comprises AAC at codon 692 is mutated to GCC, AUG at codon 694 is mutated to GCC, CAG at codon 695 is mutated to GCC and CAC at codon 698 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694. In some embodiments, the mutation comprises AAG at codon 855 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694. In some embodiments, the mutation comprises AAG at codon 878 is mutated to GCC, AAG at codon 1003 is mutated to GCC, and CGG at codon 1060 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694. In some embodiments, the mutation comprises AAG at codon 810 is mutated to GCC, AAG at codon 1003 is mutated to GCC, and CGG at codon 1060 is mutated to GCC as compared to the nucleic acid SEQ ID NO: 694.

[0017] Described herein is a nucleic acid comprises a sequence selected from the group consisting of SEQ ID NOs: 723, 725, 727 and 729.

[0018] Described herein is a base editor protein, wherein the base editor protein comprises a sequence selected from the group consisting of SEQ ID NOs: 724, 726, 728, and 730.

[0019] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (c) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein a total amount of the guide RNA and the mRNA is about 0.01 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.1 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.01 mg / kg to about 2 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.1 mg / kg to about 2 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.01 mg / kg to about 1.5 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.1 mg / kg to about 1.5 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.01 mg / kg to about 1.25 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.1 mg / kg to about 1.25 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.01 mg / kg to about 1 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.1 mg / kg to about 1 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.1 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.2 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.4 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.5 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.6 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.7 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.8 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 0.9 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.1 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.2 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.3 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.4 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.5 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.6 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.7 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.8 mg / kg to about 3 mg / kg. In some embodiments, the total amount of the guide RNA and the mRNA is about 1.9 mg / kg to about 3 mg / kg.

[0020] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (b) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein administration of the gene editing system results in a plasma Cmax of the mRNA in the human subject to be about 0.05 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 0.1 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 0.2 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 0.5 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 1 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 2 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 3 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the mRNA in the human subject is about 4 pg / mL to about 5 pg / mL.

[0021] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (c) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein administration of the gene editing system results in an AUC of the mRNA in the human subject to be about 1 pg*h / mL to about 100 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 1 pgxh / mL to about 50 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 1 pgxh / mL to about 20 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 1 pgxh / mL to about 10 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 10 pgxh / mL to about 100 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 10 pgxh / mL to about 50 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 10 pgxh / mL to about 20 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 20 pgxh / mL to about 100 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 20 pgxh / mL to about 50 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 20 pgxh / mL to about 30 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 30 pgxh / mL to about 100 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 30 pgxh / mL to about 50 pgxh / mL. In some embodiments, the AUC of the mRNA in the human subject is about 50 pgxh / mL to about 100 pgxh / mL.

[0022] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (c) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein administration of the gene editing system results in a plasma Cmax of the amino lipid in the human subject to be about 1 pg / mL to about 100 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 1 pg / mL to about 50 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 1 pg / mL to about 30 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 1 pg / mL to about 20 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 1 pg / mL to about 10 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 10 pg / mL to about 100 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 10 pg / mL to about 50 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 10 pg / mL to about 30 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 20 pg / mL to about 100 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 20 pg / mL to about 50 pg / mL. In some embodiments, the plasma Cmax of the amino lipid in the human subject is about 50 pg / mL to about 100 pg / mL.

[0023] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (c) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein administration of the gene editing system results in an AUC of the amino lipid in the human subject to be about 100 pgxh / mL to about 10000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 100 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 100 pgxh / mL to about 2000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 100 pgxh / mL to about 1000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 100 pgxh / mL to about 500 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 500 pgxh / mL to about 10000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 500 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 500 pgxh / mL to about 2000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 500 pgxh / mL to about 1000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 1000 pgxh / mL to about 10000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 1000 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the amino lipid in the human subject is about 5000 pgxh / mL to about 10000 pgxh / mL.

[0024] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (c) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein administration of the gene editing system results in a plasma Cmax of the PEG lipid in the human subject to be about 0.1 pg / mL to about 50 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 0.1 pg / mL to about 25 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 0.1 pg / mL to about 10 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 0.1 pg / mL to about 5 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 0.1 pg / mL to about 1 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 1 pg / mL to about 50 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 1 pg / mL to about 25 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 1 pg / mL to about 10 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 10 pg / mL to about 50 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 10 pg / mL to about 25 pg / mL. In some embodiments, the plasma Cmax of the PEG lipid in the human subject is about 25 pg / mL to about 50 pg / mL.

[0025] Described herein is a pharmaceutical composition for a human subject comprising: (a) a mRNA encoding a base editor protein, wherein the base editor protein comprises a nucleic acid binding domain, (b) a guide RNA that serves to guide the nucleic acid binding domain to a protospacer sequence on a target gene, and (c) a LNP comprising an amino lipid, a PEG lipid, a phospholipid and a sterol, wherein administration of the gene editing system results in an AUC of the PEG lipid in the human subject to be about 10 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 10 pgxh / mL to about 2000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 10 pgxh / mL to about 1000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 10 pgxh / mL to about 500 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 10 pgxh / mL to about 100 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 100 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 100 pgxh / mL to about 2000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 100 pgxh / mL to about 1000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 100 pgxh / mL to about 500 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 500 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 500 pgxh / mL to about 2000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 500 pgxh / mL to about 1000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 1000 pgxh / mL to about 5000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 1000 pgxh / mL to about 2000 pgxh / mL. In some embodiments, the AUC of the PEG lipid in the human subject is about 2000 pgxh / mL to about 5000 pgxh / mL.

[0026] In some embodiments, the phospholipid is di stearoylphosphatidylcholine (DSPC). In some embodiments, the sterol is cholesterol. In some embodiments, the LNP comprises a N-acetylgalactosamine (GalNAc) lipid receptor targeting conjugate.

[0027] Described herein is a method for treating or preventing an atherosclerotic cardiovascular disease in a human subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of pharmaceutical composition of any one of claims 116-219. INCORPORATION BY REFERENCE

[0028] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference in their entireties to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. BRIEF DESCRIPTION OF THE DRAWINGS

[0029] Novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:

[0030] FIG. 1 presents data from an in vitro potency study illustrating the percent editing of PCSK9 gene in primary human hepatocytes (PHH) as comparted to primary non-human primate hepatocytes (e.g., primary cyno hepatocytes (PCH)) using an LNP PCSK9 base editor formulation comprising a payload of mRNA MA004 and guide RNA GA346 at 1:1 mRNA:gRNA weight ratio and titrated at different concentrations against multiple lots of PHH and PCH cells. As illustrated in FIG. 1, the administered PCSK9 base editor formulation appears more potent in human than non-human primate hepatocytes.

[0031] FIG. 2 illustrates a study protocol using LNP PCSK9 base editor formulation comprising a payload of mRNA MA004 and guide RNA GA346 at 1:1 mRNA:gRNA weight ratio involving a first group of 4 NHPs intravenously infused with a single dose of 0.75 mg / kg, a second group of 22 NHPs intravenously infused with a single dose of 1.5 mg / kg, and third group (“vehicle control”) of 10 NHPs intravenously infused with a single dose of the same LNP delivery vehicle without the gRNA and mRNA drug substance payload. The dose is measured by the total weight of mRNA and gRNA over the weight of the subject.

[0032] FIGs. 3-7 is data obtained from the study described in FIG. 2 setting forth PCSK9 editing percent change from baseline through liver biopsy assessing whole liver DNA editing at day 15 post infusion and PCSK9 protein reduction at day 14 post infusion (FIG. 3), PCSK9 protein reduction over an extended period of time post infusion (FIG. 4), LDL-C reduction over an extended period of time post infusion (FIG. 5), ALT enzyme levels over an extended period of time post infusion (FIG. 6), and fasting glucose levels over an extended time period post infusion (FIG. 7).

[0033] FIGs. 8-10 illustrate a mouse study protocol (FIG. 8) and data generated from the study supporting the durability of liver editing using the PCSK9 base editor LNP formulations described herein in regenerated PCSK9 edited liver cells post intravenous infusion (FIGs. 9-10). Each dot in the graphs depicted in FIGs. 8-9 represents a mouse.

[0034] FIG. 11 illustrates data from an NHP study that shows no evidence of editing in sperm from sexually mature male NHPs post intravenous infusion of PCSK9 base editor LNP formulation described herein.

[0035] FIGs. 12-15 is a study protocol and data generated therefrom assessing potential off-target candidate sites of PCSK9 base editor formulations described herein. FIG. 12 is a schematic illustrating the experimental methods used for evaluating the presence of actual off-target editing by the PCSK9 base editor formulations described herein. FIG. 13 illustrates the high sensitivity of the validation assay employed. FIGs. 14-15 are jitter plots generated from the off-target protocol and the validation assay employed showing that there is no detectable off target editing in primary human liver and spleen cells among the top 244 off target candidate sites identified.

[0036] FIG. 16 illustrates data from a bio-distribution study of NHPs intravenously dosed with single 1 mg / kg LNP constituted with an ABE mRNA MA004 and guide RNA GA346. The NHPs were sacrificed on day 15 post infusion and tissue samples taken and analyzed for adenine editing of the PCSK9 gene. PCSK9 editing was observed to be predominately distributed to the liver.

[0037] FIG. 17 illustrates the potency of disclosed gRNA variants directed to ANGPTL3 and their on-target editing percentage of ANGPTL3 at position 6 in human primary hepatocytes. It should be understood that the “position 6,” as used in the data referencing position 6, refers to the 6th position counting from the 5’ end of the protospacer sequence (i.e., the opposite end from the PAM). The gRNA variants were transfected into human primary hepatocyte cells together with ABE mRNA MA004 at the concentrations noted therein in a manner described herein.

[0038] FIG. 18 illustrates the potency truncated guide RNA GA441 (n-1: GA475, n-2: GA576, n-3: GA477) and their on-target editing percentage of ANGPTL3 at the desired editing position in Human primary hepatocytes combined with the observed corresponding reduction of potential off-target editing at selected off-target candidate sites (OT #1, OT #2, OT #3, OT #4). The gRNA truncated variants were transfected into human primary hepatocyte cells together with mRNA MA004 in a manner described herein and illustrate how such truncated variants of gRNA GA441 impact potential off-target sites more than on-target editing.

[0039] FIG. 19 shows exemplary modified ABE variants transfected with gRNA GA441 and their on-target editing percentage of ANGPTL3 at position 6 in primary human hepatocytes (PHH) transfected with gRNA GA441 together with the identified ABE variant at the noted concentrations in a manner described herein. Each sample was normalized to the respective MA004 ABE mRNA sample per concentration. Each set of columns in the illustrated graph correspond to MA004, MA040, MA041, MA045, MA064, MA065, MA066, and MA067, in order, as read from left to right as further represented by the hash marks in the legend.

[0040] FIGs. 20A-20E show data generated using various ANGPTL3 gRNAs and ABE mRNAs mRNA MA004 and variants thereof MA040, MA041 and MA045 to illustrate the relative potency of each combination of gRNA and mRNA vis-a-vis on-target editing of ANGPTL3 in human primary hepatocytes transfected at the noted concentrations. FIG. 20A, FIG. 20B, and FIG. 20C are results from experiment 1 using MA004 encoding ABE8.8, MA040 encoding ABE8.8 DI 135E, and MA041 encoding ABE8.8 R691A / D1135E, respectively, with ANGPTL3 targeted gRNA GA441, GA442, GA472, GA473, GA474, GA475, GA476 and GA477 as specified in the gRNA legend and illustrated in the graphs in order from left to right. FIG. 20D and FIG. 20E are results from experiment 2 using MA004 encoding ABE8.8, and MA045 encoding ABE8.8 R691A, respectively.

[0041] FIG. 21 is a comparative graph illustrating the percent on target editing of PCSK9 of human primary hepatocytes transfected with the referenced gRNA variants and ABE mRNA MA004 at the noted 4 concentrations. The graph illustrates the relative potency between different gRNAs in human primary hepatocytes. From left to right of the graph, the gRNA variants in the 4 concentrations are GA346, GA376, GA377, GA380, GA381, GA382, GA383, GA384, GA385, GA386, GA387, GA388, GA389, and GA391 respectively.

[0042] FIG. 22 is a comparative graph illustrating the percent on target editing of PCSK9 of cyno primary hepatocytes transfected with the referenced gRNA variants and ABE mRNA MA004 at the noted 4 concentrations. The graph illustrates the relative potency in primary hepatocytes between spacer and tracr chemistries variants of gRNA GA346 embodied in the referenced gRNA variants. From left to right of the graph, the gRNA variants in the 4 concentrations are GA346, GA376, GA377, GA380, GA381, GA382, GA383, GA384, GA385, GA386, GA387, GA388, GA389, and GA391 respectively.

[0043] FIG. 23 is a comparative graph illustrating the percent on-target editing of PCSK9 of primary hepatocyte transfected with ABE mRNA M004 in combination with gRNAs GA376, GA377, GA380-GA389, GA391 and GA066 (from left to right) between guide concentration of 312.5 ng / TA / mL to 2500 ng / TA / mL. Four different lots of GA066 were used in this study. GA376, GA377, GA380, GA383, GA385 and GA386 showed comparable dose response to GA066. The graph illustrates the relative potency between the gRNAs in human primary hepatocytes.

[0044] FIG. 24 is a table illustrating predicted exposures for LNP constituted with an ABE mRNA MA004 and guide RNA GA346 in Humans. Pharmacokinetic (“PK”) modeling using the NHP data disclosed herein was used to predict exposure correlations in human subjects and potential safety margin. Abbreviations: AUC = area under the plasma concentration-time curve; plasma Cmax = plasma maximal concentration; NHP= non-human primate. The modeling employed the following assumption: (a) A graded infusion: the first 15 minutes the infusion rate (in terms of volume) is 1 mL / min; for the remaining infusion duration, the infusion rate is 3 mL / min. (b) Predicted exposure for a 75 kg person. (c) For NHP, 2 mg / kg (single dosing plasma Cmax and AUCinf were the mean values.

[0045] FIG. 25 is a table showing the percent reduction in PCSK9 human subjects at different doses of an ABE mRNA MA004 and guide RNA 346 formulated in an LNP described herein based on predictive PK-PD modeling and broken out by human subject body weight and equivalent and 3-fold higher potency in humans than NHPs. PCSK9 % reduction = 100% -PCSK9 % remaining relative to baseline. This is just one method of predicting the human dosing and other factors might affect the particular mRNA used and the assay implemented.

[0046] FIG. 26 shows relative editing percentage of an off-target candidate site B2 in primary human hepatocytes transfected with the referenced ABE mRNA and the noted ANGPTL3 guide RNAs GA441, GA475 and GA476. The relative editing percentage of each sample was normalized to the GA441 / MA004 sample for site B2.

[0047] FIG. 27 shows relative editing percentage of an off-target candidate site B6 in primary human hepatocytes transfected with the referenced ABE mRNA and the noted ANGPTL3 guide RNAs GA441, GA475 and GA476. The relative editing percentage of each sample was normalized to the GA441 / MA004 sample for site B6.

[0048] FIG. 28A illustrates an exemplary scheme of the gene editing system comprising a guide nucleic acid. The guide nucleic acid comprises a spacer sequence with a first exemplary motif. gRNAs GA837, GA693 and GA749 disclosed herein are embodiments of this motif.

[0049] FIG. 28B illustrates another exemplary scheme of the gene editing system comprising a guide nucleic acid. The guide nucleic acid comprises a spacer sequence with a second exemplary motif. gRNAs GA745, GA692 and GA748 disclosed herein are embodiments of this motif.

[0050] FIG. 28C illustrates another exemplary scheme of the gene editing system comprising a guide nucleic acid. The guide nucleic acid comprises a spacer sequence with a third exemplary motif. gRNAs GA682, GA723 and GA746 disclosed herein are embodiments of this motif.

[0051] FIG. 28D illustrates another exemplary scheme of the gene editing system comprising a guide nucleic acid. The guide nucleic acid comprises a spacer sequence with a fourth exemplary motif. gRNAs GA691, GA724 and GA747 disclosed herein are embodiments of this motif.

[0052] FIG. 29 shows the percent on target editing of the target gene ANGPTL3 results from the initial on-target in vitro screening for the guide nucleic acids comprising the spacer sequences (guide nucleic acids GA675-GA684) under MessengerMax transfection conditions. GA441 was used as a control. Primary human hepatocyte (PHH) cells (lot STL) were used for this study. Each guide was screened at the following concentrations: 5,000 ng / mL, 2,500 ng / mL, 1,250 ng / mL, and 625 ng / mL, the results of which are represented by the columns in decreasing concentration order from left to right in the graph for each guide.

[0053] FIG. 30 shows the percent on target editing of the target gene ANGPTL3 results from the initial on-target screening for the guide nucleic acids comprising the spacer sequences (guide nucleic acids GA685-GA694) and control guide RNA GA441 under MessengerMax transfection conditions in PHH cells (lot STL). Each guide was screened at the following concentrations: 5,000 ng / mL, 2,500 ng / mL, 1,250 ng / mL, and 625 ng / mL, the results of which are represented by the columns in decreasing concentration order from left to right in the graph for each guide.

[0054] FIG. 31 shows the results of the in vitro off-target (OT1) editing based on ANGPTL3 guide nucleic acids comprising the spacer sequences of GA675-GA684 and control guide RNA GA441 under MesssengerMax transfection conditions in PHH cells (lot STL).

[0055] FIG. 32 shows the results of the in vitro off-target (OT1) editing based on ANGPTL3 guide nucleic acids comprising the spacer sequences of GA685-GA694 and control guide RNA GA441 under MesssengerMax transfection conditions in PHH cells (lot STL).

[0056] FIG. 33 shows the results from the initial in vitro on-target screening for ANGPTL3 guide nucleic acids comprising the additional spacer sequences of GA695-GA715 and control guide RNA GA441 by MessengerMax transfection conditions in PHH cells (lot STL).

[0057] FIG. 34 shows the in vitro on-target and select off-target (OT1 and OT3 sites) editing results from a follow-up experiment with guide nucleic acids (GA675, GA677, GA678, GA680, GA682, GA683, GA685-GA695) comprising selected spacer sequences and ANGPTL3 control guide RNA GA441 by MessengerMax transfection in PHH cells (lot IRZ).

[0058] FIG. 35A shows the results of a SureSelect in vitro study of target and off-target (OT1, OT2, OT3 and other OTs) editing, using 50 ng DNA input, of 16 ANGPTL3 guide nucleic acids comprising selected spacer sequences and ANGPTL3 control guide RNA GA441 under MessengerMax transfection conditions in PHH cells (lots IRZ).

[0059] FIG. 35B shows the results of a SureSelect in vitro study of on-target and off-target (OT1, OT2, OT3 and other OTs) editing, using 150 ng DNA input, of 10 ANGPTL3 guide nucleic acids comprising selected spacer sequences and ANGPTL3 control guide RNA GA441 under MessengerMax transfection conditions in PHH cells (lot IRZ).

[0060] FIGs. 36A-36B shows the results from LNP transfection experiments using various ANGPTL3 guides. FIG. 36A shows the on-target in vitro editing results from the use of LNPs for transfection in PHH cells (lot IRZ) at two different doses of LNP. FIG. 36B shows the off-targeting editing obtained from the same LNPs transfection experiment for only one dose, except for the control. The LNPs used in these studies are described in Table. 5.

[0061] FIG. 37 shows the results of a SureSelect in vitro study of ANGPTL3 on-target and off-target (OT1, OT2, OT3 and other OTs) editing resulting from the LNP transfection experiments in PHH cells (lot IRZ). The LNPs used in these studies are described in Table. 5.

[0062] FIG. 38A shows a subset of the SureSelect in vitro on-target and off-target (OT1, OT2, OT3 and other OTs) editing results of the LNP transfection experiments in PHH cells (lot IRZ). The LNPs used in these studies are described in Table. 5.

[0063] FIG. 38B shows the Targeted Amplicon in vitro on-target and OT1 editing result of the same subset data, of the LNP transfection experiments.

[0064] FIG. 39A shows a subset of the SureSelect in vitro on-target and off-target (OT1, OT2, OT3 and other OTs) editing results of the MessengarMax transfection experiments in PHH cells (lot IRZ).

[0065] FIG. 39B shows the Targeted Amplicon in vitro on-target and off-targets OT1 and OT3 editing result of the same subset data of the MessengarMax transfection experiments.

[0066] FIG. 40 shows the results of an in vitro on-target dose-response study of ANGPTL3 editing produced by different LNP formulations comprising spacer-modified ANGPTL3 guide nucleic acids in PHH cells (lot IRZ) assessed using Targeted Amplicon sequencing. Three digits after decimal point following formulation, gRNA and mRNA IDs indicate lot or batch number of the respective formulation, gRNA and mRNA. The LNPs used in these studies are described in Table 5

[0067] FIGs. 41A-41B is a comparative illustration of the off-target editing percentages data produced by different LNP formulations comprising ANGPTL3 guide nucleic acids with various modified-spacer sequences as specified and described herein. FIG. 41A shows the in vitro off-target editing results using OT1 primer. FIG. 41B shows the off-target editing results using OT3 primer. Three digits after decimal point following formulation, gRNA and mRNA IDs indicate lot or batch number of the respective formulation, gRNA and mRNA. The LNPs used in these studies are described in Table 5.

[0068] FIG. 42 shows the results of an in vitro on-target dose-response study of ANGPTL3 editing using an LNP containing GA837 and MA079 in PHH cells from four different donors (lots NFX, GN A, IRZ, and LFQ) assessed using Targeted Amplicon sequencing. The LNP (VF1542) is described in Table 5.

[0069] FIG. 43A shows results of an in vitro on-target ANGPTL3 editing results (as net editing of treated minus untreated samples) of LNP, containing GA837 and MA079, transfected at a single dose in PHH cells (lot IRZ) for two biological replicates. The average net editing % shown above each bar is derived from two technical replicates. The LNP (VF1542) is described in Table 5

[0070] FIG. 43B shows the OGM (optical genome mapping) analysis of genomic DNA from one replicate (Replicate 1) of the same subset of ANGPTL3 editing data of FIG. 43A. Circos plots show all SV (structural variations) categories (insertions, duplications, deletions, inversions, and translocations) for the individual Untreated Control (left) and ABE-treated (i.e., LNP (VF1542) -treated) (middle) samples. The Bionano Dual analysis pipeline was used to identify SVs unique to the treatment condition. As indicated by the clear ABE-Untreated Control Circos plot (right), notably no unique SVs were identified. The gRNA, mRNA and LNP formulations are the same as FIG. 43A

[0071] FIG. 44A shows the hepatic ANGPTL3 on-target editing by selected (cyno equivalent) spacer-modified guide nucleic acids GA347, GA663, GA666, GA668, GA665, GA720 comprising the same spacer sequences and mRNA MA004 in LNP treated NHPs. FIG. 44B shows the corresponding ANGPTL3 protein reduction 15 days after a single dose IV administration of the LNPs. The LNPs used in this study are described in Table 6.

[0072] FIG. 45 shows the in vitro on-target editing percentage by selected (cyno equivalent) spacer-modified guide nucleic acids GA347, GA663, GA666, GA668, GA665, GA720 in LNPs in PCH. Corresponding human gRNA IDs with equivalent spacer sequences are listed at the bottom. The LNPs used in this study are described in Table 6.

[0073] FIG. 46 shows hepatic ANGPTL3 on-target editing in NHP after IV infusion a single dose of LNP constituted with selected spacer-modified guide nucleic acids GA347, GA668, GA748 and GA749 comprising the same spacer sequences and mRNA MA079. The editing was assayed 15 days after injection to Cynomolgus monkeys, achieved >54% liver ANGPTL3 editing. The LNPs used in this study are described in Table 6.

[0074] FIG. 47 shows the spacer-modified guide nucleic acids comprising same spacer sequences achieved significant reduction in plasma ANGPTL3 protein 15 days post dosing in NHP. All spacer-modified guide nucleic acid produced >90% reduction in plasma ANGPTL3 protein at all dose level evaluated. The LNPs used in this study are described in Table 6. DETAILED DESCRIPTION

[0075] Certain specific details of this description are set forth in order to provide a more thorough understanding of various aspects and embodiments. However, one skilled in the art will understand that the present disclosure may be practiced without certain of the details herein disclosed. In other instances, well-known structures have not been shown or described in detail to avoid unnecessarily obscuring descriptions of the embodiments.

[0076] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods, and materials are described below. Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed disclosure. It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method or composition of the present disclosure, and vice versa. Furthermore, compositions of the present disclosure can be used to achieve methods of the present disclosure. Definitions

[0077] To facilitate an understanding of the present disclosure, a number of terms and phrases are defined below.

[0078] As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise.

[0079] It should also be noted that the term “or” is generally employed in its sense including “and / or” unless the content clearly dictates otherwise. The terms “and / or” and “any combination thereof’ and their grammatical equivalents as used herein, can be used interchangeably. These terms can convey that any combination is specifically contemplated. Solely for illustrative purposes, the following phrases “A, B, and / or C” or “A, B, C, or any combination thereof’ can mean “A individually; B individually; C individually; A and B; B and C; A and C; and A, B, and C ” The term “or” can be used conjunctively or disjunctively, unless the context specifically refers to a disjunctive use.

[0080] The term “about” or “approximately” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, ie., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.

[0081] As used in this specification and claim(s), the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.

[0082] As used herein, “some embodiments,” “an embodiment,” “one embodiment,” “embodiments” or “other embodiments” means that a particular feature, structure, or characteristic described in connection with the embodiments is included in at least some embodiments, but not necessarily all embodiments, of the present disclosures.

[0083] The term “nucleic acid” as used herein refers to a polymer containing at least two nucleotides (i.e., deoxyribonucleotides or ribonucleotides) in either single- or double-stranded form and includes DNA and RNA, hybrids of DNA and RNA, and combinations thereof. The term “nucleic acid” as used herein also refers to a polymer containing at least two chemically modified nucleotides (i.e., deoxyribonucleotides or ribonucleotides) in either single- or doublestranded form and includes DNA and RNA, hybrids of DNA and RNA, and combinations thereof.

[0084] The term “nucleotide” refers to a molecule that contains a sugar deoxyribose (DNA) or ribose (RNA), a base, and a phosphate group. Nucleotides are linked together through the phosphate groups. “Bases” include purines and pyrimidines, which further include natural compounds adenine, thymine, guanine, cytosine, uracil, inosine, and natural analogs, and synthetic derivatives of purines and pyrimidines, which include, but are not limited to, modifications which place new reactive groups such as, but not limited to, amines, alcohols, thiols, carboxylates, and alkylhalides.

[0085] A nucleic acid includes any oligonucleotide or polynucleotide, with fragments containing up to 60 nucleotides generally termed oligonucleotides, and longer fragments termed polynucleotides. A deoxyribo-oligonucleotide consists of a 5-carbon sugar called deoxyribose joined covalently to phosphate at the 5' and 3' carbons of this sugar to form an alternating, unbranched polymer. A ribooligonucleotide consists of a similar repeating structure where the 5-carbon sugar is ribose. Accordingly, the terms “polynucleotide” and “oligonucleotide” can refer to a polymer or oligomer of nucleotide or nucleoside monomers consisting of naturally-occurring bases, sugars and inter-sugar (backbone) linkages. Additionally, nucleic acids include nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, nonstandard, and / or non-naturally occurring, and which have similar binding properties as the reference nucleic acid. The nucleic acid may be modified at the base moiety (e.g., at one or more atoms that typically are available to form a hydrogen bond with a complementary nucleotide and / or at one or more atoms that are not typically capable of forming a hydrogen bond with a complementary nucleotide), sugar moiety, or phosphate backbone. Backbone modifications can include, but are not limited to, a phosphorothioate, a phosphorodithioate, a phosphoroselenoate, a phosphorodiselenoate, a phosphoroanilothioate, a phosphoraniladate, a phosphoramidate, and a phosphorodiamidate linkage. A phosphorothioate linkage substitutes a sulfur atom for a non-bridging oxygen in the phosphate backbone and delays nuclease degradation of oligonucleotides. A phosphorodiamidate linkage (N3’—>P5’) allows preventing nuclease recognition and degradation. Backbone modifications can also include having peptide bonds instead of phosphorous in the backbone structure (e.g., N-(2-aminoethyl)-glycine units linked by peptide bonds in a peptide nucleic acid), or linking groups including carbamate, amides, and linear and cyclic hydrocarbon groups. Oligonucleotides with modified backbones are reviewed in Micklefield, Backbone modification of nucleic acids: synthesis, structure and therapeutic applications, Curr. Med. Chern., 8 (10): 1157-79, 2001 and Lyer et al., Modified oligonucleotides-synthesis, properties and applications, Curr. Opin. Mol. Ther., 1 (3): 344-358, 1999.

[0086] Nucleic acid molecules described herein may contain a sugar moiety that comprises ribose or deoxyribose, as present in naturally occurring nucleotides, or a modified sugar moiety or sugar analog. The examples of modified sugar moi eties include, but are not limited to, 2’-O-methyl, 2’-O-methoxyethyl, 2’-O-aminoethyl, 2’-Flouro, N3’^P5’ phosphoramidate, 2’dimethylaminooxy ethoxy, 2’ 2'dimethylaminoethoxy ethoxy, 2'-guanidinidium, 2'-O-guanidinium ethyl, carbamate modified sugars, and bicyclic modified sugars. 2’-O-methyl or 2’-O-methoxyethyl modifications promote the A-form or RNA-like conformation in oligonucleotides, increase binding affinity to RNA, and have enhanced nuclease resistance. Modified sugar moi eties can also include having an extra bridge bond (e.g., a methylene bridge joining the 2’-0 and 4’-C atoms of the ribose in a locked nucleic acid) or sugar analog such as a morpholine ring (e.g., as in a phosphorodiamidate morpholino). Examples of such analogs and / or modified residues include, but are not limited to diaminopurine, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5’-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6- isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, 5-methyl-2-thiouracil, 3-(3-amino- 3-N-2-carboxypropyl) uracil, (acp3)w, 2,6-diaminopurine, methyl phosphonates, chiral-methyl phosphonates, 2'-O-methyl ribonucleotides, peptide-nucleic acids (PNAs), and the like. In some cases, nucleotides may include modifications in their phosphate moieties, including modifications to a triphosphate moiety. Non-limiting examples of such modifications include phosphate chains of greater length (e.g., a phosphate chain having, 4, 5, 6, 7, 8, 9, 10 or more phosphate moieties) and modifications with thiol moieties (e.g., alpha thiotriphosphate and beta-thiotriphosphates). Such modified or substituted oligonucleotides are often preferred over native forms because of properties such as, for example, enhanced cellular uptake, reduced immunogenicity, and increased stability in the presence of nucleases. Thus, the terms “polynucleotide” and “oligonucleotide” can also include polymers or oligomers comprising non-naturally occurring monomers, or portions thereof, which function similarly.

[0087] Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g, degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and / or deoxyinosine residues (Batzer et al., Nucleic Acid Res., 19:5081 (1991); Ohtsuka et al., J. Biol. Chern., 260:2605-2608 (1985); Rossolini et al., Mol. Cell. Probes, 8:91-98 (1994)).

[0088] The term “nucleoside” refers to a compound that consists of a base combined with deoxyribose or ribose. Nucleosides include but not limited to, ribonucleoside and deoxyribonucleoside. Nucleosides are phosphorylated to give nucleotides. Ribonucleosides include adenosine (A), guanosine (G), 5-methyluridine (m5U), uridine (U), and cytidine (C). Deoxyribonucleosides include deoxyadenosine (dA), deoxyguanosine (dG), deoxythymidine (dT), deoxyuridine (dU), deoxy cytidine (dC). The deoxyribose or ribose (i.e., sugar moi eties) can be modified. The examples of modified sugar moi eties include, but are not limited to, 2’-O-methyl, 2’-O-methoxyethyl, 2’-O-aminoethyl, 2’-Flouro, N3’^P5’ phosphoramidate, 2’dimethylaminooxy ethoxy, 2’ 2'dimethylaminoethoxy ethoxy, 2'-guanidinidium, 2'-O-guanidinium ethyl, carbamate modified sugars, and bicyclic modified sugars. 2’-O-methyl or 2’-O-methoxyethyl modifications promote the A-form or RNA-like conformation in oligonucleotides, increase binding affinity to RNA, and have enhanced nuclease resistance. Modified sugar moi eties can also include having an extra bridge bond (e.g., a methylene bridge joining the 2’-0 and 4’-C atoms of the ribose in a locked nucleic acid) or sugar analog such as a morpholine ring (e.g., as in a phosphorodiamidate morpholino). Examples of such analogs and / or modified residues include, but are not limited to diaminopurine, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5’-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6- isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, 5-methyl-2-thiouracil, 3-(3-amino- 3-N-2-carboxypropyl) uracil, (acp3)w, 2,6-diaminopurine, methyl phosphonates, chiral-methyl phosphonates, 2'-O-methyl ribonucleotides, peptide-nucleic acids (PNAs), and the like.

[0089] The term “deoxyribonucleotide” and “2’-deoxyribonucleotide” are used interchangeably and refer to both unmodified deoxyribonucleotide and chemically modified deoxyribonucleotide unless otherwise specified.

[0090] The term “motif,” as used herein, refers to a pattern or an arrangement of specific nucleotides, for example, a motif can refers to (i) one or more 2’-deoxyribonucleotides within a spacer, (ii) a combination of one or more 2’-deoxyribonucleotides and one or more ribonucleotides within the spacer, (iii) a combination of one or more 2’-deoxyribonucleotides, one or more ribonucleotides, and one or more 2’-0Me ribonucleotides within the spacer, wherein the 2’-0Me ribonucleotide can be at the 5’-end or at the 3’-end of a 2’-deoxyirbonucletide, (iv) a combination of one or more 2’-deoxyribonucleotides and one or more 2’-OMe ribonucleotides within the spacer, wherein the 2’-OMe ribonucleotide can be placed / located at the 5’-end or at the 3’-end of the 2’deoxynucleotides, or (v) any of the motifs disclosed earlier (i-iv) further comprising a phosphonothioate backbone.

[0091] The term “vector,” as used herein, refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. In some examples, a vector is an expression vector that is capable of directing the expression of nucleic acids to which they are operatively linked. The term “operably linked,” as used herein, means that the nucleotide sequence of interest is linked to regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence. The term “regulatory sequence,” as used herein, includes, but is not limited to promoters, enhancers and other expression control elements. Such regulatory sequences are well known in the art and are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Examples of expression vectors include, but are not limited to, plasmid vectors, viral vectors based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus, SV40, herpes simplex virus, human immunodeficiency virus, retrovirus (e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus) and other recombinant vectors.

[0092] The term “off-targeting,” “off-site targeting,” or “off-target effect” as used herein refers to when the spacer of the guide nucleic acid binds to a sequence of the genome other than the target sequence to which the spacer was specifically designed to bind. The resulting unintentional binding would lead to unintentional editing of genes other than the target gene.

[0093] As used herein, the terms “protein,” “polypeptide,” and “peptide” are used interchangeably and refer to a polymer of amino acid residues linked via peptide bonds and which may be composed of two or more polypeptide chains. The terms “polypeptide,” “protein,” and “peptide” refer to a polymer of at least two amino acid monomers joined together through amide bonds. An amino acid may be the L-optical isomer or the D-optical isomer. More specifically, the terms “polypeptide,” “protein,” and “peptide” refer to a molecule composed of two or more amino acids in a specific order; for example, the order as determined by the base sequence of nucleotides in the gene or RNA coding for the protein. Proteins are essential for the structure, function, and regulation of the body’s cells, tissues, and organs, and each protein has unique functions. Examples are hormones, enzymes, antibodies, and any fragments thereof. In some cases, a protein can be a portion of the protein, for example, a domain, a subdomain, or a motif of the protein. In some cases, a protein can be a variant (or mutation) of the protein, wherein one or more amino acid residues are inserted into, deleted from, and / or substituted into the naturally occurring (or at least a known) amino acid sequence of the protein. A protein or a variant thereof can be naturally occurring or recombinant. Methods for detection and / or measurement of polypeptides in biological material are well known in the art and include, but are not limited to, Western-blotting, flow cytometry, ELISAs, RIAs, and various proteomics techniques. An exemplary method to measure or detect a polypeptide is an immunoassay, such as an ELISA. This type of protein quantitation can be based on an antibody capable of capturing a specific antigen, and a second antibody capable of detecting the captured antigen. Exemplary assays for detection and / or measurement of polypeptides are described in Harlow, E. and Lane, D. Antibodies: A Laboratory Manual, (1988), Cold Spring Harbor Laboratory Press.

[0094] The term “sequence identity,” as used herein, refers to the amount of nucleotide or amino acid which match exactly between two different sequences. When comparing RNA and DNA sequences Uracil and Thymine bases are considered to be the same base. Gaps are not counted and the measurement is typically in relation to the shorter of the two sequences. For example, for nucleotide sequences: A: AAGGCTT B: AAGGC C: AAGGC AT Here identity (A,B)=100% (5 identical nucleotides / min(length(A),length(B))). Identity(B,C)=100%, but identity(A,C)=85% ((6 identical nucleotides / 7). So 100% identity does not mean two sequences are the same. For amino acid sequences: A: Ala Ala Gly Gly Gin His His B: Ala Ala Gly Gly Gin C: Ala Ala Gly Gly Gin Ala His Here identity (A,B)=100% (5 identical amino acids / min(length(A), length(B))). Identity (B,C)=100%, but identity(A,C)=85% ((6 identical amino acids / 7).

[0095] The term “sequence similarity,” as used herein, can be described as an optimal matching problem that finds the minimal number of edit operations (inserts, deletes, and substitutions) in order to transform the one sequence into an exact copy of the other sequence being aligned (edit distance). Using this, the percentage sequence similarity of the examples above are sim(A,B)=60%, sim(B,C)=60%, sim(A,C)=86% (semi-global, sim=l-(edit distance / unaligned length of the shorter sequence)).

[0096] A “subject” in need thereof, refers to an individual who has a disease, a symptom of the disease, or a predisposition toward the disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptom of the disease, or the predisposition toward the disease. In some embodiments, the subject has hypercholesterolemia. In some embodiments, the subject has atherosclerotic vascular disease. In some embodiments, the subject has hypertriglyceridemia. In some embodiments, the subject has diabetes. The term “subject” or “patient” encompasses mammals. Examples of mammals include, but are not limited to, any member of the mammalian class: humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like.

[0097] The term “condition,” as used herein, includes diseases, disorders, and susceptibilities. In some embodiments, the condition is an atherosclerotic vascular disease. In some embodiments, the condition is a hypertriglyceridemia. In some embodiments, the condition is a diabetes.

[0098] The term “atherosclerosis” or “atherosclerotic vascular disease,” as used herein, refers to a disease in which the inside of an artery narrows due to the buildup of plaque. In some instances, it may result in coronary artery disease, stroke, peripheral artery disease, or kidney problems.

[0099] The term “hypertriglyceridemia,” as used herein, refers to high (hyper-) blood levels (-emia) of triglycerides, the most abundant fatty molecule in most organisms. Elevated levels of triglycerides can be associated with atherosclerosis, even in the absence of hypercholesterolemia (high cholesterol levels), and can predispose to cardiovascular disease. Very high triglyceride levels can increase the risk of acute pancreatitis. Hypertriglyceridemia can be associated with overeating, obesity, diabetes mellitus and insulin resistance, excess alcohol consumption, kidney failure, nephrotic syndrome, genetic predisposition (e.g., familial combined hyperlipidemia, i.e., Type II hyperlipidemia), lipoprotein lipase deficiency, lysosomal acid lipase deficiency, cholesteryl ester storage disease, certain medications (e.g., isotretinoin, hydrochlorothiazide diuretics, beta blockers, protease inhibitors), hypothyroidism (underactive thyroid), systemic lupus erythematosus and associated autoimmune responses, glycogen storage disease type 1, propofol, or HIV medications.

[0100] The term “diabetes,” as used herein, refers to a group of metabolic disorders characterized by a high blood sugar level over a prolonged period of time. Diabetes can be type 1 diabetes that results from the pancreas’s failure to produce enough insulin due to loss of beta cells. Diabetes can be type 2 diabetes characterized by insulin resistance, a condition in which cells fail to respond to insulin properly. Diabetes can be gestational diabetes that occurs when pregnant women without a previous history of diabetes develop high blood sugar levels.

[0101] The term “low-density lipoprotein (LDL),” as used herein, refers to a microscopic blob made up of an outer rim of lipoprotein and a cholesterol center. LDL can have a highly hydrophobic core composed of a polyunsaturated fatty acid known as linoleate and hundreds to thousands esterified and unesterified cholesterol molecules. The core of LDL can also carry triglycerides and other fats and can be surrounded by a shell of phospholipids and unesterified cholesterol.

[0102] The term “high-density lipoprotein (HDL),” as used herein, refers to the smallest lipoprotein particles. Plasma enzyme lecithin-cholesterol acyltransferase (LCAT) can convert the free cholesterol into cholesteryl, which is then sequestered into the core of the lipoprotein particle, eventually causing the newly synthesized HDL to assume a spherical shape. HDL particles can increase in size as they circulate through the bloodstream and incorporate more cholesterol and phospholipid molecules from cells and other lipoproteins.

[0103] The term “cholesterol,” as used herein, refers to a lipid with a unique structure composed of four linked hydrocarbon rings forming the bulky steroid structure. The term “triglyceride,” as used herein, refers to a tri-ester composed of a glycerol bound to three fatty acid molecules. In some embodiments, the fatty acids are saturated or unsaturated fatty acids.

[0104] The terms “treat,” “treating,” or “treatment,” and its grammatical equivalents as used herein, can include alleviating, abating, or ameliorating at least one symptom of a disease or a condition, preventing additional symptoms, inhibiting the disease or the condition, e.g., delaying, decreasing, suppressing, attenuating, diminishing, arresting, or stabilizing the development or progression of a disease or the condition, relieving the disease or the condition, causing regression of the disease or the condition, relieving a condition caused by the disease or the condition, reducing disease severity, or stopping the symptoms of the disease or the condition either prophylactically and / or therapeutically. “Treating” also includes lessening the frequency of occurrence or recurrence, or the severity, of any symptoms or other ill effects related to a disease or condition and / or the side effects associated with the disease or condition. “Treating” does not necessarily require curative results. It is appreciated that, although not precluded, treating a disorder or condition also does not require that the disorder, condition, or symptoms associated therewith be completely eliminated. The term “treating” encompasses the concept of “managing” which refers to reducing the severity of a particular disease or disorder in a patient or delaying its recurrence, e.g., lengthening the period of remission in a patient who had suffered from the disease. “Treating” may refer to the application or administration or a composition to a subject after the onset, or suspected onset, of a disease or condition.

[0105] The term “treating” further encompasses the concept of “prevent,” “preventing,” and “prevention.” The terms “prevent,” “preventing,” and “prevention,” as used herein, refer to a decrease in the occurrence of pathology of a condition in a subject, who does not have, but is at risk of or susceptible to developing a disease or condition. The prevention may be complete, e.g., the total absence of pathology of a condition in a subject. The prevention may also be partial, such that the occurrence of pathology of a condition in a subject is less than that which would have occurred without the present disclosure.

[0106] By “treating or preventing a condition,” for example, as compared with an equivalent untreated control, alleviating a symptom of a disorder may involve reduction or degree of prevention at least 3%, 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 100% as measured by any standard technique. In some embodiments, alleviating a symptom of a disorder may involve reduction or degree of prevention by at least 2, 3, 4, 5, 10, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or 10000 fold as compared with an equivalent untreated control.

[0107] As used therein, “delaying” the development of a disease means to defer, hinder, slow, retard, stabilize, and / or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and / or individuals being treated. A method that “delays” or alleviates the development of a disease, or delays the onset of the disease, is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and / or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.

[0108] “Development” or “progression” of a disease means initial manifestations and / or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset.

[0109] As used herein “onset” or “occurrence” of a disease includes initial onset and / or recurrence.

[0110] “Administering” and its grammatical equivalents as used herein can refer to providing pharmaceutical compositions described herein to a subject or a patient. Conventional methods, known to those of ordinary skill in the art of medicine, can be used to administer the composition to the subject, depending upon the type of disease to be treated or the site of the disease. For example, the composition can be administered, e.g., orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally, via an implanted reservoir, or via infusion. One or more such routes can be employed.

[0111] The term “parenteral” as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraperitoneal, intradermal, intraarterial, intrasynovial, intrastemal, intrathecal, intravascular, intralesional, and intracranial injection or infusion techniques. In addition, it can be administered to the subject via injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.

[0112] By “co-administering” is meant administering one or more additional therapeutic regimens or agents or treatments and the composition of the disclosure sufficiently close in time to enhance the effect of one or more additional therapeutic agents, or vice versa. In this regard, the composition of the disclosure described herein can be administered simultaneously with one or more additional therapeutic regimens or agents or treatments, at a different time, or on an entirely different therapeutic schedule (e.g., the first treatment can be daily, while the additional treatment is weekly). For example, in embodiments, the secondary therapeutic regimens or agents or treatments are administered simultaneously, prior to, or subsequent to the composition of the disclosure.

[0113] The terms “pharmaceutical composition” and its grammatical equivalents as used herein can refer to a mixture or solution comprising a therapeutically effective amount of an active pharmaceutical ingredient together with one or more pharmaceutically acceptable excipients, carriers, and / or a therapeutic agent to be administered to a subject, e.g., a human in need thereof.

[0114] The term “pharmaceutically acceptable” and its grammatical equivalents as used herein can refer to an attribute of a material which is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and neither biologically nor otherwise undesirable and is acceptable for veterinary as well as human pharmaceutical use. “Pharmaceutically acceptable” can refer a material, such as a carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively nontoxic, ie., the material may be administered to a subject without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the pharmaceutical composition in which it is contained.

[0115] A “pharmaceutically acceptable excipient, carrier, or diluent” refers to an excipient, carrier, or diluent that can be administered to a subject, together with an agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the agent.

[0116] A “pharmaceutically acceptable salt” may be an acid or base salt that is generally considered in the art to be suitable for use in contact with the tissues of human beings or animals without excessive toxicity, irritation, allergic response, or other problem or complication. Such salts include mineral and organic acid salts of basic residues such as amines, as well as alkali or organic salts of acidic residues such as carboxylic acids. Specific pharmaceutical salts include, but are not limited to, salts of acids such as hydrochloric, phosphoric, hydrobromic, malic, glycolic, fumaric, sulfuric, sulfamic, sulfanilic, formic, toluenesulfonic, methanesulfonic, benzene sulfonic, ethane disulfonic, 2-hydroxyethyl sulfonic, nitric, benzoic, 2-acetoxybenzoic, citric, tartaric, lactic, stearic, salicylic, glutamic, ascorbic, pamoic, succinic, fumaric, maleic, propionic, hydroxymaleic, hydroiodic, phenylacetic, alkanoic such as acetic, HOOC-(CH2)n-COOH where n is 0-4, and the like. Similarly, pharmaceutically acceptable cations include, but are not limited to sodium, potassium, calcium, aluminum, lithium and ammonium. Those of ordinary skill in the art will recognize from this disclosure and the knowledge in the art that further pharmaceutically acceptable salts include those listed by Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, PA, p. 1418 (1985). In general, a pharmaceutically acceptable acid or base salt can be synthesized from a parent compound that contains a basic or acidic moiety by any conventional chemical method. Briefly, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in an appropriate solvent.

[0117] The term “therapeutic agent” can refer to any agent that, when administered to a subject, has a therapeutic, diagnostic, and / or prophylactic effect and / or elicits a desired biological and / or pharmacological effect. Therapeutic agents can also be referred to as “actives” or “active agents.” Such agents include, but are not limited to, cytotoxins, radioactive ions, chemotherapeutic agents, small molecule drugs, proteins, and nucleic acids.

[0118] “A therapeutically effective amount” as used herein refers to the amount of each composition of the present disclosure required to confer therapeutic effect on the subject, either alone or in combination with one or more other therapeutic agents. Hence, as used herein, the term “therapeutically effective amount” means an amount of an agent to be delivered (e.g., nucleic acid, composition, therapeutic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and / or condition, to treat, improve symptoms of, diagnose, prevent, and / or delay the onset of the disease, disorder, and / or condition. In terms of treatment, a “therapeutically effective amount” is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of a disease or a condition, e.g., an atherosclerotic vascular disease, hypertriglyceridemia, or diabetes. A “therapeutically effective amount” varies, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual subject parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment. It will be understood by those of ordinary skill in the art, however, that a subject may insist upon a lower dose or tolerable dose for medical reasons, psychological reasons or for virtually any other reasons. Additionally, other medication the patient may be receiving will affect the determination of the therapeutically effective amount of the therapeutic agent to administer. Empirical considerations, such as the half-life, generally will contribute to the determination of the dosage. A “therapeutically effective amount” may be of any of the compositions of the disclosure used alone or in conjunction with one or more agents used to treat a condition. A therapeutically effective amount can be administered in one or more administrations.

[0119] An effective initial method to determine a “therapeutically effective amount” may be by carrying out cell culture assays (for example, using neuronal cells) or using animal models (for example, mice, rats, rabbits, dogs or pigs). A dose may be formulated in animal models to achieve a concentration range that includes the IC50 (i.e., the concentration of the composition which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. In addition to determining the appropriate concentration range for an disclosure composition to be therapeutically effective, animal models may also yield other relevant information such as preferable routes of administration that will give maximum effectiveness. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the capabilities of the ordinarily skilled artisan.

[0120] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50, as well as all intervening decimal values between the aforementioned integers such as, for example, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, and 1.9. With respect to sub-ranges, “nested sub-ranges” that extend from either end point of the range are specifically contemplated. For example, a nested sub-range of an exemplary range of 1 to 50 may comprise 1 to 10, 1 to 20, 1 to 30, and 1 to 40 in one direction, or 50 to 40, 50 to 30, 50 to 20, and 50 to 10 in the other direction.

[0121] The term “protospacer,” or “target sequence” and their grammatical equivalents as used herein can refer to a DNA sequence of a target gene. In the native state, a protospacer is adjacent to a PAM (protospacer adjacent motif). The site of cleavage by an RNA-guided nuclease is within a protospacer sequence.

[0122] The term “spacer” or “spacer sequence” refers to a nucleic acid sequence that is complementary and binds to the complementary strand of the target gene. A spacer can be within a guide nucleic acid (e.g., gRNA, gDRNA).

[0123] The term “base editing,” “gene editing,” “genome editing,” or “gene modification” and its grammatical equivalents as used herein can refer to genetic engineering in which one or more nucleotides are inserted, replaced, or removed from a genome. Gene editing can be performed using a nuclease (e.g., a natural-existing nuclease or an artificially engineered nuclease). Gene modification can include introducing a double stranded break, a non-sense mutation, a frameshift mutation, a splice site alteration, or an inversion in a polynucleotide sequence, e.g., a target polynucleotide sequence.

[0124] The term “base editor” as used herein can refer to an agent that binds a polynucleotide and has nucleobase modifying activity. The base editor can comprise a nucleobase modifying polypeptide (e.g., a deaminase) and a nucleic acid programmable nucleotide binding domain in conjunction with a guide polynucleotide (e.g., guide RNA), or nucleic acids encoding the programmable nucleotide binding domain and the deaminase. The agent can be a biomolecular complex comprising a protein domain having base editing activity, i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA), or a nucleic acid encoding the same. The polynucleotide programmable DNA binding domain can be fused or linked to a deaminase domain, resulting in a base editor fusion protein. The base editor can comprise a nucleic acid encoding the base editor fusion protein, e.g., a mRNA encoding the base editor fusion protein. The base editor fusion protein can comprise one or more linkers, for example, peptide linkers. The agent can be a fusion protein comprising a domain having base editing activity. The protein domain having base editing activity can be linked to the guide RNA (e.g., via an RNA binding motif on the guide RNA and an RNA binding domain fused to the deaminase). In some instances, the domain having base editing activity is capable of deaminating a base within a nucleic acid molecule. In some instances, the base editor is capable of deaminating one or more bases within a DNA molecule. In some instances, the base editor is capable of deaminating an adenosine (A) within DNA. The base editor can be an adenosine base editor (ABE). In some instances, the base editor is capable of deaminating a cytosine (C) within DNA. The base editor can be a cytosine base editor (CBE).

[0125] The term “base editor system” refers to a gene editing system for editing a single nucleobase of a target nucleotide sequence. In various embodiments, the base editor system comprises (1) a polynucleotide programmable nucleotide binding domain (e.g., Cas9); (2) a deaminase domain (e.g., an adenosine deaminase or a cytidine deaminase) for deaminating said nucleobase; and (3) one or more guide polynucleotide (e.g., guide RNA). In some embodiments, the base editor system comprises a base editor fusion protein comprising (1) and (2). In some embodiments, the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain. In some embodiments, the base editor is an adenine or adenosine base editor (ABE). In some embodiments, the base editor is a cytosine base editor (CBE).

[0126] The term “prime editing” as used herein refers to a form of precise genome editing that enables direct, irreversible targeted small insertions, deletions, and base swapping without requiring double- stranded DNA breaks (DSBs), or donor DNA templates. DNA prime editors comprise a catalytically disabled Cas9 nuclease fused to a reverse transcriptase. Prime editing involves a prime editing guide RNA (pegRNA) that is substantially larger than a standard sgRNA used for CRISPR Cas9 editing. The pegRNA comprises a primer binding sequence (PBS) and a template containing the desired RNA sequence added at the 3’ end.

[0127] The term “CRISPR RNA” (crRNA) herein refers to an RNA sequence that can form a complex with one or more Cas proteins (e.g., Cas9) and provides DNA binding specificity to the complex. A crRNA provides DNA binding specificity since it contains a “spacer sequence” that is complementary to a strand of a DNA target sequence. A crRNA further comprises a “repeat sequence” (“tracr RNA mate sequence”) encoded by a repeat region of the CRISPR locus from which the crRNA was derived. A repeat sequence of a crRNA can anneal to sequence at the 5'-end of a tracrRNA. crRNA in native CRISPR systems is derived from a “pre-crRNA” transcribed from a CRISPR locus. A pre-crRNA comprises spacer regions and repeat regions; spacer regions contain unique sequence complementary to a DNA target site sequence. Pre-crRNA in native systems is processed to multiple different crRNAs, each with a guide sequence along with a portion of repeat sequence. CRISPR systems utilize crRNA, for example, for DNA targeting specificity.

[0128] The term “trans-activating CRISPR RNA” (tracrRNA) herein refers to a non-coding RNA used in type II CRISPR systems, and contains, in the 5'-to-3' direction, (i) a sequence that anneals with the repeat region of CRISPR type II crRNA and (ii) a stem loop-containing portion (Deltcheva et al., Nature 471:602-607). A modified tracrRNA refers to a tracrRNA with modified ribonucleotide (e.g., 2-OMe modified RNA).

[0129] As used herein, the term “guide nucleic acid”, relates to a polynucleotide sequence that can form a complex with a Cas endonuclease and enables the Cas endonuclease to recognize and optionally cleave a DNA target site. The guide nucleic acid can be a single molecule or a double molecule. The guide nucleic acid sequence can be DNA only (gDNA). The DNA can be modified or unmodified. The guide nucleic acid sequence can be RNA only (gRNA). The RNA can be modified or unmodified. The guide nucleic acid sequence can be a combination of DNA and RNA. Optionally, the guide nucleic acid can comprise at least one nucleotide, phosphodiester bond or linkage modification such as, but not limited, to Locked Nucleic Acid (LNA), 5-methyl dC, 2,6-Diaminopurine, 2'-Fluoro A, 2'-Fluoro U, 2'-O-Methyl RNA, Phosphorothioate bond, linkage to a cholesterol molecule, linkage to a polyethylene glycol molecule, linkage to a spacer 18 (hexaethylene glycol chain) molecule, or 5' to 3' covalent linkage resulting in circularization. A guide nucleic acid that solely comprises ribonucleic acids is referred to as a “guide RN ” A guide nucleic acid that comprises both RNA and DNA is referred to as a “guide RDNA.”

[0130] “Partial hepatectomy,” as used herein, refers to an operation to remove part of the liver. In some embodiments, partial hepatectomy is used to model liver regeneration in vivo.

[0131] As used herein, a spacer sequence that corresponds to a protospacer is capable of making a modification to a base within the complimentary strand of the target protospacer nucleic acid sequence, a spacer sequence that corresponds to a protospacer sequence may be identical or substantially identical to the protospacer sequence.

[0132] As used herein, “corresponding” refers to a region where a different sequence or component can react to or bind to. For example, a corresponding region of a Cas9 nickase to a scaffold component of a guide RNA refers to a region of the Cas9 nickase that can react and bind to the scaffold component of a guide RNA. For another example, a spacer sequence corresponds to a protospacer sequence refers to the fact that the spacer sequence binds to the protospacer sequence. The binding might have one or more mis-matches. Gene Editing Systems

[0133] The clustered regularly interspaced short palindromic repeat (CRISPR) system has been adopted for gene editing and has revolutionized the biotechnology and life science space. Despite being a powerful gene editing tool, CRISPR has its own drawbacks. One of the major issues is the off-target mutations caused by the system. (Yin et al., Nature Chemical Biology 14, 311-316 (2018)). It has been found that partially replacing the RNA nucleotides (ribonucleosides) from the guide RNA with DNA nucleotides (deoxyribonucleosides) can lead to decreased off-target activity compared to the unmodified guide RNA. Such DNA-RNA chimera guides are also known as CRISPR hybrid DNA-RNA (chRDNA). However, while the chRDNA can reduce the off-target effect, it often does so by sacrificing the on-target editing efficiency. Thus, there remains an urgent need in finding optimized guide nucleic acids for CRISPR systems that would maintain the powerful on-target editing efficiency with low off-targeting effect, particularly in vivo.

[0134] The present disclosure provides a novel gene editing system that offers many of the benefits of using the CRISPR system for gene editing - namely, highly efficient programmable gene editing - while overcoming the limitation of off-target editing. The novel gene editing system described herein achieves efficient gene editing results with reduced off-target effect by using a novel guide nucleic acid to direct a gene editor protein to affect an alteration to a target gene. As disclosed herein, the novel guide nucleic acid is engineered to comprise a mixture of deoxyribonucl eotide and ribonucleotide in the spacer sequence comprising at least one deoxyribonucl eotide and at least one ribonucleotide in the spacer sequence while retaining its ability to hybridize to the target gene. The number, the position, and the specific modification of the deoxyribonucleotide and / or ribonucleotide in the guide nucleic acid are optimized such that the gene editing system comprising the guide nucleic acid is allowed to perform gene editing with high on-target efficiency but low off-target effect. In some embodiments, the 2’ hydroxyl group on the ribose of the ribonucleotide can be modified to covalently linked to a methyl group. FIGs 28A-28D provide exemplary gene editing systems with guide nucleic acids comprising exemplary spacer sequences as disclosed herein. As illustrated in FIG. 28A, the exemplary gene editing system (100) comprises a gene editor protein (150) which contains a nucleic acid binding domain that can bind to the target gene (110) and a guide nucleic acid (120). The representative guide nucleic acid (120) comprises a spacer sequence (130) composed of both ribonucleotides (RNA) and deoxyribonucleotides (DNA). The spacer sequence (130) is complementary to a protospacer (160) from the target gene (110). Replacing the ribonucleotides with deoxyribonucleotides at some specific positions of the spacer sequence (130) with 2’-0Me and phosphorothioate backbone chemical modifications results in unique DNA-RNA hybrid sequence motifs at the 5’-end to the spacer sequence (130), which is able to direct the gene editor protein (150) to the target sequence (160) to elicit site-specific on-target gene alteration with reduced off-target effect. Here, the exemplary motif in the spacer sequence (130) is (2’-0Me RNA)(2’-0Me RNA)(DNA)(DNA)(RNA)(DNA)(DNA)(DNA). Note that the specific phosphorothioate backbone modifications are not shown. The guide nucleic acid (120) further comprises a tracrRNA (140) or equivalent thereof at the 3’ end of the spacer sequence (130). The tracrRNA (140) or equivalent thereof recruits a gene editor protein (150) to the target sequence (160) to affect an alteration on the target gene (110). The tracrRNA (140) may be modified. For example, the tracrRNA (140) may comprises a 2’-0Me RNA (not shown). The gene editor protein (150) may comprise a deaminase that can be used for base editing. FIGs. 1B-1D illustrate other exemplary gene editing systems with guide nucleic acids comprising other exemplary spacer sequences. For example, FIG. 28B illustrates a spacer sequence with motif of (2’-0Me RNA)(2’-0Me RNA)(DNA)(DNA)(RNA)(DNA)(DNA). FIG. 28C illustrates another spacer sequence with another motif of (2’-0Me RNA)(2’-0Me RNA)(DNA)(DNA)(DNA)(DNA)(DNA). FIG. 28D illustrates another spacer sequence with another motif of (2’-0Me RNA)(2’-0Me RNA)( 2’-0Me RNA)(DNA)(DNA)(DNA)(DNA)(RNA)(DNA)(DNA)(RNA)(RNA)(DNA)(DNA). Note that the specific phosphorothioate backbone modifications are not shown. Note the drawing is for schematic purpose only.

[0135] The present disclosure further provides a novel gene editing system for base editing with high on-target efficiency and low off-target editing. The novel gene editing system for base editing described herein achieves the benefits by using the novel guide nucleic acid described herein to direct the gene editor protein comprising a deaminase to modify a nucleobase in the target gene.

[0136] The present disclosure further provides a novel gene editing system for editing ANGPTL3 gene with high on-target efficiency and low off-target editing. The novel gene editing system for editing ANGPTL3 gene described herein achieves the benefits by using the novel guide nucleic acid to direct the gene editor protein to affect an alteration to the ANGPTL3 gene. CRISPR / Cas Systems

[0137] There are several different CRISPR / Cas systems and the nomenclature and classification of these have changed as the systems are further characterized. The CRISPR / Cas system is superior to other methods of genome editing involving endonucleases, meganucleases, zinc finger nucleases, and transcription activator-like effector nucleases (TALENs), which may require de novo protein engineering for every new target locus.

[0138] Based upon the genes encoding the effector module ( / . e., the proteins involved in the interference stage), the CRISPR / Cas systems can be placed in either Class 1 or Class 2. Class 1 systems have a multi-subunit crRNA-effector complex, whereas Class 2 systems have a single protein, such as Cas 9, Cpfl, C2cl, C2c2, C2c3, or a crRNA-effector complex. Class 1 systems comprise Type I, Type III and Type IV systems. Class 2 systems comprise Type II and Type V systems (Makarova et al., Nature Review Microbiology 13: 1-15 (2015)).

[0139] Type I systems all have a Cas3 protein with helicase activity and cleavage activity. Type I systems are divided into seven sub-types (I-A to I-F and I-U). Type III systems possess a caslO gene, which encodes a multidomain protein containing a Palm domain (a variant of the RNA recognition motif (RRM)) that is homologous to the core domain of numerous nucleic acid polymerases and cyclases and that is the largest subunit of type III crRNA-effector complexes. All type III loci also encode the small subunit protein, one Cas5 protein and typically several Cas7 proteins. Type III can be divided into four sub-types, III-A to III-D. Sub-type III-A has a csm2 gene encoding a small subunit and also has casl, cas2 and cas6 genes. Sub-type III-B has a cmr5 gene encoding a small subunit and also typically lacks casl, cas2 and cas6 genes. Sub-type III-C has a CaslO protein with an inactive cyclase-like domain and lacks a casl and cas2 gene. Sub-type III-D has a CaslO protein that lacks the HD domain, it lacks a casl and cas2 gene and has a casJ-like gene known as csxlO. Type IV systems encode a minimal multisubunit crRNA-effector complex comprising a partially degraded large subunit, Csfl, Cas5, Cas7, and in some cases, a putative small subunit. Type IV systems lack casl and cas2 genes. Type IV systems do not have sub-types, but there are two distinct variants. One variant has a DinG family helicase, while the other variant lacks a DinG family helicase, but has a gene encoding a small a-helical protein.

[0140] Type II systems have casl, cas2 and cas9 genes. cas9 encodes a multidomain protein that combines the functions of the crRNA-effector complex with target DNA cleavage. Type II systems also encode a tracrRNA. Type II systems are divided into three sub-types, subtypes II-A, II-B and II-C. Sub-type II-A contains an additional gene, csn2. Sub-type II-B lacks csn2, but has cas4. Sub-type II-C is the most common Type II system found in bacteria and has only three proteins, Casl, Cas2 and Cas9. Type V systems have a cpfl gene and casl and cas2 genes. The cpfl gene encodes a protein, Cpfl, that has a RuvC-like nuclease domain that is homologous to the respective domain of Cas9, but lacks the HNH nuclease domain that is present in Cas9 proteins.

[0141] In Class 1 systems, the expression and interference stages involve multisubunit CRISPR RNA (crRNA)-effector complexes. In these systems, pre-crRNA is bound to the multisubunit crRNA-effector complex and processed into a mature crRNA. In Type I and III systems this involves an RNA endonuclease, e.g., Cas6.

[0142] In Class 1 systems the crRNA is associated with the crRNA-effector complex and achieves interference by combining nuclease activity with RNA-binding domains and base pair formation between the crRNA and a target nucleic acid. In Type I systems, the crRNA and target binding of the crRNA-effector complex involves Cas7, Cas5, and Cas8 fused to a small subunit protein. The target nucleic acid cleavage of Type I systems involves the HD nuclease domain, which is either fused to the superfamily 2 helicase Cas3’ or is encoded by a separate gene, cas3”. In Type III systems, the crRNA and target binding of the crRNA-effector complex involves Cas7, Cas5, CaslO and a small subunit protein. The target nucleic acid cleavage of Type III systems involves the combined action of the Cas7 and CaslO proteins, with a distinct HD nuclease domain fused to CaslO, which is thought to cleave single-stranded DNA during interferences.

[0143] In Class 2 systems, the expression and interference stages involve a single large protein, e.g., Cas9, Cpfl, C2C1, C2C2, or C2C3. In most Class 2 Type II systems, pre-crRNA is bound to Cas9 and processed into a mature crRNA in a step that involves RNase III and a tracrRNA.

[0144] In Class 2 systems the crRNA is associated with a single protein and achieves interference by combining nuclease activity with RNA-binding domains and base pair formation between the crRNA and a target nucleic acid. In Type II systems, the crRNA and target binding involves Cas9 as does the target nucleic acid cleavage. In Type II systems, the RuvC-like nuclease (RNase H fold) domain and the HNH (McrA-like) nuclease domain of Cas9 each cleave one of the strands of the target nucleic acid. The Cas9 cleavage activity of Type II systems also requires hybridization of crRNA to tracrRNA to form a duplex that facilitates the crRNA and target binding by the Cas9. In Type V systems, the crRNA and target binding involves Cpfl as does the target nucleic acid cleavage. In Type V systems, the RuvC-like nuclease domain of Cpfl cleaves both strands of the target nucleic acid in a staggered configuration, producing 5’ overhangs, which is in contrast to the blunt ends generated by Cas9 cleavage. These 5’ overhangs may facilitate insertion of DNA through non-homologous end-joining (NHEJ) methods.

[0145] The Cpfl cleavage activity of Type V systems also does not require hybridization of crRNA to tracrRNA to form a duplex, rather the crRNA of Type V systems use a single crRNA that has a stem loop structure forming an internal duplex. Cpfl binds the crRNA in a sequence and structure specific manner, that recognizes the stem loop and sequences adjacent to the stem loop, most notably, the nucleotide 5’ of the spacer sequences that hybridizes to the target nucleic acid. This stem loop structure is typically in the range of 15 to 19 nucleotides in length. Substitutions that disrupt this stem loop duplex abolish cleavage activity, whereas other substitutions that do not disrupt the stem loop duplex do not abolish cleavage activity. In Type V systems, the crRNA forms a stem loop structure at the 5’ end and the sequence at the 3’ end is complementary to a sequence in a target nucleic acid.

[0146] Other proteins associated with Type V crRNA and target binding and cleavage include Class 2 candidate 1 (C2cl) and Class 2 candidate 3 (C2c3). C2cl and C2c3 proteins are similar in length to Cas9 and Cpfl proteins, ranging from approximately 1,100 amino acids to approximately 1,500 amino acids. C2cl and C2c3 proteins also contain RuvC-like nuclease domains and have an architecture similar to Cpfl. C2cl proteins are similar to Cas9 proteins in requiring a crRNA and a tracrRNA for target binding and cleavage, but have an optimal cleavage temperature of 50°C. C2cl proteins target an AT-rich PAM, which similar to Cpfl, is 5' of the target sequence, (Shmakov et al., Molecular Cell 60(3): 385-397 (2015)). Class 2 candidate 2 (C2c2) does not share sequence similarity to other CRISPR effector proteins, and therefore may be in a putative Type VI system. C2c2 proteins have two HEPN domains and are predicted to have RNase activity, and therefore may target and cleave mRNA. C2c2 proteins appear similar to Cpfl proteins in requiring crRNA for target binding and cleavage, while not requiring tracrRNA. Also like Cpfl, the crRNA for C2c2 proteins forms a stable hairpin, or stem loop structure, that may aid in association with the C2c2 protein.

[0147] The gene editing systems provided herein may comprise Class 1 or Class 2 system components, including ribonucleic acid protein complexes. The Class 2 Cas nuclease families of proteins are enzymes with DNA endonuclease activity, and they can be directed to cleave a desired nucleic acid target by designing an appropriate guide RNA, as described further herein. A Class 2 CRISPR / Cas system component may be from a Type II, Type IIA, Type IIB, Type IIC, Type V, or Type VI system. Class 2 Cas nucleases include, for example, Cas9 (also known as Csnl or Csxl2), Csn2, Cas4, Casl2a (Cpfl), Casl2b (C2cl), Casl2c (C2c3), Casl3a (C2c2), Casl3b, Casl3c, and Casl3d proteins. In some embodiments, the Cas protein is from a Type II CRISPR / Cas system, i.e., a Cas9 protein from a CRISPR / Cas9 system, or a Type V CRISPR / Cas system, e.g., a Casl2a protein. In some embodiments, the Cas protein is from a Class 2 CRISPR / Cas system, i.e., a single-protein Cas nuclease such as a Cas9 protein or a Casl2a protein. Other non-limiting examples of Cas proteins can include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, CaslO, Csyl, Csy2, Csy3, Csel, Cse2, Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csxl4, CsxlO, Csxl6, CsaX, Csx3, Csxl, CsxlS, Csfl, Csf2, CsO, Csf4, Cpfl, Cas9HiFi, homologues thereof, or modified versions thereof. Base Editing / Base Editing System

[0148] Class 2 CRISPR / Cas systems, particularly CRISPR / Cas9 systems, have been used for precision genome editing. Through the use of a guide RNA (gRNA) with a sequence homologous to that of a sequence of DNA in the target genome (known as the protospacer) adjacent to a specific protospacer-adjacent motif (PAM) comprising the sequence NGG (N is any standard base) in the DNA, Cas9 can be used to create a double-strand break (DSB) at the targeted sequence. NHEJ at DSBs can be used to create indels and knock out genes at genetic loci; likewise, homology-directed repair (HDR) can be used, with an introduced template DNA, to insert genes or modify the targeted sequence.

[0149] In some aspects, provided herein are base editor systems capable of nucleobase modifications. In some embodiments, the base editor system comprises (i) a guide polynucleotide or a nucleic acid encoding same, and (ii) a base editor fusion protein comprising a programmable DNA binding domain (e.g., Cas9 or dCas9) and a deaminase, or a nucleic acid encoding same. In some embodiments, the base editor system comprises a guide polynucleotide. In some embodiments, the base editor system comprises a nucleic acid encoding a guide polynucleotide. In some embodiments, the base editor system comprises a base editor fusion protein comprising a programmable DNA binding domain and a deaminase. In some embodiments, the base editor system comprises a nucleic acid encoding a base editor fusion protein comprising a programmable DNA binding domain and a deaminase.

[0150] In some embodiments, the guide polynucleotide directs the base editor system to effect a nucleobase alteration in a PCSK9 or ANGPTL3 gene in vivo when administered to a subject.

[0151] In some embodiments, the base alteration occurs in at least 35% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing.

[0152] In some embodiments, the base alteration occurs in at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in at most 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in l%-99.9%, 2%-99.9%, 3%-99.9%, 4%-99.9%, 5%-99.9%, 6%-99.9%, 7%-99.9%, 8%-99.9%, 9%-99.9%, 10%-99.9%, 15%-99.9%, 20%-99.9%, 25%-99.9%, 30%-99.9%, 35%-99.9%, 40%-99.9%, 45%-99.9%, 50%-99.9%, 55%-99.9%, 60%-99.9%, 65%-99.9%, 70%-99.9%, 75%-99.9%, 80%-99.9%, 85%-99.9%, 90%-99.9%, or 95-99.9% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in l%-99.5%, l%-99%, l%-98%, l%-97%, 1%- 96%, l%-95%, l%-90%, l%-85%, l%-80%, l%-75%, l%-70%, l%-65%, l%-60%, l%-55%, l%-50%, l%-45%, l%-40%, l%-35%, l%-30%, l%-25%, l%-20%, 1%-15%, l%-10%, 1%-9%, l%-8%, l%-7%, l%-6%, l%-5%, l%-4%, l%-3%, or l%-2% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in l%-90%, 5%-85%, 10%-80%, 15%-75%, 20%-70%, 25%-65%, 30%-60%, 35%-55%, or 40%-50% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in 100% of whole liver cells in the subject as measured by next generation sequencing or Sanger sequencing.

[0153] In some embodiments, the base alteration occurs in hepatocytes in the subject. In some embodiments, the base alteration occurs in at least 30% of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in hepatocytes in the subject. In some embodiments, the base alteration occurs in at least % of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in at most 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in l%-99.9%, 2%-99.9%, 3%-99.9%, 4%-99.9%, 5%-99.9%, 6%-99.9%, 7%-99.9%, 8%-99.9%, 9%-99.9%, 10%-99.9%, 15%-99.9%, 20%-99.9%, 25%-99.9%, 30%-99.9%, 35%-99.9%, 40%-99.9%, 45%-99.9%, 50%-99.9%, 55%-99.9%, 60%-99.9%, 65%-99.9%, 70%-99.9%, 75% 99.9%, 80%-99.9%, 85%-99.9%, 90%-99.9%, or 95-99.9% of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in l%-99.5%, l%-99%, l%-98%, l%-97%, l%-96%, l%-95%, l%-90%, 1%- 85%, l%-80%, l%-75%, l%-70%, l%-65%, l%-60%, l%-55%, l%-50%, l%-45%, l%-40%, l%-35%, l%-30%, l%-25%, l%-20%, 1%-15%, l%-10%, l%-9%, l%-8%, l%-7%, l%-6%, l%-5%, l%-4%, l%-3%, or l%-2% hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in l%-90%, 5%-85%, 10%-80%, 15%-75%, 20%-70%, 25%-65%, 30%-60%, 35%-55%, or 40%-50% of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing. In some embodiments, the base alteration occurs in 100% of hepatocytes in the subject as measured by next generation sequencing or Sanger sequencing.

[0154] In some embodiments, the base alteration occurred in whole liver cells in the subject is measured by next generation sequencing. In some embodiments, the base alteration occurred in whole liver cells in the subject is measured by Sanger sequencing. In some embodiments, the base alteration occurred in hepatocytes in the subject is measured by next generation sequencing. In some embodiments, the base alteration occurred in hepatocytes in the subject is measured by Sanger sequencing.

[0155] In some embodiments, the nucleobase alteration results in a reduction of at least 35% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of at least 35% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS.

[0156] In some embodiments, the nucleobase alteration results in a reduction of at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 90%, 95%, 97%, 98%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of at most 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 90%, 95%, 97%, 98%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 2%-99.9%, 3%-99.9%, 4%-99.9%, 5%-99.9%, 6%-99.9%, 7%-99.9%, 8%-99.9%, 9%-99.9%, 10%-99.9%, 15%-99.9%, 20%-99.9%, 25%-99.9%, 30%-99.9%, 31%-99.9%, 32%-99.9%, 33%-99.9%, 34%-99.9%, 35%-99.9%, 36%-99.9%, 37%-99.9%, 38%-99.9%, 39%-99.9%, 40%-99.9%, 45%-99.9%, 50%-99.9%, 55%-99.9%, 60%-99.9%, 65%-99.9%, 70%-99.9%, 75%-99.9%, 80%-99.9%, 85%-99.9%, 90%-99.9%, or 95-99.9% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of l%-99.5%, l%-99%, 1%-98%, l%-97%, l%-96%, l%-95%, l%-90%, l%-85%, l%-80%, l%-79%, l%-78%, l%-77%, l%-76%, l%-75%, l%-74%, l%-73%, l%-72%, 1%-71%, l%-70%, l%-65%, l%-60%, 1%-55%, l%-50%, l%-45%, l%-40%, l%-39%, l%-38%, l%-37%, l%-36%, l%-35%, l%-34%, l%-33%, l%-32%, l%-31%, l%-30%, l%-25%, l%-20%, 1%-15%, l%-10%, l%-9%, l%-8%, l%-7%, l%-6%, l%-5%, l%-4%, l%-3%, or l%-2% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 5%-99.5%, 10%-99%, 15%-97%, 20%-95%, 25%-90%, 30%-85%, 31%-80%, 32%-79%, 33%-78%, 34%-77%, 35%-76%, 36%-76%, 37%-75%, 38%-74%, 39%-73%, 40%-72%, 45%-71%, 50%-70%, or 55%-65% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of 100% in blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS.

[0157] In some embodiments, the nucleobase alteration results in at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 75%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 210%, 220%, 230%, 240%, 250%, 260%, 270%, 280%, 290%, 300%, 400% 500%, 600%, 700%, 800%, 900%, 1000% less blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in at least 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more than 10-fold less blood PCSK9 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS.

[0158] In some embodiments, the reduction of blood PCSK9 protein level or the blood PCSK9 protein level in the subject as compared to prior to the administration is measured by ELISA (enzyme-linked immunosorbent assay). In some embodiments, the reduction of blood PCSK9 protein level or the blood PCSK9 protein level in the subject as compared to prior to the administration is measured by Western blot analysis. In some embodiments, the reduction of blood PCSK9 protein level or the blood PCSK9 protein level in the subject as compared to prior to the administration is measured by LC-MS / MS (liquid chromatography -tandem mass spectrometry).

[0159] In some embodiments, the nucleobase alteration results in a reduction of at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 90%, 95%, 97%, 98%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of at most 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 90%, 95%, 97%, 98%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of 1%-99.9%, 2%-99.9%, 3%-99.9%, 4%-99.9%, 5%-99.9%, 6%-99.9%, 7%-99.9%, 8%-99.9%, 9%-99.9%, 10%-99.9%, 15%-99.9%, 20%-99.9%, 25%-99.9%, 30%-99.9%, 31%-99.9%, 32%-99.9%, 33%-99.9%, 34%-99.9%, 35%-99.9%, 36%-99.9%, 37%-99.9%, 38%-99.9%, 39%-99.9%, 40%-99.9%, 45%-99.9%, 50%-99.9%, 55%-99.9%, 60%-99.9%, 65%-99.9%, 70%-99.9%, 75%-99.9%, 80%-99.9%, 85%-99.9%, 90%-99.9%, or 95-99.9% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of l%-99.5%, l%-99%, l%-98%, l%-97%, l%-96%, l%-95%, l%-90%, l%-85%, l%-80%, l%-79%, l%-78%, l%-77%, l%-76%, l%-75%, l%-74%, l%-73%, l%-72%, 1%-71%, l%-70%, l%-65%, l%-60%, l%-55%, l%-50%, l%-45%, l%-40%, l%-39%, l%-38%, l%-37%, l%-36%, l%-35%, l%-34%, l%-33%, l%-32%, 1%-31%, l%-30%, l%-25%, 1%-20%, 1%-15%, l%-10%, l%-9%, l%-8%, l%-7%, l%-6%, l%-5%, l%-4%, l%-3%, or l%-2% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 5%-99.5%, 10%-99%, 15%-97%, 20%-95%, 25%-90%, 30%-85%, 31%-80%, 32%-79%, 33%-78%, 34%-77%, 35%-76%, 36%-76%, 37%-75%, 38%-74%, 39%-73%, 40%-72%, 45%-71%, 50%-70%, or 55%-65% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in a reduction of 100% in blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS.

[0160] In some embodiments, the nucleobase alteration results in at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 75%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 210%, 220%, 230%, 240%, 250%, 260%, 270%, 280%, 290%, 300%, 400% 500%, 600%, 700%, 800%, 900%, 1000% less blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS. In some embodiments, the nucleobase alteration results in at least 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more than 10-fold less blood ANGPTL3 protein level in the subject as compared to prior to the administration as measured by ELISA, Western blots, or LC-MS / MS.

[0161] In some embodiments, the reduction of blood ANGPTL3 protein level or the blood ANGPTL3 protein level in the subject as compared to prior to the administration is measured by ELISA (enzyme-linked immunosorbent assay). In some embodiments, the reduction of blood ANGPTL3 protein level or the blood ANGPTL3 protein level in the subject as compared to prior to the administration is measured by Western blot analysis. In some embodiments, the reduction of blood ANGPTL3 protein level or the blood ANGPTL3 protein level in the subject as compared to prior to the administration is measured by LC-MS / MS (liquid chromatography -tandem mass spectrometry).

[0162] In some embodiments, the nucleobase alteration results in a reduction of at least 35% in blood or low-density lipoprotein cholesterol (LDL-C) levels in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of at least 35%, 40%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of at most 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 2%-99.9%, 3%-99.9%, 4%-99.9%, 5%-99.9%, 6%-99.9%, 7%-99.9%, 8%-99.9%, 9%-99.9%, 10%-99.9%, 15%-99.9%, 20%-99.9%, 25%-99.9%, 30%-99.9%, 35%-99.9%, 40%-99.9%, 45%-99.9%, 50%-99.9%, 55%-99.9%, 60%-99.9%, 65%-99.9%, 70%-99.9%, 75%-99.9%, 80%-99.9%, 85%-99.9%, 90%-99.9%, or 95-99.9% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of l%-99.5%, l%-99%, l%-98%, l%-97%, l%-96%, l%-95%, l%-90%, l%-85%, l%-80%, l%-75%, l%-70%, l%-65%, l%-60%, l%-55%, l%-50%, 1%-45%, l%-40%, l%-35%, l%-30%, l%-25%, l%-20%, 1%-15%, l%-10%, l%-9%, l%-8%, 1%-7%, l%-6%, l%-5%, l%-4%, l%-3%, or l%-2% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 5%-99.5%, 10%-99%, 15%-97%, 20%-95%, 25%-90%, 30%-85%, 35%-80%, 40%-75%, 45%-70%, 50%-65%, or 55%-60% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of 100% in blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 75%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 210%, 220%, 230%, 240%, 250%, 260%, 270%, 280%, 290%, 300%, 400% 500%, 600%, 700%, 800%, 900%, 1000% less blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in at least 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8fold, 9-fold, 10-fold, or more than 10-fold less blood low-density lipoprotein cholesterol (LDLC) level in the subject as compared to prior to the administration.

[0163] In some embodiments, the nucleobase alteration results in a reduction of at least 35% in blood triglyceride levels in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of at least 30%, 35%, 40%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of at most 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.3%, 99.5%, 99.7%, 99.8%, or 99.9% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 2%-99.9%, 3%-99.9%, 4%-99.9%, 5%-99.9%, 6%-99.9%, 7%-99.9%, 8%-99.9%, 9%-99.9%, 10%-99.9%, 15%-99.9%, 20%-99.9%, 25%-99.9%, 30%-99.9%, 35%-99.9%, 40%-99.9%, 45%-99.9%, 50%-99.9%, 55%-99.9%, 60%-99.9%, 65%-99.9%, 70%-99.9%, 75%-99.9%, 80%-99.9%, 85%-99.9%, 90%-99.9%, or 9599.9% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of l%-99.5%, l%-99%, 1%-98%, l%-97%, l%-96%, l%-95%, l%-90%, l%-85%, l%-80%, l%-75%, l%-70%, l%-65%, l%-60%, l%-55%, l%-50%, l%-45%, l%-40%, l%-35%, l%-30%, l%-25%, l%-20%, 1%-15%, l%-10%, l%-9%, l%-8%, l%-7%, l%-6%, l%-5%, l%-4%, l%-3%, or l%-2% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of l%-99.9%, 5%-99.5%, 10%-99%, 15%-97%, 20%-95%, 25%-90%, 30%-85%, 35%-80%, 40%-75%, 45%-70%, 50%-65%, or 55%-60% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in a reduction of 100% in blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 75%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 210%, 220%, 230%, 240%, 250%, 260%, 270%, 280%, 290%, 300%, 400% 500%, 600%, 700%, 800%, 900%, 1000% less blood triglyceride level in the subject as compared to prior to the administration. In some embodiments, the nucleobase alteration results in at least 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8fold, 9-fold, 10-fold, or more than 10-fold less blood triglyceride level in the subject as compared to prior to the administration.

[0164] In some embodiments, the blood triglyceride level or the reduction of blood triglyceride level in the subject as compared to prior to the administration is measured by any standard technique. In some embodiments, the blood low-density lipoprotein cholesterol (LDL-C) level or the reduction of blood low-density lipoprotein cholesterol (LDL-C) level in the subject as compared to prior to the administration is measured by any standard technique. For example, a clinical analyzer instrument may be used to measure a ‘lipid panel’ in serum samples which entails the direct measurement of cholesterol (total C), triglycerides (TG) and high-density lipoprotein cholesterol (HDL-C) enzymatically. Reagent kits specific for each analyte contain buffers, calibrators, blanks and controls. As used in the present disclosure, cholesterol, triglycerides and HDL-C may be quantified using absorbance measurements of specific enzymatic reaction products. LDL-C may be determined indirectly. In some instances, most of circulating cholesterol can be found in three major lipoprotein fractions: very low-density lipoproteins (VLDL), LDL and HDL. In some embodiments, total circulating cholesterol may be estimated with the formula [Total C] = [VLDL-C] + [LDL-C] + [HDL-C], Thus the LDL-C can be calculated from measured values of total cholesterol, triglycerides and HDL-C according to the relationship: [LDL-C] = [total C] - [HDL-C] - [TG] / 5, where [TG] / 5 is an estimate of VLDL-cholesterol. A reagent kit specific for triglycerides containing buffers, calibrators, blanks and controls may be used. As used herein, serum samples from the study may be analyzed and triglycerides may be measured using a series of coupled enzymatic reactions. In some embodiments, H2O2 may be used to quantify the analyte.as the end product of the last one and its absorbance at 500nm, and the color intensity is proportional to triglyceride concentrations.

[0165] In some embodiments, the guide polynucleotide is a guide RNA, wherein the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with 0, 1, or 2 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with no mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with 1 mismatch. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with 2 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with 3 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with 4 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the PCSK9 gene with 5 mismatches.

[0166] In some embodiments, the guide polynucleotide is a guide RNA, wherein the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with 0, 1, or 2 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with no mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with 1 mismatch. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with 2 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with 3 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with 4 mismatches. In some embodiments, the guide RNA comprises a spacer sequence that binds to the complementary strand of a protospacer sequence of the ANGPTL3 gene with 5 mismatches.

[0167] In some embodiments, the nucleobase alteration is outside of the protospacer sequence in less than 1% of whole liver cells in the subject as measured by net nucleobase editing. In some embodiments, the nucleobase alteration is outside of the protospacer sequence in less than 1% of hepatocytes in the subject as measured by net nucleobase editing. In some embodiments, the nucleobase alteration is only within the protospacer sequence as measured by net nucleobase editing.

[0168] In some embodiments, the nucleobase alteration is outside of the protospacer sequence in less than 0.01%. 0.02%, 0.03% 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 2.0%, 3.0% 4.0%, 5.0%, 6.0%, 7.0%, 8.0%, 9.0%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 65%, 80%, 85%, 90% of whole liver cells in the subject as measured by net nucleobase editing. In some embodiments, the nucleobase alteration is outside of the protospacer sequence in less than 0.01%. 0.02%, 0.03% 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 2.0%, 3.0% 4.0%, 5.0%, 6.0%, 7.0%, 8.0%, 9.0%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 65%, 80%, 85%, 90% of hepatocytes in the subject as measured by net nucleobase editing. In some embodiments, the nucleobase alteration is outside of the protospacer sequence in less than 0.01%. 0.02%, 0.03% 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 2.0%, 3.0% 4.0%, 5.0%, 6.0%, 7.0%, 8.0%, 9.0%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 65%, 80%, 85%, 90% of cells in the subject as measured by net nucleobase editing.

[0169] In some embodiments, the deaminase is an adenine deaminase. In some embodiments, the nucleobase alteration is a A»T to G»C alteration. In some embodiments, the deaminase is an adenine deaminase and the nucleobase alteration is a A»T to G»C alteration. In some embodiments, the programmable DNA binding domain comprises a nuclease inactive Cas9 or a Cas9 nickase. In some embodiments, the programmable DNA binding domain comprises a Cas9.

[0170] In some embodiments, the nucleobase alteration is at a splice site of the PCSK9 gene. In some embodiments, the nucleobase alteration is at a splice donor site of the PCSK9 gene. In some embodiments, the splice donor site is at 5’ end of PCSK9 intron 1 as referenced in SEQ ID NO: 5. In some embodiments, the nucleobase alteration is at a splice acceptor site of the PCSK9 gene. In some embodiments, the nucleobase alteration results in a frame shift, a premature stop codon, a insertion or deletion in a transcript encoded by the PCSK9 gene. In some embodiments, the nucleobase alteration results in an aberrant transcript encoded by the PCSK9 gene. In some embodiments, the guide polynucleotide is a guide RNA. In some embodiments, the guide RNA is chemically modified. In some embodiments, the guide RNA comprises a tracrRNA sequence. In some embodiments, the guide RNA comprises a chemical modification. Exemplary guide RNA comprising a chemical modification can be found in PCT Application Publication No. WO2021 / 207712, which is hereby incorporated by reference in its entirety.

[0171] In some embodiments, the nucleobase alteration is at a splice site of the ANGPTL3 gene. In some embodiments, the nucleobase alteration is at a splice donor site of the ANGPTL3 gene. In some embodiments, the splice donor site is at 5’ end of ANGPTL3 intron 6 as referenced in SEQ ID NO: 1. In some embodiments, the nucleobase alteration is at a splice acceptor site of the ANGPTL3 gene. In some embodiments, the nucleobase alteration results in a frame shift, a premature stop codon, an insertion or deletion in a transcript encoded by the ANGPTL3 gene. In some embodiments, the nucleobase alteration results in an aberrant transcript encoded by the ANGPTL3 gene. In some embodiments, the guide polynucleotide is a guide RNA. In some embodiments, the guide RNA is chemically modified. In some embodiments, the guide RNA comprises a tracrRNA sequence. In some embodiments, the guide RNA comprises a chemical modification. Exemplary guide RNA comprising a chemical modification can be found in PCT Application Publication No. WO2021 / 207712, which is hereby incorporated by reference in its entirety.

[0172] In some embodiments, the guide RNA comprises a guide RNA sequence. Exemplary additional guide RNA sequence can be found in PCT Application Publication No. WO2021 / 207712, which is hereby incorporated by reference in its entirety.

[0173] In some embodiments, the protospacer sequence comprises a protospacer sequence. In some embodiments, the protospacer comprises the sequence 5’-CCCGCACCTTGGCGCAGCGG-3’ (SEQ ID NO: 731), AAGATACCTGAATAACTCTC-3’ (SEQ ID NO: 732), and 5’- AAGATACCTGAATAACCCTC-3’ (SEQ ID NO: 733).

[0174] In some embodiments, the base editor fusion protein comprises the sequence of SEQ ID NO: 734. In some embodiments, the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 734 or to any of the adenosine deaminases provided herein. It should be appreciated that adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein). The disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein. In some embodiments, the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,21,22,21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to the amino acid sequence set forth in SEQ ID NO: 734 or any of the adenosine deaminases provided herein. In some embodiments, the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth in SEQ ID NO: 734 or any of the adenosine deaminases provided herein.

[0175] In some embodiments, the nucleic acid encoding the base editor fusion protein is a mRNA. The mRNA may comprise modifications, for example, modifications at 3’ or 5’ end of the mRNA. In some embodiments, the mRNA comprises a cap analog.

[0176] In some embodiments, the mRNA comprises at least 1, 2, or 3 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 1, 2, or 3 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 1 nucleotide at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 2 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 3 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 4 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 5 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 6 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 7 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 8 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 9 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof. In some embodiments, the mRNA comprises at least 10 nucleotides at the 5’ end that comprises 2’-hydroxyl group, 2’-O-methyl group, or additional 2’ chemical modification or a combination thereof.

[0177] In some embodiments, the mRNA comprises a poly A tail. The poly A tail may be at the 3 ’ end of the mRNA.

[0178] In some embodiments, the GC% content of the mRNA sequence is greater than or equal to 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% or 90%. In some embodiments, the GC% content of the mRNA sequence is greater than or equal to 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80%.

[0179] In some embodiments, the mRNA sequence comprises an adenine tTNA deaminase (TadA) region. In some embodiments, the GC% of the TadA region is greater than or equal to 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% or 90%. In some embodiments, the GC% content of the TadA region is greater than or equal to 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80%.

[0180] In some embodiments, the mRNA sequence comprises a Cas9 region. In some embodiments, the GC% of the Cas9 region is greater than or equal to 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% or 90%. In some embodiments, the GC% content of the Cas9 region is greater than or equal to 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80%.

[0181] In some embodiments, the mRNA sequence comprises a NLS region. In some embodiments, the GC% of the NLS region is greater than or equal to 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 767^, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% or 90%. In some embodiments, the GC% content of the NLS region is greater than or equal to 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80%.

[0182] In some embodiments, the mRNA sequence comprises a first linker region that connects the TadA region and the Cas9 region. In some embodiments, the GC% of the first linker region is greater than or equal to 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% or 90%. In some embodiments, the GC% content of the first linker region is greater than or equal to 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80%.

[0183] In some embodiments, the mRNA sequence comprises a second linker region that connects the Cas9 region and the NLS region. In some embodiments, the GC% of the second linker region is greater than or equal to 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% or 90%. In some embodiments, the GC% content of the second linker region is greater than or equal to 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% or 80%.

[0184] In some embodiments, the base editor system as provided herein further comprises a lipid nanoparticle (LNP) enclosing a guide polynucleotide or a nucleic acid encoding the guide polynucleotide (i). In some embodiments, the LNP further encloses a base editor fusion protein comprising a programmable DNA binding domain and a deaminase, or a nucleic acid encoding same (ii). In some embodiments, the base editor system further comprises a second LNP enclosing a base editor fusion protein comprising a programmable DNA binding domain and a deaminase, or a nucleic acid encoding same (ii).

[0185] A base editor system as provided herein can include one or more LNPs. For example, a base editor system may comprise a LNP enclosing both a guide polynucleotide and a nucleic acid encoding the base editor fusion protein, e.g. an mRNA encoding the base editor fusion protein. In another example, a base editor system may comprise a LNP enclosing a guide polynucleotide, e.g. a guide RNA, and a LNP enclosing a nucleic acid, e.g. an mRNA, encoding the base editor fusion protein. LNPs separately enclosing the guide polynucleotide and the base editor fusion protein or mRNA encoding the base editor fusion protein may allow for flexible dosing and administration of the base editor system. For example, a LNP enclosing a guide RNA can be administered first, followed by administration of a LNP enclosing a mRNA encoding the base editor fusion protein. In some embodiments, a LNP enclosing a guide RNA and a second LNP enclosing a mRNA encoding the base editor fusion protein are administered to a subject at the same time. In some embodiments, a LNP enclosing a guide RNA and a LNP enclosing a mRNA encoding the base editor protein are administered to a subject sequentially. In some embodiments, a LNP enclosing mRNA encoding the base editor fusion protein is administered to a subject, followed by multiple administration or doses of a second LNP enclosing a guide RNA after 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, or 12 weeks or more. The multiple doses of the second LNP may be administered with intervals of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 days or more.

[0186] In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1:10 to about 10: 1 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1:1, 1.5:1, 2:1, 3:1, 4:1, 1:1.5, 1:2, 1:3, 1:4 or any ratio between 4:1 or 1:4 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein can be determined by titration of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein.

[0187] In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 500:1 to about 1:500.

[0188] In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1000:1 to about 1:1000 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 65:1, 60:1, 55:1, 50:1, 45:1, 40:1, 35:1, 30:1, 25:1, 20:1, 19:1, 18:1, 17:1, 17:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2;1, 1.9:1, 1.8:1, 1.7:1, 1.6:1, 1.5:1, 1.4:1, 1.3:1, 1.2:1, 1.1:1, 1.0:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1:0.1, 1:0.2, 1:0.3, 1:0.4, 1:0.5, 1:0.6, 1:0.7, 1:0.8, 1:0.9, 1:1.0, 1:1.1, 1:1.2, 1:1.3, 1:1.4, 1:1.5, 1:1.6, 1:1.7, 1:1.8, 1:1.9, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:450, 1:500, 1:550, 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950, or 1:1000 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 65:1,60:1,55:1,50:1,45:1,40:1,35:1,30:1,25:1,20:1, 19:1, 18:1, 17:1, 17:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2;1, 1.9:1, 1.8:1, 1.7:1, 1.6:1, 1.5:1, 1.4:1, 1.3:1, 1.2:1, 1.1:1, 1.0:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1:0.1, 1:0.2, 1:0.3, 1:0.4, 1:0.5, 1:0.6, 1:0.7, 1:0.8, 1:0.9, 1:1.0, 1:1.1, 1:1.2, 1:1.3, 1:1.4, 1:1.5, 1:1.6, 1:1.7, 1:1.8, 1:1.9, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:450, 1:500, 1:550, 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950, or 1:1000 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 65:1, 60:1, 55:1, 50:1, 45:1, 40:1, 35:1, 30:1, 25:1, 20:1, 19:1, 18:1, 17:1, 17:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2;1, 1.9:1, 1.8:1, 1.7:1, 1.6:1, 1.5:1, 1.4:1, 1.3:1, 1.2:1, 1.1:1, 1.0:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1 by weight. In some embodiments, the ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 1:0.1, 1:0.2, 1:0.3, 1:0.4, 1:0.5, 1:0.6, 1:0.7, 1:0.8, 1:0.9, 1:1.0, 1:1.1, 1:1.2, 1:1.3, 1:1.4, 1:1.5, 1:1.6, 1:1.7, 1:1.8, 1:1.9, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:450, 1:500, 1:550, 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950, or 1:1000 by weight.

[0189] In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 10000:1 to about 1:10000. In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 10000:1, 9500:1, 9000:1, 8500:1, 8000:1, 7500:1, 7000:1, 6500:1, 6000:1, 5500:1, 5000:1, 4500:1, 4000:1, 3500:1, 3000:1, 2500:1, 2000:1, 1500:1, 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 190:1, 180:1, 170:1, 160:1, 150:1, 140:1, 130:1, 120:1, 110:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 69:1, 68:1, 67:1, 66:1, 65:1, 64:1, 63:1, 62:1, 61:1, 60:1, 59:1, 58:1, 57:1, 56:1, 55:1, 54:1, 53:1, 52:1, 51:1, 50:1, 49:1, 48:1, 47:1, 46:1, 45:1, 44:1, 43:1, 42:1, 41:1, 40:1, 39:1, 38:1, 37:1, 36:1, 35:1, 34:1, 33:1, 32:1, 31:1, 30:1, 29:1, 28:1, 27:1, 26:1, 25:1, 24:1, 23:1, 22:1, 21:1, 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1:1. In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1:10000, 1:9500, 1:9000, 1:8500, 1:8000, 1:7500, 1:7000, 1:6500, 1:6000, 1:5500, 1:5000, 1:4500, 1:4000, 1:3500, 1:3000, 1:2500, 1:2000, 1:1500, 1:1000, 1:950, 1:900, 1:850, 1:800, 1:750, 1:700, 1:650, 1:600, 1:550, 1:500, 1:450, 1:400, 1:350, 1:300, 1:250, 1:200, 1:190, 1:180, 1:170, 1:160, 1:150, 1:140, 1:130, 1:120, 1:110, 1:100, 1:95, 1:90, 1:85, 1:80, 1:75, 1:70, 1:69, 1:68, 1:67, 1:66, 1:65, 1:64, 1:63, 1:62, 1:61, 1:60, 1:59, 1:58, 1:57, 1:56, 1:55, 1:54, 1:53, 1:52, 1:51, 1:50, 1:49, 1:48, 1:47, 1:46, 1:45, 1:44, 1:43, 1:42, 1:41, 1:40, 1:39, 1:38, 1:37, 1:36, 1:35, 1:34, 1:33, 1:32, 1:31, 1:30, 1:29, 1:28, 1:27, 1:26, 1:25, 1:24, 1:23, 1:22, 1:21, 1:20, 1:19, 1:18, 1:17, 1:16, 1:15, 1:14, 1:13, 1:12, 1:11, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1. In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 10000:1, 9500:1, 9000:1, 8500:1, 8000:1, 7500:1, 7000:1, 6500:1, 6000:1, 5500:1, 5000:1, 4500:1, 4000:1, 3500:1, 3000:1, 2500:1, 2000:1, 1500:1, 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 190:1, 180:1, 170:1, 160:1, 150:1, 140:1, 130:1, 120:1, 110:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 69:1, 68:1, 67:1, 66:1, 65:1, 64:1, 63:1, 62:1, 61:1, 60:1, 59:1, 58:1, 57:1, 56:1, 55:1, 54:1, 53:1, 52:1, 51:1, 50:1, 49:1, 48:1, 47:1, 46:1, 45:1, 44:1, 43:1, 42:1, 41:1, 40:1, 39:1, 38:1, 37:1, 36:1, 35:1, 34:1, 33:1, 32:1, 31:1, 30:1, 29:1, 28:1, 27:1, 26:1, 25:1, 24:1, 23:1, 22:1, 21:1, 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1:1. In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1:10000, 1:9500, 1:9000, 1:8500, 1:8000, 1:7500, 1:7000, 1:6500, 1:6000, 1:5500, 1:5000, 1:4500, 1:4000, 1:3500, 1:3000, 1:2500, 1:2000, 1:1500, 1:1000, 1:950, 1:900, 1:850, 1:800, 1:750, 1:700, 1:650, 1:600, 1:550, 1:500, 1:450, 1:400, 1:350, 1:300, 1:250, 1:200, 1:190, 1:180, 1:170, 1:160, 1:150, 1:140, 1:130, 1:120, 1:110, 1:100, 1:95, 1:90, 1:85, 1:80, 1:75, 1:70, 1:69, 1:68, 1:67, 1:66, 1:65, 1:64, 1:63, 1:62, 1:61, 1:60, 1:59, 1:58, 1:57, 1:56, 1:55, 1:54, 1:53, 1:52, 1:51, 1:50, 1:49, 1:48, 1:47, 1:46, 1:45, 1:44, 1:43, 1:42, 1:41, 1:40, 1:39, 1:38, 1:37, 1:36, 1:35, 1:34, 1:33, 1:32, 1:31, 1:30, 1:29, 1:28, 1:27, 1:26, 1:25, 1:24, 1:23, 1:22, 1:21, 1:20, 1:19, 1:18, 1:17, 1:16, 1:15, 1:14, 1:13, 1:12, 1:11, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1. In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 10000:1, 9500:1, 9000:1, 8500:1, 8000:1, 7500:1, 7000:1, 6500:1, 6000:1, 5500:1, 5000:1, 4500:1, 4000:1, 3500:1, 3000:1, 2500:1, 2000:1, 1500:1, 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 190:1, 180:1, 170:1, 160:1, 150:1, 140:1, 130:1, 120:1, 110:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 69:1, 68:1, 67:1, 66:1, 65:1, 64:1, 63:1, 62:1, 61:1, 60:1, 59:1, 58:1, 57:1, 56:1, 55:1, 54:1, 53:1, 52:1, 51:1, 50:1, 49:1, 48:1, 47:1, 46:1, 45:1, 44:1, 43:1, 42:1, 41:1, 40:1, 39:1, 38:1, 37:1, 36:1, 35:1, 34:1, 33:1, 32:1, 31:1, 30:1, 29:1, 28:1, 27:1, 26:1, 25:1, 24:1, 23:1, 22:1, 21:1, 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1:1. In some embodiments, the molar ratio of the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 1:10000, 1:9500, 1:9000, 1:8500, 1:8000, 1:7500, 1:7000, 1:6500, 1:6000, 1:5500, 1:5000, 1:4500, 1:4000, 1:3500, 1:3000, 1:2500, 1:2000, 1:1500, 1:1000, 1:950, 1:900, 1:850, 1:800, 1:750, 1:700, 1:650, 1:600, 1:550, 1:500, 1:450, 1:400, 1:350, 1:300, 1:250, 1:200, 1:190, 1:180, 1:170, 1:160, 1:150, 1:140, 1:130, 1:120, 1:110, 1:100, 1:95, 1:90, 1:85, 1:80, 1:75, 1:70, 1:69, 1:68, 1:67, 1:66, 1:65, 1:64, 1:63, 1:62, 1:61, 1:60, 1:59, 1:58, 1:57, 1:56, 1:55, 1:54, 1:53, 1:52, 1:51, 1:50, 1:49, 1:48, 1:47, 1:46, 1:45, 1:44, 1:43, 1:42, 1:41, 1:40, 1:39, 1:38, 1:37, 1:36, 1:35, 1:34, 1:33, 1:32, 1:31, 1:30, 1:29, 1:28, 1:27, 1:26, 1:25, 1:24, 1:23, 1:22, 1:21, 1:20, 1:19, 1:18, 1:17, 1:16, 1:15, 1:14, 1:13, 1:12, 1:11, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1.

[0190] In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 10:1 to about 1:10 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 4:1, 3; 1, 2:1, 1.5:1, 1:1, 1:1.5, 1:2, 1:3, or 1:4 by weight. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 500:1 to about 1:500.

[0191] In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1000:1 to about 1:1000 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 65:1, 60:1, 55:1, 50:1, 45:1, 40:1, 35:1, 30:1, 25:1, 20:1, 19:1, 18:1, 17:1, 17:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2;1, 1.9:1, 1.8:1, 1.7:1, 1.6:1, 1.5:1, 1.4:1, 1.3:1, 1.2:1, 1.1:1, 1.0:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 1:0.1, 1:0.2, 1:0.3, 1:0.4, 1:0.5, 1:0.6, 1:0.7, 1:0.8, 1:0.9, 1:1.0, 1:1.1, 1:1.2, 1:1.3, 1:1.4, 1:1.5, 1:1.6, 1:1.7, 1:1.8, 1:1.9, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:450, 1:500, 1:550, 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950, or 1:1000 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 65:1,60:1,55:1,50:1,45:1,40:1,35:1,30:1,25:1,20:1, 19:1, 18:1, 17:1, 17:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2;1, 1.9:1, 1.8:1, 1.7:1, 1.6:1, 1.5:1, 1.4:1, 1.3:1, 1.2:1, 1.1:1, 1.0:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1:0.1, 1:0.2, 1:0.3, 1:0.4, 1:0.5, 1:0.6, 1:0.7, 1:0.8, 1:0.9, 1:1.0, 1:1.1, 1:1.2, 1:1.3, 1:1.4, 1:1.5, 1:1.6, 1:1.7, 1:1.8, 1:1.9, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:450, 1:500, 1:550, 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950, or 1:1000 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 65:1, 60:1, 55:1, 50:1, 45:1, 40:1, 35:1, 30:1, 25:1, 20:1, 19:1, 18:1, 17:1, 17:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2;1, 1.9:1, 1.8:1, 1.7:1, 1.6:1, 1.5:1, 1.4:1, 1.3:1, 1.2:1, 1.1:1, 1.0:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1 by weight. In some embodiments, the ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 1:0.1, 1:0.2, 1:0.3, 1:0.4, 1:0.5, 1:0.6, 1:0.7, 1:0.8, 1:0.9, 1:1.0, 1:1.1, 1:1.2, 1:1.3, 1:1.4, 1:1.5, 1:1.6, 1:1.7, 1:1.8, 1:1.9, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:450, 1:500, 1:550, 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950, or 1:1000 by weight.

[0192] In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 10000:1 to about 1:10000. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is about 10000:1, 9500:1, 9000:1, 8500:1, 8000:1, 7500:1, 7000:1, 6500:1, 6000:1, 5500:1, 5000:1, 4500:1, 4000:1, 3500:1, 3000:1, 2500:1, 2000:1, 1500:1, 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 190:1, 180:1, 170:1, 160:1, 150:1, 140:1, 130:1, 120:1, 110:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 69:1, 68:1, 67:1, 66:1, 65:1, 64:1, 63:1, 62:1, 61:1, 60:1, 59:1, 58:1, 57:1, 56:1, 55:1, 54:1, 53:1, 52:1, 51:1, 50:1, 49:1, 48:1, 47:1, 46:1, 45:1, 44:1, 43:1, 42:1, 41:1, 40:1, 39:1, 38:1, 37:1, 36:1, 35:1, 34:1, 33:1, 32:1, 31:1, 30:1, 29:1, 28:1, 27:1, 26:1, 25:1, 24:1, 23:1, 22:1, 21:1, 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1:1. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1:10000, 1:9500, 1:9000, 1:8500, 1:8000, 1:7500, 1:7000, 1:6500, 1:6000, 1:5500, 1:5000, 1:4500, 1:4000, 1:3500, 1:3000, 1:2500, 1:2000, 1:1500, 1:1000, 1:950, 1:900, 1:850, 1:800, 1:750, 1:700, 1:650, 1:600, 1:550, 1:500, 1:450, 1:400, 1:350, 1:300, 1:250, 1:200, 1:190, 1:180, 1:170, 1:160, 1:150, 1:140, 1:130, 1:120, 1:110, 1:100, 1:95, 1:90, 1:85, 1:80, 1:75, 1:70, 1:69, 1:68, 1:67, 1:66, 1:65, 1:64, 1:63, 1:62, 1:61, 1:60, 1:59, 1:58, 1:57, 1:56, 1:55, 1:54, 1:53, 1:52, 1:51, 1:50, 1:49, 1:48, 1:47, 1:46, 1:45, 1:44, 1:43, 1:42, 1:41, 1:40, 1:39, 1:38, 1:37, 1:36, 1:35, 1:34, 1:33, 1:32, 1:31, 1:30, 1:29, 1:28, 1:27, 1:26, 1:25, 1:24, 1:23, 1:22, 1:21, 1:20, 1:19, 1:18, 1:17, 1:16, 1:15, 1:14, 1:13, 1:12, 1:11, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 10000:1, 9500:1, 9000:1, 8500:1, 8000:1, 7500:1, 7000:1, 6500:1, 6000:1, 5500:1, 5000:1, 4500:1, 4000:1, 3500:1, 3000:1, 2500:1, 2000:1, 1500:1, 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 190:1, 180:1, 170:1, 160:1, 150:1, 140:1, 130:1, 120:1, 110:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 69:1, 68:1, 67:1, 66:1, 65:1, 64:1, 63:1, 62:1, 61:1, 60:1, 59:1, 58:1, 57:1, 56:1, 55:1, 54:1, 53:1, 52:1, 51:1, 50:1, 49:1, 48:1, 47:1, 46:1, 45:1, 44:1, 43:1, 42:1, 41:1, 40:1, 39:1, 38:1, 37:1, 36:1, 35:1, 34:1, 33:1, 32:1, 31:1, 30:1, 29:1, 28:1, 27:1, 26:1, 25:1, 24:1, 23:1, 22:1, 21:1, 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1:1. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at least about 1:10000, 1:9500, 1:9000, 1:8500, 1:8000, 1:7500, 1:7000, 1:6500, 1:6000, 1:5500, 1:5000, 1:4500, 1:4000, 1:3500, 1:3000, 1:2500, 1:2000, 1:1500, 1:1000, 1:950, 1:900, 1:850, 1:800, 1:750, 1:700, 1:650, 1:600, 1:550, 1:500, 1:450, 1:400, 1:350, 1:300, 1:250, 1:200, 1:190, 1:180, 1:170, 1:160, 1:150, 1:140, 1:130, 1:120, 1:110, 1:100, 1:95, 1:90, 1:85, 1:80, 1:75, 1:70, 1:69, 1:68, 1:67, 1:66, 1:65, 1:64, 1:63, 1:62, 1:61, 1:60, 1:59, 1:58, 1:57, 1:56, 1:55, 1:54, 1:53, 1:52, 1:51, 1:50, 1:49, 1:48, 1:47, 1:46, 1:45, 1:44, 1:43, 1:42, 1:41, 1:40, 1:39, 1:38, 1:37, 1:36, 1:35, 1:34, 1:33, 1:32, 1:31, 1:30, 1:29, 1:28, 1:27, 1:26, 1:25, 1:24, 1:23, 1:22, 1:21, 1:20, 1:19, 1:18, 1:17, 1:16, 1:15, 1:14, 1:13, 1:12, 1:11, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 10000:1, 9500:1, 9000:1, 8500:1, 8000:1, 7500:1, 7000:1, 6500:1, 6000:1, 5500:1, 5000:1, 4500:1, 4000:1, 3500:1, 3000:1, 2500:1, 2000:1, 1500:1, 1000:1, 950:1, 900:1, 850:1, 800:1, 750:1, 700:1, 650:1, 600:1, 550:1, 500:1, 450:1, 400:1, 350:1, 300:1, 250:1, 200:1, 190:1, 180:1, 170:1, 160:1, 150:1, 140:1, 130:1, 120:1, 110:1, 100:1, 95:1, 90:1, 85:1, 80:1, 75:1, 70:1, 69:1, 68:1, 67:1, 66:1, 65:1, 64:1, 63:1, 62:1, 61:1, 60:1, 59:1, 58:1, 57:1, 56:1, 55:1, 54:1, 53:1, 52:1, 51:1, 50:1, 49:1, 48:1, 47:1, 46:1, 45:1, 44:1, 43:1, 42:1, 41:1, 40:1, 39:1, 38:1, 37:1, 36:1, 35:1, 34:1, 33:1, 32:1, 31:1, 30:1, 29:1, 28:1, 27:1, 26:1, 25:1, 24:1, 23:1, 22:1, 21:1, 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 0.9:1, 0.8:1, 0.7:1, 0.6:1, 0.5:1, 0.4:1, 0.3:1, 0.2:1, or 0.1:1. In some embodiments, the molar ratio of a nucleic acid encoding the guide polynucleotide and the nucleic acid encoding the base editor fusion protein is at most about 1:10000, 1:9500, 1:9000, 1:8500, 1:8000, 1:7500, 1:7000, 1:6500, 1:6000, 1:5500, 1:5000, 1:4500, 1:4000, 1:3500, 1:3000, 1:2500, 1:2000, 1:1500, 1:1000, 1:950, 1:900, 1:850, 1:800, 1:750, 1:700, 1:650, 1:600, 1:550, 1:500, 1:450, 1:400, 1:350, 1:300, 1:250, 1:200, 1:190, 1:180, 1:170, 1:160, 1:150, 1:140, 1:130, 1:120, 1:110, 1:100, 1:95, 1:90, 1:85, 1:80, 1:75, 1:70, 1:69, 1:68, 1:67, 1:66, 1:65, 1:64, 1:63, 1:62, 1:61, 1:60, 1:59, 1:58, 1:57, 1:56, 1:55, 1:54, 1:53, 1:52, 1:51, 1:50, 1:49, 1:48, 1:47, 1:46, 1:45, 1:44, 1:43, 1:42, 1:41, 1:40, 1:39, 1:38, 1:37, 1:36, 1:35, 1:34, 1:33, 1:32, 1:31, 1:30, 1:29, 1:28, 1:27, 1:26, 1:25, 1:24, 1:23, 1:22, 1:21, 1:20, 1:19, 1:18, 1:17, 1:16, 1:15, 1:14, 1:13, 1:12, 1:11, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1.

[0193] Precision genome editing is a growing field with industrial, agricultural, and biomedical applications. One of the dominant genome-editing systems available today is clustered regularly interspaced short palindromic repeats (CRISPR)-CRISPR associated 9 (Cas9). Through the use of a guide RNA (gRNA) with a sequence homologous to that of a sequence of DNA in the target genome (known as the protospacer) adjacent to a specific protospacer-adjacent motif (PAM) comprising the sequence NGG (N is any standard base) in the DNA, Cas9 can be used to create a double-strand break (DSB) at the targeted sequence. Non-homologous end joining (NHEJ) at DSBs can be used to create indels and knock out genes at genetic loci; likewise, homology-directed repair (HDR) can be used, with an introduced template DNA, to insert genes or modify the targeted sequence. A variety of Cas9-based tools have been developed in recent years, including tools that methylate DNA, recognize broader sequence space, or create single-strand nicks. In 2016, Komor et al. described the use of CRISPR-Cas9 to convert a cytosine base to a thymine base without the introduction of a template DNA strand and without the need for DSBs (Komor AC, Kim YB, Packer MS, et al. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature, 2016, 533: 420-4, incorporated herein by reference in its entirety). After the cytidine deaminase domain of rat APOBEC 1 was fused to the N-terminus of catalytically-dead Cas9 (dCas9) using the linker XTEN (resulting in a fusion protein called base editor 1, or BE1), conversion of cytosine to uracil was observed between position 4 and position 8 within the 20-nt protospacer region of DNA (or, to express it a different way, 13 to 17 nucleotides upstream of the PAM). Of note, any cytosine base within this “window” was amenable to editing, resulting in varied outcomes depending on how many and which cytosines were edited. After DNA replication or repair, each uracil was replaced by a thymine, completing the C to T base editing. 3 The next version of base editor (BE2) incorporated a uracil glycosylase inhibitor fused to the C-terminus of dCas9 to help inhibit base excision repair of the uracil bases resulting from the cytidine deaminase activity (which otherwise would act to restore the original cytosine bases); this improved the efficiency of C to T base editing. The final version, BE3, used a Cas9 nickase rather than dCas9; the nickase cut the unedited strand opposite the edited C to T bases, stimulating the removal of the opposing guanidine through eukaryotic mismatch repair. BE2 and BE3 base editing was observed in both human and murine cell lines. The specificity of base editing has been further improved through the addition of mutations to the Cas9 nickase; in similar fashion, Cas9 has been mutated to narrow the width of the editing window from approximately 5 nucleotides to as little as 1-2 nucleotides (Rees HA, Komor AC, Yeh WH, et al. Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery. Nat Commun, 2017, 8: 15790, Kim YB, Komor AC, Levy JM, et al. Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions. Nat Biotechnol, 2017, 35: 371-6, each of which is incorporated herein by reference in its entirety).

[0194] An alternative cytosine base editing platform is by linking the activation-induced cytosine deaminase domain PmCDAl to dCas9 (Target-AID), they were able to demonstrate targeted C to T base editing in yeast. Furthermore, an alternative C to T editing strategy was also demonstrated without fusing a deaminase domain to Cas9; instead, a SH3 (Src 3 homology) domain was added to the C-terminus of dCas9 while a SHL (SH3 interaction ligand) was added to PmCDAl.6 Optimization of efficiency was achieved through the use of a Cas9 nickase rather than dCas9. Further, an uracil DNA glycosylase inhibitor was added to enhance base editing in the mammalian CHO cell line. The resulting platform was able to consistently edit bases within 3 to 5 bases of the 18th nucleotide upstream of the PAM sequence (Nishida K et al., Science, 2016, 353: aaf8729).

[0195] A distinct cytosine base editing platform used Cpfl (also known as Casl2a) instead of Cas9 as the RNA-guided endonuclease. Catalytically-inactive Cpfl was fused to APOBEC 1 (dLbCpfl-BEO), leading to C to T conversion in a human cell line. While the Cas9 base editor variants BE3 and Target-AID recognize the PAM sequence NGG, dLbCpfl-BEO recognizes the T-rich PAM sequence TTTV. Although base editing was observed between positions 8 and 13 of the protospacer sequence with dLbCpfl-BEO, the introduction of additional mutations into Cpfl was able to reduce the window to positions 10 to 12. However, narrowing of the base editing window correlated with a decrease in editing efficiency (Li X et al., Nat Biotechnol, 2018, 36: 324-7).

[0196] Cytosine base editing is not wholly predictable; indels can occur at the target site, albeit at lower frequencies that those observed for C to T editing editors. Furthermore, cytosine base editors can occasionally cause C to A or C to G edits rather than the expected C to T edits. Adding linker lengths between Cas9 nickase and the rat APOBEC 1 cytosine deaminase domain from 16 amino acids to 32 amino acids, the linker between the Cas9 nickase and the uracil glycosylase inhibitor from 4 amino acids to 9 amino acids, and using a second uracil glycosylase inhibitor was appended to the C-terminus of the new cytosine base editor using another 9 amino acid linker improved cytosine base editor termed “BE4” (Komor AC et al., Sci Adv, 2017, 3: eaao4774).

[0197] By fusing Escherichia coli adenine tTNA deaminase TadA (ecTadA) to dCas9 and mutagenesis of the ecTadA domain in conjunction with selection for editing activity revealed that Al 06V and D108N mutations yielded a base editor capable of editing adenine to guanine in DNA, termed ABE7.10 (Gaudelli NM et al., Nature, 2017, 551: 464-71). Koblan et al. improved the efficiency of ABE7.10 through modification of nuclear localization signals and codon optimization, yielding a version called AB Emax; a similar approach improved the efficiency of the cytosine base editor BE4.10 Huang et al. performed further development of both adenine and cytosine base editors to use alternative PAMs and to expand their editing windows, thereby increasing their targeting range (Koblan LW et al., Nat Biotechnol, 2018, 36: 843-6). The same has proven to be true of base editors, 12-14 although comparisons of Cas9, cytosine base editors, and adenine base editors using the same gRNAs have shown distinct off-target profiles.

[0198] The same has proven to be true of base editors, although comparisons of Cas9, cytosine base editors, and adenine base editors using the same gRNAs have shown distinct off-target profiles.

[0199] A variety of studies have raised concern about gRNA-independent off-target base editing, caused by the deaminase domain acting in isolation (without the need for engagement of DNA by the Cas9-gRNA complex). Additional studies showed that the gRNA-independent off-target effects of base editors are not limited to DNA. RNA sequencing of cells treated with either cytosine base editors or adenine base editors revealed transcriptome-wide off-target editing of RNA, and that introduction of amino acid substitution in the deaminase domain of adenine base (e.g. R106W) editors reduced off-target editing of RNA without substantially reducing on-target DNA base-editing efficiency. Zuo E, Sun Y, Wei W, et al. Cytosine base editor generates substantial off-target single-nucleotide variants in mouse embryos. Science, 2019, 364: 289-92; Jin S, Zong Y, Gao Q, et al. Cytosine, but not adenine, base editors induce genome-wide off-target mutations in rice. Science, 2019, 364: 292-5; Grunewald J, Zhou R, Garcia SP, et al. Transcriptome-wide off-target RNA editing induced by CRISPR-guided DNA base editors. Nature, 2019, 569: 433-7; Grunewald J, Zhou R, Iyer S, et al. CRISPR DNA base editors with reduced RNA off-target and self-editing activities. Nat Biotechnol, 2019, 37: 1041-8; Zhou C, Sun Y, Yan R, et al. Off-target RNA mutation induced by DNA base editing and its elimination by mutagenesis. Nature, 2019, 571: 275-8; Rees HA, Wilson C, Doman JL, et al. Analysis and minimization of cellular RNA editing by DNA adenine base editors. Sci Adv, 2019, 5: eaax5717, each of which is incorporated herein by reference in its entirety).

[0200] Correction of disease-causing mutations via precision editing with standard Cas9 genome editing has largely required HDR. Since HDR is limited to cells in S or G2 phase of mitosis, precision editing of non-mitotic cells is difficult. However, base editors are not reliant on HDR; the editing of postmitotic cochlear cells in mice is feasible with cytosine base editor BE3. By injecting BE3 and a gRNA in the form of a preassembled ribonucleoprotein via cationic liposomes, serine-33 in beta-catenin was edited to phenylalanine (TCT codon edited to TTT), allowing for the transdifferentiation of supporting cells into hair cells. Base editing of cochlear tissue was confirmed via sequencing, showing an editing rate between 0.7% and 3.0% depending on the region of the cochlea. In contrast, standard Cas9 editing via HDR showed negligible signs of efficacy in cochlear cells. A variant of SaBE3, delivered into the liver via adeno-associated viral (AAV) vectors, was reported to directly correct a pathogenic T to C mutation in the Pah gene with an editing rate as high as 29% and thereby treat the disease phenylketonuria in adult mice. Adenine base editing has also been demonstrated to generate mutations in mice. Yeh WH, Chiang H, Rees HA, et al. In vivo base editing of post-mitotic sensory cells. Nat Commun, 2018, 9: 2184; Villiger L, Grisch-Chan HM, Lindsay H, et al. Treatment of a metabolic liver disease by in vivo genome base editing in adult mice. Nat Med, 2018, 24: 1519-25; Ryu SM, Koo T, Kim K, et al. Adenine base editing in mouse embryos and an adult mouse model of Duchenne muscular dystrophy. Nat Biotechnol, 2018, 36: 536-9; Song CQ, Jiang T, Richter M, et al. Adenine base editing in an adult mouse model of tyrosinaemia. Nat Biomed Eng, 2020, 4: 12530; Pisciotta L, Favari E, Magnolo L, et al. Characterization of three kindreds with familial combined hypolipidemia caused by loss-of-function mutations of ANGPTL3. Circ Cardiovasc Genet, 2012, 5: 42-50. each of which is incorporated herein by reference in its entirety.

[0201] Provided herein are compositions of nucleobase editor systems that comprises nucleobase editor proteins, complexes, or compounds that is capable of making a modification or conversion to a nucleobase (e.g., A, T, C, G, or U) within a target nucleotide sequence.

[0202] A nucleobase editor or a base editor (BE) refers to an agent comprising a polypeptide that is capable of making a modification to a base (e.g., A, T, C, G, or U) within a nucleic acid sequence (e.g., DNA or RNA). In some embodiments, the base editor is capable of deaminating a base within a nucleic acid. In some embodiments, the base editor is capable of deaminating a base within a DNA molecule. In some embodiments, the base editor is capable of deaminating an adenine (A) in DNA.

[0203] In some embodiments, the base editor comprises a fusion protein comprising a programmable DNA binding protein fused to an adenosine deaminase. In some embodiments, the base editor comprises a fusion protein comprising a Cas9 protein and an adenosine deaminase. In some embodiments, the base editor is a Cas9 nickase (nCas9) fused to an adenosine deaminase. In some embodiments, the base editor is a nuclease-inactive Cas9 (dCas9) fused to an adenosine deaminase. In some embodiments, the base editor comprises a fusion protein comprising a programmable DNA binding protein fused to an cytidine deaminase. In some embodiments, the base editor comprises a fusion protein comprising a Cas9 protein and an cytidine deaminase. In some embodiments, the base editor is a Cas9 nickase (nCas9) fused to an cytidine deaminase. In some embodiments, the base editor is a nuclease-inactive Cas9 (dCas9) fused to an cytidine deaminase. In some embodiments, the base editor further comprises, an inhibitor of base excision repair, for example, a UGI domain. In some embodiments, the fusion protein comprises a Cas9 nickase fused to a deaminase and an inhibitor of base excision repair, such as a UGI or dISN domain. In some embodiments, the dCas9 domain of the fusion protein comprises a D10A and a H840A mutation as numbered in the wild type SpCas9 amino acid sequence. In some embodiments, the UGI comprises the following amino acid sequence:

[0204] >splP14739IUNGI_BPPB2 Uracil-DNA glycosylase inhibitor MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLT S D APE YKPW ALVIQDS NGENKIKML (SEQ ID NO: 735).

[0205] In some embodiments, a base editor system provided herein comprises a base editor fusion protein. For example, a base editor fusion protein may comprise a programmable DNA binding protein and a deaminase, e.g. an adenosine deaminase. In some embodiments, any of the fusion proteins provided herein are base editors. In some embodiments, the programmable DNA binding protein is a Cas9 domain, a Cpfl domain, a CasX domain, a CasY domain, a Cas 12b domain, a C2c2 domain, aC2c3 domain, or an Argonaute domain. In some embodiments, the programmable DNA binding protein is a Cas9 domain. The Cas9 domain may be any of the Cas9 domains or Cas9 proteins (e.g., nuclease inactive Cas9 or Cas9 nickase, or a Cas9 variant from any species) provided herein. In some embodiments, any of the Cas9 domains or Cas9 proteins provided herein may be fused with any of the deaminases provided herein. In some embodiments, the base editor comprises a deaminase, e.g., an adenosine deaminase and a programmable DNA binding protein, e.g., a Cas9 domain joined via a linker. In some embodiments, the base editor comprises a fusion protein comprising a deaminase, e.g., an adenosine deaminase and a programmable DNA binding protein, e.g., a Cas9 domain joined via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, a linker is present between the deaminase domain and the Cas9 domain. In some embodiments, a deaminase and a programmable DNA binding domain are fused via any of the peptide linkers provided herein. For example, an adenosine deaminase and a Cas9 domain may be fused via a linker that comprises between 1 and 200 amino acids. In some embodiments, the adenosine deaminase and the programmable DNA binding protein are fused via a linker that comprises from 1 to 5, 1 to 10, 1 to 20, 1 to 30, 1 to 40, 1 to 50, 1 to 60, 1 to 80, 1 to 100, 1 to 150, 1 to 200, 5 to 10, 5 to 20, 5 to 30, 5 to 40, 5 to 60, 5 to 80, 5 to 100, 5 to 150, 5 to 200, 10 to 20, 10 to 30, 10 to 40, 10 to 50, 10 to 60, 10 to 80, 10 to 100, 10 to 150, 10 to 200, 20 to 30, 20 to 40, 20 to 50, 20 to 60, 20 to 80, 20 to 100, 20 to 150, 20 to 200, 30 to 40, 30 to 50, 30 to 60, 30 to 80, 30 to 100, 30 to 150, 30 to 200, 40 to 50, 40 to 60, 40 to 80, 40 to 100, 40 to 150, 40 to 200, 50 to 60 50 to 80, 50 to 100, 50 to 150, 50 to 200, 60 to 80, 60 to 100, 60 to 150, 60 to 200, 80 to 100, 80 to 150, 80 to 200, 100 to 150, 100 to 200, or 150 to 200 amino acids in length. In some embodiments, the adenosine deaminase and the programmable DNA binding protein are fused via a linker that comprises 4, 16, 32, or 104 amino acids in length. In some embodiments, the adenosine deaminase and the programmable DNA binding protein are fused via a linker that comprises the amino acid sequence of SGSETPGTSESATPES (SEQ ID NO: 736), SGGS (SEQ ID NO: 737), SGGSSGSETPGTSESATPESSGGS (SEQ ID NO: 738), SGGSSGGSSGSETPGTSESATPESSGGSSGGS (SEQ ID NO: 739), or GGSGGSPGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTE PSEGSAPGTSTEPSEGSAPGTSESATPESGPGSEPATSGGSGGS (SEQ ID NO: 740). In some embodiments, the adenosine deaminase and the programmable DNA binding protein are fused via a linker comprising the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 736), which may also be referred to as the XTEN linker. In some embodiments, the linker is 24 amino acids in length. In some embodiments, the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPES (SEQ ID NO: 741). In some embodiments, the linker is 40 amino acids in length. In some embodiments, the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSSGGSSGGS (SEQ ID NO: 742). In some embodiments, the linker is 64 amino acids in length. In some embodiments, the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSSGGSSGGSSGSETPGTSESATPESSGGSSG GS (SEQ ID NO: 743). In some embodiments, the linker is 92 amino acids in length. In some embodiments, the linker comprises the amino acid sequence PGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTEPSEGSAP GTSTEPSEGSAPGTSESATPESGPGSEPATS (SEQ ID NO: 744).

[0206] In some embodiments, a base editor system provided herein comprises a base editor comprising a fusion protein comprising an inhibitor of base repair. In some embodiments, a base editor comprises a fusion protein comprising a cytidine deaminase and a programmable DNA binding domain, e.g. a Cas9 domain. In some embodiments, a base editor comprises a fusion protein comprising an adenosine deaminase and a programmable DNA binding domain, e.g. a Cas9 domain. In some embodiments, the base editor or the fusion protein further comprises an inhibitor of base repair (IBR). In some embodiments, the IBR comprises an inhibitor of inosine base repair. In some embodiments, the IBR is an inhibitor of inosine base excision repair. In some embodiments, the inhibitor of inosine base excision repair is a catalytically inactive inosine specific nuclease (dISN). In some embodiments, a dISN may inhibit (e.g., by steric hindrance) inosine removing enzymes from excising the inosine residue from DNA. For example, catalytically dead inosine glycosylases (e.g., alkyl adenine glycosylase [AAG]) will bind inosine but will not create an abasic site or remove the inosine, thereby sterically blocking the newly-formed inosine moiety from potential DNA damage / repair mechanisms. Thus, this disclosure contemplates a fusion protein comprising a programmable DNA binding protein and an adenosine deaminase further fused to a dISN. This disclosure contemplates a fusion protein comprising any Cas9 domain, for example, a Cas9 nickase (nCas9) domain, a catalytically inactive Cas9 (dCas9) domain, a high fidelity Cas9 domain, or a Cas9 domain with reduced PAM exclusivity. It should be understood that the use of a dISN may increase the editing efficiency of a adenosine deaminase that is capable of catalyzing a A to I change. For example, fusion proteins comprising a dISN domain may be more efficient in deaminating A residues.

[0207] In some embodiments, the base editors provided herein comprise fusion proteins that further comprise one or more nuclear targeting sequences, for example, a nuclear localization sequence (NLS). In some embodiments, the fusion protein comprises multiple NLSs. In some embodiments, the fusion protein comprises a NLS at the N-terminus and the C-terminus of the fusion protein. In some embodiments, a NLS comprises an amino acid sequence that facilitates the importation of a protein, that comprises an NLS, into the cell nucleus. In some embodiments, the NLS is fused to the N-terminus of the fusion protein. In some embodiments, the NLS is fused to the C- terminus of the fusion protein. In some embodiments, the NLS is fused to the N-terminus of the programmable DNA binding protein, e.g. the Cas9. In some embodiments, the NLS is fused to the C-terminus of the programmable DNA binding protein. In some embodiments, the NLS is fused to the N-terminus of the adenosine deaminase. In some embodiments, the NLS is fused to the C-terminus of the adenosine deaminase. In some embodiments, the NLS is fused to the fusion protein via one or more linkers. In some embodiments, the NLS is fused to the fusion protein without a linker. In some embodiments, the NLS comprises an amino acid sequence of any one of the NLS sequences provided or referenced herein. In some embodiments, a NLS comprises the amino acid sequence PKKKRKV (SEQ ID NO: 745) or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC (SEQ ID NO: 746). Additional nuclear localization sequences are known in the art and would be apparent to the skilled artisan. For example, NLS sequences are described in Plank et ah , PCT / EP2000 / 011690, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences.

[0208] In some embodiments, the fusion proteins provided herein do not comprise a linker. In some embodiments, a linker is present between one or more of the domains or proteins (e.g., adenosine deaminase, napDNAbp, NLS, and / or IBR). In some embodiments, the used in the general architecture above indicates the presence of an optional linker.

[0209] Some aspects of the disclosure provide base editors or fusion proteins that comprise a programmable DNA binding protein and at least two adenosine deaminase domains. Without wishing to be bound by any particular theory, dimerization of adenosine deaminases (e.g., in cis or in trans) may improve the ability (e g., efficiency) of the fusion protein to modify a nucleic acid base, for example to deaminate adenine. In some embodiments, any of the fusion proteins may comprise 2, 3, 4 or 5 adenosine deaminase domains. In some embodiments, any of the fusion proteins provided herein comprise two adenosine deaminases. In some embodiments, any of the fusion proteins provided herein contain only two adenosine deaminases. In some embodiments, the adenosine deaminases are the same. In some embodiments, the adenosine deaminases are any of the adenosine deaminases provided herein. In some embodiments, the adenosine deaminases are different. In some embodiments, the first adenosine deaminase is any of the adenosine deaminases provided herein, and the second adenosine is any of the adenosine deaminases provided herein, but is not identical to the first adenosine deaminase. In some embodiments, the first adenosine deaminase comprises any one of the mutations provided herein as numbered in SEQ ID NO: 747. In some embodiments, the second adenosine deaminase comprises any one of the mutations provided herein as numbered in SEQ ID NO: 747. In some embodiments, the first adenosine deaminase comprises any one of the mutations provided herein as numbered in SEQ ID NO: 747, and the second adenosine deaminase comprises a wild type adenosine deaminase sequence. In some embodiments, the second adenosine deaminase comprises any one of the mutations provided herein as numbered in SEQ ID NO: 747, and the first adenosine deaminase comprises a wild type adenosine deaminase sequence. As one example, the fusion protein may comprise a first adenosine deaminase and a second adenosine deaminase that both comprise a A106V, D108N, D147Y, and E155V mutation from ecTadA (SEQ ID NO: 747). As another example, the fusion protein may comprise a first adenosine deaminase domain that comprises a A106V, D108N, D147Y, and E155V mutation from ecTadA (SEQ ID NO: 747), and a second adenosine deaminase that comprises a L84F, A106V, D108N, H123Y, D147Y, E155V, and I156F mutation from ecTadA (SEQ ID NO: 747).

[0210] In some embodiments, the adenosine deaminase comprises the amino acid sequence: MSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAH AEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAG SLMDVLHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD (SEQ ID NO: 747).

[0211] In some embodiments, the fusion protein comprises two adenosine deaminases (e.g., a first adenosine deaminase and a second adenosine deaminase). In some embodiments, the first adenosine deaminase is N-terminal to the second adenosine deaminase in the fusion protein. In some embodiments, the first adenosine deaminase is C-terminal to the second adenosine deaminase in the fusion protein. In some embodiments, the first adenosine deaminase and the second deaminase are fused directly or via a linker. In some embodiments, the linker is any of the linkers provided herein, for example, any of the linkers described in the "Linkers" section. In some embodiments, the first adenosine deaminase is the same as the second adenosine deaminase. In some embodiments, the first adenosine deaminase and the second adenosine deaminase are any of the adenosine deaminases described herein. In some embodiments, the first adenosine deaminase and the second adenosine deaminase are different. In some embodiments, the first adenosine deaminase is any of the adenosine deaminases provided herein. In some embodiments, the second adenosine deaminase is any of the adenosine deaminases provided herein but is not identical to the first adenosine deaminase. In some embodiments, the first adenosine deaminase is an ecTadA adenosine deaminase. In some embodiments, the first adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence set forth SEQ ID NO: 747 or to any of the adenosine deaminases provided herein. In some embodiments, the second adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence set forth SEQ ID NO: 747 or to any of the adenosine deaminases provided herein. In some embodiments, the second adenosine deaminase comprises the amino acid sequence of SEQ ID NO: 747.

[0212] In some embodiments, the fusion proteins provided herein do not comprise a linker. In some embodiments, a linker is present between one or more of the domains or proteins (e.g., first adenosine deaminase, second adenosine deaminase, programmable DNA binding protein, and / or NLS).

[0213] It should be appreciated that the fusion proteins of the present disclosure may comprise one or more additional features. For example, in some embodiments, the fusion protein may comprise cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins. Suitable protein tags provided herein include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags , biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art. In some embodiments, the fusion protein comprises one or more His tags.

[0214] In some embodiments, the fusion protein comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the amino acid sequences listed in Table 4. In some embodiments, the fusion protein comprises any one of the amino acid sequences listed in Table 4. In some embodiments, the sequence of the fusion protein is any one of the amino acid sequences listed in Table 4. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the amino acid sequences of SEQ ID NOs: 688, 691, 695, 702, 705, and 707. In some embodiments, the fusion protein comprises any one of the amino acid sequences of SEQ ID NOs: 688, 691, 695, 702, 705, and 707. In some embodiments, the sequence of the fusion protein is any one of the amino acid sequences of SEQ ID NOs: 688 and 702.

[0215] In some embodiments, the fusion protein is encoded by the polynucleotide sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences listed in Table 4. In some embodiments, the fusion protein is encoded by any one of the polynucleotide sequences listed in Table 23. In some embodiments, the fusion protein is expressed by the polynucleotide sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences listed in Table 4. In some embodiments, the fusion protein is expressed by any one of the polynucleotide sequences listed in Table 4. In some embodiments, the fusion protein is encoded by the polynucleotide sequence that comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, and 706. In some embodiments, the fusion protein is encoded by the polynucleotide sequence that comprises any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, and 706. In some embodiments, the fusion protein is encoded by any one of the polynucleotide sequences of SEQ ID NOs: 687 and 701. In some embodiments, the fusion protein is expressed by the polynucleotide sequence that comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, and 706, or a combination thereof. In some embodiments, the fusion protein is encoded by the polynucleotide sequence that comprises any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, and 706, or a combination thereof. In some embodiments, the fusion protein is expressed by any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, and 706. In some embodiments, the polynucleotide sequence further comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences of SEQ ID NOs: 687 and 701.

[0216] In some embodiments, the nucleobase editor ABE8.8 comprises a fusion protein comprising the sequence as provided below: MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPTAH AEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRVVFGVRNAKTGAAG SLMDVLHHPGMNHRVEITEGILADECAALLCRFFRMPRRVFNAQKKAQSSTDSGGSSGG SSGSETPGTSESATPESSGGSSGGSDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGN TDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSF FHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLA LAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLS KSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDN LLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKA LVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNRED LLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGN SRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYF TVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDS VEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTY AHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIH DDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPE NIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQ NGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVV KKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQIL DSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVV GTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLA NGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPK RNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERS SFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNEL ALPSKY VNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLS AYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSIT GLYETRIDLSQLGGD (SEQ ID NO: 734).

[0217] Amino acid and nucleotide changes of MA040, MA041, and MA045 compared to MA004: MA004 has codon CGG at nCas9 amino acid position 691 and codon GAC at amino acid position 1135. MA040 has a DI 135E nCas9 amino acid mutation; codon 1135 is changed to GAG. MA041 has R691A and DI 135E nCas9 amino acid mutations; codon 691 is changed to GCC and co-don 1135 is changed to GAG. MA045 has a R691A nCas9 amino acid mutation; codon 691 is changed to GCC.

[0218] Additional adenosine deaminase mutations and variants are described in Patent Application WO2018119354, which is incorporated herein by reference in its entirety.

[0219] Additional adenosine deaminases useful in the present application would be apparent to the skilled artisan and are within the scope of this disclosure. For example, the adenosine deaminase may be a homolog of an AD AT. Exemplary AD AT homologs include, without limitation:

[0220] Staphylococcus aureus TadA: MGSHMTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAH AEHIAIER A AI< VLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCS GS LMNLLQQS NFNHRAIVDKG VLKE AC S TLLTTFFKNLRANKKS TN (SEQ ID NO: 748)

[0221] Bacillus subtilis TadA: MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRETEQRSIAHAEML VIDE AC KALGT WRLEG ATLY VTLEPCPMC AG A V VLS R VEK V VFG AFDPKGGC S GTLMN LLQEERFNHQ AE V VS G VLEEEC GGMLS AFFRELRI<I<I<I< A ARKNLS E (SEQ ID NO: 749)

[0222] Salmonella typhimurium (S. typhimurium) TadA: MPPAFITGVTSLSDVELDHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEG WNRPIGRHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCAGAMVHSRIG RVVFGARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLLSDFFRMRRQEIK ALKKADRAEGAGPAV (SEQ ID NO: 750)

[0223] Shewanella putrefaciens (S. putrefaciens) TadA: MDEYWMQVAMQMAEKAEAAGEVPVGAVLVKDGQQIATGYNLSISQHDPTAHAEILCL RSAGKKLENYRLLDATLYITLEPCAMCAGAMVHSRIARVVYGARDEKTGAAGTVVNLL QHPAFNHQVEVTSGVLAEACSAQLSRFFKRRRDEKKALKLAQRAQQGIE (SEQ ID NO: 751)

[0224] Haemophilus influenzae F3031 (H. influenzae) TadA: MDAAKVRSEFDEKMMRYALELADKAEALGEIPVGAVLVDDARNIIGEGWNLSIVQSDP TAHAEIIALRNGAKNIQNYRLLNSTLYVTLEPCTMCAGAILHSRIKRLVFGASDYKTGAI GSRFHFFDDYKMNHTLEITSGVLAEECSQKLSTFFQKRREEKKIEKALLKSLSDK (SEQ ID NO: 752)

[0225] Caulobacter crescentus (C. crescentus) TadA: MRTDESEDQDHRMMRLALDAARAAAEAGETPVGAVILDPSTGEVIATAGNGPIAAHDP TAHAEIAAMRAAAAKLGNYRLTDLTLVVTLEPCAMCAGAISHARIGRVVFGADDPKGG AVVHGPKFFAQPTCHWRPEVTGGVLADESADLLRGFFRARRKAKI (SEQ ID NO: 753)

[0226] Geobacter sulfurreducens (G. sulfurreducens) TadA: MSSLKKTPIRDDAYWMGKAIREAAKAAARDEVPIGAVIVRDGAVIGRGHNLREGSNDPS AHAEMIAIRQAARRSANWRLTGATLYVTLEPCLMCMGAIILARLERVVFGCYDPKGGA AGSLYDLSADPRLNHQVRLSPGVCQEECGTMLSDFFRDLRRRKKAKATPALF IDERKVPPEP (SEQ ID NO: 754)

[0227] In other aspects, the disclosure provides base-editing systems and methods for editing a polynucleotide. For example, provided herein are genome / base-editing systems and methods for editing a polynucleotide encoding ANGPTL3 and variants thereof. To edit a target gene, a target gene polynucleotide may contact the systems disclosed herein comprising a sgRDNA and a adenosine base editor protein, wherein the sgRDNA comprises a spacer sequence as disclosed herein and a tracrRNA sequence, wherein the spacer sequence hybridizes with a target polynucleotide sequence in a ANGPTL3 gene and the tracrRNA sequence binds the adenosine base editor protein (e.g. a Cas9 component of the adenosine base editor). The sgRDNA therefore can direct the base editor protein to the target polynucleotide sequence to result in a to G modification in the target gene. The target gene or target polynucleotide can be a gene encoding ANGPTL3. The target polynucleotide sequence can be in an ANGPTL3 gene. The modification can reduce or abolish expression of functional ANGPTL3 protein encoded by the ANGPTL3 gene in the cell. The introduction can be performed via a lipid nanoparticle that comprises the composition.

[0228] For example, the sgRDNA and the Adenosine base editor protein may be expressed in a cell where a target gene editing is desired (e.g., a liver cell), to thereby allowing contact of the target gene with the composition disclosed herein (e.g., sgRNA and the Adenosine base editor protein). In some embodiments, the binding of the Adenosine base editor protein to its target polynucleotide sequence in the target gene is directed by a single guide RDNA disclosed herein, e.g., a single guide RDNA comprising (i) a spacer sequence as disclosed herein and (ii) a tracrRNA sequence, wherein the spacer sequence hybridizes with a target polynucleotide sequence in a target gene. Thus, by designing the guide RDNA sequence, the Adenosine base editor protein can be directed to edit any target polynucleotide sequence in the target gene (e.g., target gene encoding ANGPTL3). The guide RDNA sequence can be co-expressed with the Adenosine base editor protein in a cell where editing is desired. To edit a gene encoding the ANGPTL3 protein, the gene is contacted with the systems described herein. A target polynucleotide sequence in a target gene can be contacted with the single guide RDNA disclosed herein and an adenosine base editor protein or a nucleic acid sequence encoding the Adenosine base editor protein, wherein the single guide RDNA directs the Adenosine base editor protein to effect a modification in the target gene (e.g., target gene encoding ANGPTL3). The target polynucleotide sequence can be the gene locus in the genomic DNA of a cell. The cell can be a cultured cell. The cell may be in vivo, in vitro, or ex vivo.

[0229] A base editor system provided herein may comprise a programmable DNA binding protein and a deaminase. As used herein, a deaminase may refer to an enzyme that catalyzes the removal of an amine group from a molecule, or deamination, for example through hydrolysis. In some embodiments, the deaminase is a cytidine deaminase, catalyzing the deamination of cytidine (C) to uridine (U), deoxycytidine (dC) to deoxyuridine (dU), or 5-methyl-cytidine to thymidine (T, 5-methyl-U), respectively. Subsequent DNA repair mechanisms ensure that a dU is replaced by T, as described in Komor et al, Nature, Programmable editing of a target base in genomic DNA without double- stranded DNA cleavage, 533, 420-424 (2016), which is incorporated herein by reference in its entirety. In some embodiments, the deaminase is a cytosine deaminase, catalyzing and promoting the conversion of cytosine to uracil (e.g., in RNA) or thymine (e.g., in DNA). In some embodiments, the deaminase is an adenosine deaminase, catalyzing and promoting the conversion of adenine to guanine. In some embodiments, the deaminase is a naturally-occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. In some embodiments, the deaminase is a variant of a naturally-occurring deaminase from an organism, and the variants do not occur in nature. For example, in some embodiments, the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase from an organism.

[0230] A cytidine deaminase (or cytosine deaminase) comprises an enzyme that catalyzes the chemical reaction "cytosine + H20 -> uracil + NH3" or "5-methyl-cytosine + H20 -> thymine + NH3." In the context of a gene, such nucleotide change, or mutation, may in turn lead to an amino acid change in the protein, which may affect the protein's function, e.g., loss-of-function or gain-of-function. Subsequent DNA repair mechanisms ensure that uracil bases in DNA are replaced by T, as described in Komor et al. (Nature, Programmable editing of a target base in genomic DNA without double- stranded DNA cleavage, 533, 420-424 (2016), which is incorporated herein by reference in its entirety).

[0231] One exemplary suitable class of cytosine deaminases is the apolipoprotein B mRNA-editing complex (APOBEC) family of cytosine deaminases encompassing eleven proteins that serve to initiate mutagenesis in a controlled and beneficial manner. The apolipoprotein B editing complex 3 (APOBEC3) enzyme provides protection to human cells against a certain HIV-1 strain via the deamination of cytosines in reverse-transcribed viral ssDNA. These cytosine deaminases all require a Zn -coordinating motif (His-X-Glu-X23_26-Pro-Cys-X2_4-Cys (SEQ ID NO: 29)) and bound water molecule for catalytic activity. The glutamic acid residue acts to activate the water molecule to a zinc hydroxide for nucleophilic attack in the deamination reaction. Each family member preferentially deaminates at its own particular "hotspot," for example, WRC (W is A or T, R is A or G) for hAID, or TTC for hAPOBEC3F. A recent crystal structure of the catalytic domain of AP0BEC3G revealed a secondary structure comprising a five-stranded P-sheet core flanked by six a-helices, which is believed to be conserved across the entire family. The active center loops have been shown to be responsible for both ssDNA binding and in determining "hotspot" identity. Overexpression of these enzymes has been linked to genomic instability and cancer, thus highlighting the importance of sequence- specific targeting. Another suitable cytosine deaminase is the activation-induced cytidine deaminase (AID), which is responsible for the maturation of antibodies by converting cytosines in ssDNA to uracils in a transcription-dependent, strand-biased fashion.

[0232] An adenosine deaminase (or adenine deaminase) comprises an enzyme that catalyzes the hydrolytic deamination of adenosine or deoxy adenosine to inosine or deoxyinosine, respectively. In some embodiments, the adenosine deaminase catalyzes the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA). The adenosine deaminases (e.g. engineered adenosine deaminases, evolved adenosine deaminases) provided herein may be from any organism, such as a bacterium. In some embodiments, the deaminase or deaminase domain is a variant of a naturally-occurring deaminase from an organism. In some embodiments, the deaminase or deaminase domain does not occur in nature. For example, in some embodiments, the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase. In some embodiments, the adenosine deaminase is from a bacterium, such as, E.coli, S. aureus, S. typhi, S. putrefaciens, H. influenzae, or C. crescentus. In some embodiments, the adenosine deaminase is a TadA deaminase. In some embodiments, the TadA deaminase is an E. coli TadA deaminase. In some embodiments, the TadA deaminase is a truncated E. coli TadA deaminase. For example, the truncated ecTadA may be missing one or more N-terminal amino acids relative to a full-length ecTadA. In some embodiments, the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N-terminal amino acid residues relative to the full length ecTadA. In some embodiments, the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length ecTadA. In some embodiments, the ecTadA deaminase does not comprise an N-terminal methionine.

[0233] In some embodiments, the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO :747 or to any of the adenosine deaminases provided herein. It should be appreciated that adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein). The disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein. In some embodiments, the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,21,22,21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to the amino acid sequence set forth in SEQ ID NO: 747 or any of the adenosine deaminases provided herein. In some embodiments, the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth in SEQ ID NO: 747 or any of the adenosine deaminases provided herein. Additional exemplary adenosine deaminase can be found in PCT Application Publication NO. WO2021 / 207712, which is hereby incorporated by reference in its entirety.

[0234] In some embodiments, the adenine base editor comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the amino acid sequences listed in Table 2 or Table 4. In some embodiments, the adenine base editor comprises any one of the amino acid sequences listed in Table 2 or Table 4. In some embodiments, the sequence of the adenine base editor is any one of the amino acid sequences listed in Table 2 or Table 4. In some embodiments, the adenine base editor comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the amino acid sequences of SEQ ID NOs: SEQ ID NOs: 688, 691, 695, 702, 705, 707, 718, 720, 722, 724, 726, 728 and 730. In some embodiments, the adenine base editor comprises any one of the amino acid sequences of SEQ ID NOs: 688, 691, 695, 702, 705, 707, 718, 720, 722, 724, 726, 728 and 730. In some embodiments, the sequence of the adenine base editor is any one of the amino acid sequences of SEQ ID NOs: 688, 702, 718, 720, 722, 724, 726, 728 and 730.

[0235] In some embodiments, the adenine base editor is encoded by the polynucleotide sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences listed in Table 2 or Table 4. In some embodiments, the adenine base editor is encoded by any one of the polynucleotide sequences listed in Table 2 or Table 4. In some embodiments, the adenine base editor is expressed by the polynucleotide sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences listed in Table 2 or Table 4. In some embodiments, the adenine base editor is expressed by any one of the polynucleotide sequences listed in Table 2 or Table 4. In some embodiments, the adenine base editor is encoded by the polynucleotide sequence that comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.7%, or at least 99.9% identical to any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, 706, 717, 719, 721, 723, 725, 727, and 729. In some embodiments, the adenine base editor is encoded by the polynucleotide sequence that comprises any one of the polynucleotide sequences of SEQ ID NOs: 687, 690, 694, 701, 704, 706, 717, 719, 721, 723, 725, 727, and 729. In some embodiments, the adenine base editor is encoded by any one of the polynucleotide sequences of SEQ ID NOs: 687, 701, 717, 719, 721, 723, 725, 727, and 729. Prime Editing

[0236] The disclosed gene editing systems can encompass a prime editing CRISPR system or a component thereof. Prime editing is a variation on CRISPR systems which expands the guide RNA’s responsibility to serve two purposes: to guide Cas9 to a targeted genomic location, and to serve as an RNA template to copy new sequences into the DNA genome (Anzalone AV et al., Nature volume 576, pagesl49-157 (2019)). Similar to CRISPR, prime editing requires the presence of a catalytically modified Cas endonuclease and a single guide RNA. The Cas9 endonuclease is catalytically modified to be a Cas9 nickase which nicks the DNA rather than generating a double-strand break. The Cas9 nickase is fused to a reverse transcriptase. The prime editing guide RNA (pegRNA), is substantially larger than standard sgRNA. The pegRNA is a sgRNA with a primer binding sequence (PBS) and the template containing the desired RNA sequence added at the 3’end. Additional information about prime editing can be found in published PCT application WO2020191245A1, which is incorporated herein in its entirety.

[0237] The hybrid guide gene editing systems disclosed herein can comprise a polymerase. A polymerase functions to catalyze the polymerization of a nucleic acid strand using an existing nucleic acid as a template. Examples of useful polymerases include DNA polymerases and RNA polymerases. The polymerase can work with a nucleic acid programmable nucleotide binding domain or a nucleic acid programmable DNA binding protein (e.g., in the form of fusion proteins or coupled or associated in trans with the hybrid guide nucleic acid sequences). The polymerase can be a RNA-dependent DNA polymerase (e.g., reverse transcriptase) or a DNA-dependent DNA polymerase (e.g., a prokaryotic polymerase, including Pol I, Pol II, or Pol III, or a eukaryotic polymerase, including Pol a, Pol b, Pol g, Pol d, Pol e, or Pol z). Editing Efficiency

[0238] The gene editing systems disclosed herein can achieve high efficiency in gene editing with low off-target editing effect. For example, the gene editor protein in the gene editing system with guide nucleic acids comprising deoxyribonucl eoti de containing motif(s) in the spacer disclosed herein can affect less than 10% editing on all off-target sites as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. For example, the gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect less than 7% editing on all off-target sites as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect less than 5% editing on all off-target sites as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect less than 2% editing on all off-target sites as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect less than 1% editing on all off-target sites as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect less than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% editing on all off-target sites as compared to a gene editing system with guide nucleic acid sequence without deoxy rib onucl eoti de.

[0239] The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect at least 50% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect at least 70% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect at least 90% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect more than 50% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect more than 70% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect more than 90% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect at least 50%, 60%, 70%, 80%, or 90% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. The gene editor protein in the gene editing system with the guide nucleic acid sequence comprising any of the motifs in the spacer sequence disclosed herein can affect more than 50%, 60%, 70%, 80%, or 90% editing on the target gene as compared to a gene editing system with guide nucleic acid sequence without deoxyribonucleotide. Gene Editor Protein

[0240] Provided herein are gene editor proteins comprising a nucleic acid-binding domain. The nucleic acid-binding domain may be able to bind to DNA. The nucleic acid-binding domain may be able to bind to RNA. The nucleic acid-binding domain can be a Cas9 domain. The term “Cas9” refers to an RNA guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas9, and / or the gRNA binding domain of Cas9). A Cas9 nuclease is also referred to as a Casnl nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat) associated nuclease. Cas9 can refer to a polypeptide with at least or at least about 50%, 60%, 70%, 80%, 90%, 100% sequence identity and / or sequence similarity to a wild type exemplary Cas9 polypeptide (e.g., Cas9 from S. pyogenes). Cas9 can refer to a polypeptide with at most or at most about 50%, 60%, 70%, 80%, 90%, 100% sequence identity and / or sequence similarity to a wild type exemplary Cas9 polypeptide (e.g., from S. pyogenes). Cas9 can refer to the wild type or a modified form of the Cas9 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.

[0241] Cas9 nuclease sequences and structures of variant Cas9 orthologs have been described in various species. Exemplary species that the Cas9 protein or other components can be from include, but are not limited to, Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Staphylococcus aureus, Listeria innocua, Lactobacillus gasseri, Francisella novicida, Wolinella succinogenes, Sutterella wadsworthensis, Gamma proteobacterium, Neisseria meningitidis, Campylobacter jejuni, Pasteurella multocida, Fibrobacter succinogene, Rhodospirillum rubrum, Nocardiopsis dassonvillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Lactobacillus buchneri, Treponema denticola, Microscilla marina, Burkholderiales bacterium, Polar omonas naphthalenivorans, Polar omonas sp., Crocosphaera watsonii, Cyanothece sp., Microcystis aeruginosa, Synechococcus sp., Acetohalobium arabaticum, Ammonifex degensii, Caldicelulosiruptor becscii, Candidatus Desulforudis, Clostridium botulinum, Clostridium difficile, Finegoldia magna, Natranaerobius thermophilus, Pelotomaculum thermopropionium, Acidithiobacillus caldus, Acidithiobacillus ferrooxidans, Allochromatium vinosum, Marinobacter sp., Nitrosococcus halophilus, Nitrosococcus watsoni, Pseudoalteromonas haloplanktis, Ktedonobacter racemifer, Methanohalobium evestigatum, Anabaena variabilis, Nodularia spumigena, Nostoc sp., Arthrospira maxima, Arthrospira platensis, Arthrospira sp., Lyngbya sp., Microcoleus chthonoplastes, Oscillator ia sp., Petrotoga mobilis, Thermosipho africanus, Streptococcus pasteurianus, Neisseria cinerea, Campylobacter lari, Parvibaculum lavamentivorans, Coryne bacterium diphtheria, or Acaryochloris marina. In some embodiments, the Cas9 protein is from Streptococcus pyogenes. In some embodiments, the Cas9 protein may be from Streptococcus thermophilus. In some embodiments, the Cas9 protein is from Staphylococcus aureus.

[0242] Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski et al., (2013) RNA Biology 10:5, 726-737; which are incorporated herein by reference.

[0243] The gene editing systems provided herein can comprise a gene editor protein, e.g. a Cas nuclease, with reduced or abolished nuclease activity. For example, a Ca9 protein may be nuclease inactive or may be a Cas9 nickase. Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science. 337:816-821 (2012); Qi et al, Cell. 28; 152(5): 1173-83 (2013)). For example, the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvCl subdomain. The HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvCl subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science. 337:816-821(2012); Qi et al, Cell. 28;152(5): 1173-83 (2013)). The Cas9 nickase suitable for use in accordance with the present disclosure has an active HNH domain and an inactive RuvC domain and is able to cleave only the strand of the target DNA that is bound by the sgRNA (which is the opposite strand of the strand that is being edited via cytidine deamination). The Cas9 nickase of the present disclosure may comprise mutations that inactivate the RuvC domain, e.g., a D10A mutation. It is to be understood that any mutation that inactivates the RuvC domain may be included in a Cas9 nickase, e.g., insertion, deletion, or single or multiple amino acid substitution in the RuvC domain. In a Cas9 nickase described herein, while the RuvC domain is inactivated, the HNH domain remains activate. Thus, while the Cas9 nickase may comprise mutations other than those that inactivate the RuvC domain (e.g., D10A), those mutations do not affect the activity of the HNH domain. In a non-limiting Cas9 nickase example, the histidine at position 840 remains unchanged.

[0244] Additional suitable mutations that inactivate Cas9 will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure. Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D839A and / or N863A (See, e.g., Prashant et al, Nature Biotechnology. 2013; 31(9): 833-838, which are incorporated herein by reference), or K603R (See, e.g., Chavez et al., Nature Methods 12, 326-328, 2015, which is incorporated herein by reference). Cas9, dCas9, or Cas9 variant also encompasses Cas9, dCas9, or Cas9 variants from any organism. Also appreciated is that dCas9, Cas9 nickase, or other appropriate Cas9 variants from any organisms may be used in accordance with the present disclosure.

[0245] Cas9 can be a Cas9 from archaea (e.g., nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.

[0246] The gene editor protein can comprise a CasX or CasY, or a variant thereof, which have been described in, for example, Burstein et al., Cell Res. 2017 Feb 21. doi: 10.1038 / cr.2017.21.

[0247] The gene editor proteins can comprise high fidelity Cas9 domains. High fidelity Cas9 domains are engineered Cas9 domains comprising one or more mutations that decrease electrostatic interactions between the Cas9 domain and the sugar-phosphate backbone of DNA, as compared to a corresponding wild-type Cas9 domain. Without wishing to be bound by any particular theory, high fidelity Cas9 domains that have decreased electrostatic interactions with the sugar-phosphate backbone of DNA may have less off-target effects. The Cas9 domain can comprise one or more mutations that decreases the association between the Cas9 domain and the sugar-phosphate backbone of DNA. A Cas9 domain can comprise one or more mutations that decreases the association between the Cas9 domain and the sugar-phosphate backbone of DNA by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at leastlO%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, or more. Any of the Cas9 provided herein can comprise one or more of N497X, R661X, Q695X, and / or Q926X mutation as numbered in the wild type Cas9 amino acid sequence or a corresponding amino acid in another Cas9, wherein X is any amino acid. The Cas9 can comprise one or more of N497A, R661A, Q695A, and / or Q926A mutation of the amino acid sequence provided in the wild type Cas9 sequence, or a corresponding mutation as numbered in the wild type Cas9 amino acid sequence or a corresponding amino acid in another Cas9. Cas9 domains with high fidelity have been described in Kleinstiver, B.P., et al., Nature 529, 490-495 (2016); and Slaymaker, I.M., et al., Science 351, 84-88 (2015); the entire contents of each are incorporated herein by reference.

[0248] It should be appreciated that any of the gene editing systems provided herein, may be converted into high fidelity gene editing systems by modifying the Cas9 domain as described herein to generate high fidelity gene editor protein comprising the high fidelity Cas9 domain. The high fidelity Cas9 domain can be a nuclease inactive Cas9 domain or a Cas9 nickase domain.

[0249] The gene editor protein can comprise one or more nuclease domains. A gene editor protein of the disclosure can comprise a HNH or HNH-like nuclease domain, a RuvC or RuvC-like nuclease domain, and / or HEPN-superfamily-like nucleases. HNH or HNH-like domains can comprise a McrA-like fold. HNH or HNH-like domains can comprise two antiparallel P-strands and an a-helix. HNH or HNH-like domains can comprise a metal binding site (e.g., divalent cation binding site). HNH or HNH-like domains can cleave one strand of a target nucleic acid (e.g., complementary strand of the crRNA targeted strand). Proteins that comprise an HNH or HNH-like domain can include endonucleases, colicins, restriction endonucleases, transposases, and DNA packaging factors.

[0250] A gene editor protein can be a Cas9 protein, a Cpfl protein, a C2cl protein, a C2c2 protein, a C2c3 protein, Cas3, Cas 5, Cas7, Cas8, CaslO, or complexes of these, dependent upon the particular CRISPR system being used. The gene editor protein can be a Cas9 or a Cpfl protein. A gene editor protein can have reduced nuclease activity. In some instances, the gene editor protein is a nickase, i.e., it can be modified to cleave one strand of a target nucleic acid duplex. A gene editor protein can be modified to have no nuclease activity, i.e., it does not cleave any strand of a target nucleic acid duplex, or any single strand of a target nucleic acid. Examples of gene editor protein with reduced or no nuclease activity include, but not limited to, a Cas9 with a modification to the HNH and / or RuvC nuclease domains, and a Cpfl with a modification to the RuvC nuclease domain. Non- limiting examples of such modifications can include D917A, El 006A and DI 225A to the RuvC nuclease domain of the F. novicida Cpfl and alteration of residues DIO, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and / or A987 of the S. pyogenes Cas9, and their corresponding amino acid residues in other Cpfl and Cas9 proteins.

[0251] Any variants of Cas9 known in the art can also be the gene editor protein. In some instances, the variant of Cas9 is a catalytically inactive Cas9 (dCas9). A dCas9 can bear mutations at two nuclease domains and thus lack nuclease activity. The dCas9 can function as a programmable sequence-specific DNA-binding protein. dCas9 can be used to physically block the process of transcription, turning off a specific gene, or to shuttle other proteins to a particular site in the genome. As used herein, a “dCas” and “dCas protein” are used interchangeably and refer to a catalytically inactive CRISPR associated protein. In some instances, the dCas protein comprises one or more mutations in a DNA-cleavage domain. The dCas protein can comprise one or more mutations in the RuvC or HNH domain. The dCas protein can comprise one or more mutations in both the RuvC and HNH domain. The dCas can be a fragment of a wild-type Cas molecule. The dCas can comprise a functional domain from a wild-type Cas molecule, wherein the functional domain is chosen from a Reel domain, a bridge helix domain, or a PAM interacting domain. The nuclease activity of the dCas molecule can be reduced by at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%), 90%), 95%), 99% compared to that of a corresponding wild type Cas.

[0252] Suitable dCas can be derived from a wild type Cas. The Cas can be from a type I, type II, or type III CRISPR-Cas systems. In some instances, suitable dCas proteins are derived from a Casl, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9, or CaslO molecule. The dCas can be derived from a Cas9 molecule. The dCas9 molecule can be obtained, for example, by introducing point mutations (e.g., substitutions, deletions, or additions) in the Cas9 molecule at the DNA-cleavage domain, e.g., the nuclease domain, e.g., the RuvC and / or HNH domain. See, e.g., Jinek et al., Science (2012) 337:816-21, incorporated by reference herein in its entirety. For example, introducing two point mutations in the RuvC and HNH domains reduces the Cas9 nuclease activity while retaining the Cas9 sgRNA and DNA binding activity. In some instances, the two point mutations within the RuvC and HNH active sites are DIO A and H840A mutations of the S. pyogenes Cas9 molecule. Alternatively, DIO and H840 of the S. pyogenes Cas9 molecule can be deleted to abolish the Cas9 nuclease activity while retaining its sgRNA and DNA binding activity. In some instances, the two point mutations within the RuvC and HNH active sites are DIOA and N580A mutations of the S. aureus Cas9 molecule. The dCas can be an S. aureus dCas9 molecule comprising a mutation at DIO and / or N580. The dCas can be an S. aureus dCas9 molecule comprising DIOA and / or N580A mutations. The dCas can be an S. aureus dCas9 molecule, any variant or mutant, or any fragment thereof.

[0253] Similar mutations can also apply to any other naturally-occurring Cas9 (e.g., Cas9 from other species) or engineered Cas9 molecules. The dCas9 can comprise a Streptococcus pyogenes dCas9 molecule, a Staphylococcus aureus dCas9 molecule, a Campylobacter jejuni dCas9 molecule, a Cory neb acterium diphtheria dCas9 molecule, a Eubacterium ventriosum dCas9 molecule, a Streptococcus pasteurianus dCas9 molecule, a Lactobacillus farciminis dCas9 molecule, a Sphaerochaeta globus dCas9 molecule, an Azospirillum (strain B510) dCas9 molecule, a Gluconacetobacter diazotrophicus dCas9 molecule, a Neisseria cinerea dCas9 molecule, a Roseburia intestinalis dCas9 molecule, a Parvibaculum lavamentivorans dCas9 molecule, a Nitratifractor salsuginis (strain DSM 16511) dCas9 molecule, a Campylobacter lari (strain CF89-12) dCas9 molecule, a Streptococcus therm ophilus (strain LMD-9) dCas9 molecule, or fragment thereof.

[0254] The gene editor protein disclosed herein can be modified. Such modifications may include the incorporation or fusion of a domain from another polypeptide to the gene editor protein, or replacement of a domain of the gene editor protein with a domain of another polypeptide. For example, a modified the gene editor protein can contain a first domain from a Cas9 or Cpf 1 protein and a second domain from a protein other than Cas9 or Cpf 1. The modification to include such domains in the modified gene editor protein may confer additional activity on the modified gene editor protein. Such activities can include nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity, glycosylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity) that modifies a polypeptide associated with target nucleic acid (e.g., a histone).

[0255] The gene editor protein can introduce double-stranded breaks or single-stranded breaks in nucleic acid sequences, (e.g., genomic DNA). A nucleic acid sequence can be a target nucleic acid. The gene editor protein can introduce blunt-end cleavage sites or produce cleavage sites having sticky ends, i.e., 5’ or 3’ overhangs. Cpfl, for example, may introduce a staggered DNA double-stranded break with about a 4 or 5 nucleotide (nt) 5' overhang. A double- stranded break can stimulate a cell’s endogenous DNA-repair pathways (e.g., NHEJ or alternative non-homologous end-joining (A-NHEJ). NHEJ can repair a cleaved target nucleic acid without the need for a homologous template. This can result in deletions of the target nucleic acid. Homologous recombination (HR) can occur with a homologous template. The homologous template can comprise sequences that are homologous to sequences flanking the target nucleic acid cleavage site. After a target nucleic acid is cleaved by the gene editor protein, the site of cleavage can be destroyed (e.g., the site may not be accessible for another round of cleavage with a nucleic acid-targeting polynucleotide and site-directed polypeptide).

[0256] The gene editor protein can comprise a nucleic acid binding domain and thus can bind a nucleic acid. The nucleic acid can be a DNA sequence. The DNA sequence can be a target DNA sequence. The nucleic acid binding domain can be a DNA binding domain.

[0257] Any DNA-binding domain can be used in the systems disclosed herein. The DNA binding domain can comprise a zinc finger protein. The zinc finger protein can be non-naturally occurring in that it is engineered to bind to a target site of choice. Beerli et al. (2002) Nature Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nature Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416. An engineered zinc finger binding domain can have a novel binding specificity, compared to a naturally-occurring zinc finger protein. Engineering methods include, but are not limited to, rational design and various types of selection. Rational design includes, for example, using databases comprising triplet (or quadruplet) nucleotide sequences and individual zinc finger amino acid sequences, in which each triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers which bind the particular triplet or quadruplet sequence. See, for example, co-owned U.S. Pat. Nos. 6,453,242 and 6,534,261, incorporated by reference herein in their entireties.

[0258] Exemplary selection methods, including phage display and two-hybrid systems, are disclosed in U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,410,248; 6,140,466; 6,200,759; and 6,242,568; as well as WO 98 / 37186; WO 98 / 53057; WO 00 / 27878; WO 01 / 88197 and GB 2,338,237. In addition, enhancement of binding specificity for zinc finger binding domains has been described, for example, in co-owned WO 02 / 077227.

[0259] The systems described herein can employ a meganuclease (homing endonuclease) DNA-binding domain for binding to the target nucleic acid. Naturally-occurring meganucleases recognize 15-40 base-pair cleavage sites and are commonly grouped into four families: the LAGLIDADG family, the GIY-YIG family, the His-Cyst box family, and the HNH family. Exemplary homing endonucleases include I-Scel, I-Ceul, PI-PspI, Pl-Sce, LScelV, I-CsmI, I-Panl, I-SceII, I-Ppol, 1-SceIII, I-Crel, I-TevI, I-TevII and I-TevIII. Their recognition sequences are known. See also U.S. Pat. No. 5,420,032; U.S. Pat. No. 6,833,252; Belfort et al. (1997) Nucleic Acids Res. 25:3379-3388; Dujon et al. (1989) Gene 82:115-118; Perler et al. (1994) Nucleic Acids Res. 22, 1125-1127; Jasin (1996) Trends Genet. 12:224-228; Gimble et al. (1996) J. Mol. Biol. 263:163-180; Argast et al. (1998) J. Mol. Biol. 280:345-353 and the New England Biolabs catalogue. In addition, the DNA-binding specificity of homing endonucleases and meganucleases can be engineered to bind non-natural target sites. See, for example, Chevalier et al. (2002) Molec. Cell 10:895-905; Epinat et al. (2003) Nucleic Acids Res. 31:2952-2962; Ashworth et al. (2006) Nature 441:656-659; Paques et al. (2007) Current Gene Therapy 7:49-66; U.S. Patent Publication No. 20070117128. The DNA-binding domains of the homing endonucleases and meganucleases may be altered in the context of the nuclease as a whole (i.e., such that the nuclease includes the cognate cleavage domain) or may be fused to a heterologous cleavage domain.

[0260] The DNA-binding domain of one or more of the nucleases used in the methods and compositions described herein comprises a naturally occurring or engineered (non-naturally occurring) TAL effector DNA binding domain. See, e.g., U.S. Pat. No. 8,586,526, incorporated by reference in its entirety herein. Deaminase domains

[0261] The gene editing systems disclosed herein can comprise a deaminase. As used herein, a “deaminase” may refer to an enzyme that catalyzes the removal of an amine group from a molecule, or deamination, for example through hydrolysis. The deaminase can be a cytidine deaminase, catalyzing the deamination of cytidine (C) to uridine (U), deoxycytidine (dC) to deoxyuridine (dU), or 5-methyl-cytidine to thymidine (T, 5-methyl-U), respectively. Subsequent DNA repair mechanisms ensure that a dU is replaced by T, as described in Komor et al, Nature, Programmable editing of a target base in genomic DNA without double- stranded DNA cleavage, 533, 420-424 (2016), which is incorporated herein by reference in its entirety. The deaminase can be a cytosine deaminase, catalyzing and promoting the conversion of cytosine to uracil (e.g., in RNA) or thymine (e.g., in DNA). The deaminase can be an adenosine deaminase, catalyzing and promoting the conversion of adenine to guanine. The deaminase can be a naturally-occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. The deaminase can be a variant of a naturally-occurring deaminase from an organism, and the variants do not occur in nature. For example, the deaminase or deaminase domain can be at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase from an organism.

[0262] A cytidine deaminase (or cytosine deaminase) comprises an enzyme that catalyzes the chemical reaction “cytosine + H20 —► uracil + NH3” or “5-methyl-cytosine + H20 —► thymine + NH3.” In the context of a gene, such nucleotide change, or mutation, may in turn lead to an amino acid change in the protein, which may affect the protein’s function, e.g., loss-of-function or gain-of-function. Subsequent DNA repair mechanisms ensure that uracil bases in DNA are replaced by T, as described in Komor et al. (Nature, 533, 420-424 (2016), which is incorporated herein by reference in its entirety).

[0263] One exemplary suitable class of cytosine deaminases is the apolipoprotein B mRNA-editing complex (APOBEC) family of cytosine deaminases encompassing eleven proteins that serve to initiate mutagenesis in a controlled and beneficial manner. The apolipoprotein B editing complex 3 (APOBEC3) enzyme provides protection to human cells against a certain HIV-1 strain via the deamination of cytosines in reverse-transcribed viral ssDNA. These cytosine deaminases all require a Zn -coordinating motif (His-X-Glu-X23_26-Pro-Cys-X2_4-Cys) and bound water molecule for catalytic activity. The glutamic acid residue acts to activate the water molecule to a zinc hydroxide for nucleophilic attack in the deamination reaction. Each family member preferentially deaminates at its own particular “hotspot,” for example, WRC (W is A or T, R is A or G) for hAID, or TTC for hAPOBEC3F. A recent crystal structure of the catalytic domain of APOBEC3G revealed a secondary structure comprising a five-stranded P-sheet core flanked by six a-helices, which is believed to be conserved across the entire family. The active center loops have been shown to be responsible for both ssDNA binding and in determining “hotspot” identity. Overexpression of these enzymes has been linked to genomic instability and cancer, thus highlighting the importance of sequence- specific targeting. Another suitable cytosine deaminase is the activation-induced cytidine deaminase (AID), which is responsible for the maturation of antibodies by converting cytosines in ssDNA to uracils in a transcriptiondependent, strand-biased fashion.

[0264] An adenosine deaminase (or adenine deaminase) comprises an enzyme that catalyzes the hydrolytic deamination of adenosine or deoxy adenosine to inosine or deoxyinosine, respectively. The adenosine deaminase can catalyze the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA). The adenosine deaminases (e.g., engineered adenosine deaminases, evolved adenosine deaminases) provided herein can be from any organism, such as a bacterium. The deaminase or deaminase domain can be a variant of a naturally-occurring deaminase from an organism. The deaminase or deaminase domain may not occur in nature. For example, the deaminase or deaminase domain can be at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase. The adenosine deaminase can be from a bacterium, such as, E.coli, S. aureus, S. typhi, S. putrefaciens, H. influenzae, or C. crescentus. The adenosine deaminase can be a TadA deaminase. The TadA deaminase can be an E. coli TadA deaminase. The TadA deaminase can be a truncated E. coli TadA deaminase. For example, the truncated ecTadA may be missing one or more N-terminal amino acids relative to a full-length ecTadA. The truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or20N-terminal amino acid residues relative to the full length ecTadA. The truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length ecTadA. The ecTadA deaminase may not comprise an N-terminal methionine.

[0265] It should be appreciated that adenosine deaminases provided herein may include one or more mutations. Exemplary adenosine deaminase mutations and variants are described in Patent Application WO2018119354, which is incorporated herein by reference in its entirety. Additional adenosine deaminases useful in the present application would be apparent to the skilled artisan and are within the scope of this disclosure. Guide Nucleic Acid

[0266] A guide nucleotide sequence can exist as a single nucleotide molecule and comprise two domains: (1) a domain that shares homology to a target nucleic acid and directs binding of a guide nucleotide sequence-gene editor protein to the targeted gene sequence; and (2) a domain that binds a guide nucleotide sequence-gene editor protein. Domain (1) can comprise a spacer sequence. Domain (2) can be referred to as a tracrRNA sequence or equivalent such as a modified tracrRNA. Domain (2) may comprise a stem-loop structure. For example, domain (2) can be identical or homologous to a tracrRNA as provided in Jinek et al., Science 337:816-821(2012), which is incorporated herein by reference. Other examples of gRNAs (e.g., those including domain (2)) can be found in U.S. Patent Application Publication US20160208288 and U.S. Patent Application Publication US20160200779 each of which is herein incorporated by reference in their entirety.

[0267] Methods of using guide nucleotide sequence-gene editor protein, such as Cas9, for sitespecific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al., Science 339, 819-823 (2013); Mali, P. et al., Science 339, 823-826 (2013); Hwang, W.Y. et al., Nature biotechnology 31, 227-229 (2013); Jinek, M. et al., eLife 2, e00471 (2013); Dicarlo, J.E. et al., Nucleic acids research (2013); Jiang, W. et al., Nature biotechnology 31, 233-239 (2013); each of which are incorporated herein by reference).

[0268] The guide nucleic acids of the gene editing systems disclosed herein can comprise a DNA-RNA chimera guide (i.e., chRDNA). The chRDNA can be a single guide RDNA. As used herein, the term “RDNA” refers to a nucleic acid comprising a mixture of ribonucleotide (RNA) and deoxynucleotide (DNA). That is, an RDNA comprises at least one ribonucleotide and at least one deoxynucleotide.

[0269] As used herein, the term “sgchRDNA,” “sgRDNA,” “single guide chRDNA,” and “single guide RDNA” are used interchangeably and refer to a polynucleotide comprising a spacer sequence, wherein the spacer sequence comprises a mixture of DNA and RNA nucleotides that is complementary to a sequence in a target nucleic acid. The spacer sequence comprises at least one deoxyribonucl eoti de and at least one ribonucleotide. The ribose of the ribonucleotide of the spacer sequence can be modified. For example, the ribose can comprise a 2’ hydroxyl group covalently linked to a methyl group (2’-O-Methyl).

[0270] As used herein, the term “sgRNA,” “sgRNA,” “single guide RNA,” and “single guide RNA” are used interchangeably and refer to a polynucleotide comprising a spacer sequence, wherein the spacer sequence comprises solely RNA that is complementary to a sequence in a target nucleic acid. The spacer sequence comprises only ribonucleotide. The ribose of the ribonucleotide of the spacer sequence can be modified. For example, the ribose can comprise a 2’ hydroxyl group covalently linked to a methyl group (2’-O-Methyl).

[0271] The guide nucleic acid disclosed herein can comprise, for example, a deoxy rib onucl eoti de-deoxy rib onucl eoti de-rib onucl eoti de-deoxy rib onucl eoti dedeoxyrib onucl eotide (dN-dN-N-dN-dN) motif. The guide nucleic acid disclosed herein can comprise, in another example, a deoxyribonucleotide-deoxyribonucleotide-ribonucleotide-deoxyribonucleotide-deoxyribonucleotide-deoxyribonucleotide (dN-dN-N-dN-dN-dN) motif. The guide nucleic acid comprises a spacer sequence. The spacer sequence comprises at least one deoxyribonucleotide. The spacer sequence can comprise one to ten deoxyribonucleotides. The spacer sequence can comprise one to nine deoxyribonucleotides. The spacer sequence can comprise one to eight deoxyribonucleotides. The spacer sequence can comprise one to seven deoxyribonucleotides. The spacer sequence can comprise one to six deoxyribonucleotides. The spacer sequence can comprise one to five deoxyribonucleotides. The spacer sequence can comprise one to four deoxyribonucleotides. The spacer sequence can comprise one to three deoxyribonucleotides. The spacer sequence can comprise one deoxyribonucl eotide. The spacer sequence can comprise two deoxyribonucleotides. The spacer sequence can comprise three deoxyribonucleotides. The spacer sequence can comprise four deoxyribonucleotides. The spacer sequence can comprise five deoxyribonucleotides. The spacer sequence can comprise six deoxyribonucleotides. The spacer sequence can comprise seven deoxyribonucleotides. The spacer sequence can comprise eight deoxyribonucleotides. The spacer sequence can comprise nine deoxyribonucleotides. The spacer sequence can comprise ten deoxyribonucleotides.

[0272] The locations where the ribonucleotide can be replaced with the deoxyribonucleotide can comprise, from the 5’ end of the spacer sequence, position 3, position 4, position 5, position 6, position 7, position 8, position 9, position 10, position 11, position 12, position 13, position 14, position 15, position 16, position 17, position 18, position 19, or position 20. In some instances, the deoxyribonucleotide is located on position 3, 4, 6, 7 and / or 8 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 3, 4, 6 and 7 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 3 and 4 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 6 and 7 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 3, 4, 6, 7 and 8 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 4, 5, 6, 7, 9, 10, 13, and 14 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 3, 4, 5, 6 and 7 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 3, 4, 6 and 7 from the 5’ end of the spacer sequence. The spacer sequence can comprise deoxyribonucleotides on positions 3, 4, 6, 7, 8 and 9 from the 5’ end of the spacer sequence.

[0273] The spacer sequence disclosed herein can comprise at least one modified ribonucleotide. For example, the ribonucleotide can be modified at 2’ hydroxyl group to be covalently linked to a methyl group (i.e., 2’-O-methyl). The spacer sequence can comprise one to three modified ribonucleotides. The spacer sequence can comprise one to two modified ribonucleotides. The spacer sequence can comprise one modified ribonucleotide. The spacer sequence can comprise two modified ribonucleotides. The spacer sequence can comprise three modified ribonucleotides. In some instances, the spacer sequence does not have modified ribonucleotide. The spacer sequence can have only unmodified ribonucleotides. The spacer sequence can have only unmodified ribonucleotides and 2’-deoxyribonucleotides. The modified ribonucleotide can be located on the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 1, 2, and 3 from the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 1,3, and 4 from the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 1 and 2 from the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 1 and 3 from the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 2 and 3 from the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 3 and 4 from the 5’ end of the spacer sequence. The modified ribonucleotide can be located on position 1 from the 5’ end of the spacer sequence.

[0274] In some instances, the spacer sequence has three modified ribonucleotides located on position 1, 2, and 3 from the 5’ end of the spacer sequence. The spacer sequence can have three modified ribonucleotides located on position 1,3, and 4 from the 5’ end of the spacer sequence. The spacer sequence can have two modified ribonucleotides located on position 1 and 2 from the 5’ end of the spacer sequence. The spacer sequence can have two modified ribonucleotides located on position 1 and 3 from the 5’ end of the spacer sequence. The spacer sequence can have two modified ribonucleotides located on position 2 and 3 from the 5’ end of the spacer sequence. The spacer sequence can have two modified ribonucleotides located on position 3 and 4 from the 5’ end of the spacer sequence. The spacer sequence can have one modified ribonucleotide located on position 1 from the 5’ end of the spacer sequence.

[0275] In some instances, the spacer sequence comprises five deoxyribonucleotides and two 2’-OMe ribonucleotides. The spacer sequence can comprise five deoxyribonucleotides located on positions 3, 4, 5, 6, and 7 from the 5’ end of the spacer sequence and two 2’-0Me ribonucleotides located on positions 1 and 2 from the 5’ end of the spacer sequence. The spacer can comprise eight deoxyribonucleotides located on positions 4, 5, 6, 7, 9, 10, 13, and 14 from the 5’ end of the spacer sequence and three 2’-0Me ribonucleotides located on positions 1, 2, and 3 from the 5’ end of the spacer sequence. The spacer can comprise four deoxyribonucleotides located on positions 3, 4, 6, and 7 from the 5’ end of the spacer sequence and two 2’-0Me ribonucleotides located on positions 1 and 2 from the 5’ end of the spacer sequence. The spacer can comprise five deoxyribonucleotides located on positions 3, 4, 6, 7, and 8 from the 5’ end of the spacer sequence and two 2’-0Me ribonucleotides located on positions 1 and 2 from the 5’ end of the spacer sequence.

[0276] The spacer sequence can further comprise a phosphorothioate backbone modification (PS). The spacer sequence can comprise at least one phosphorothioate backbone modification. The spacer sequence can comprise at least two phosphorothioate backbone modifications. The spacer sequence can comprise at least three phosphorothioate backbone modifications. The spacer sequence can comprise two or three phosphorothioate backbone modifications. The nucleotide residue of the 5’ terminal of the spacer can comprise a phosphorothioate backbone modification. The phosphorothioate backbone modification can be between position 1 and position 2 from the 5’ end of the spacer sequence. The phosphorothioate backbone modification can be between position 2 and position 3 from the 5’ end of the spacer sequence. The phosphorothioate backbone modification can be between position 3 and position 4 from the 5’ end of the spacer sequence. The spacer sequence can comprise three phosphorothioate backbone modifications and the phosphorothioate backbone modifications are located between position 1 and 2, between position 2 and 3, and between position 3 and 4 from the 5’ end of the spacer sequence. The spacer sequence can comprise two phosphorothioate backbone modifications and the phosphorothioate backbone modifications are located between position 1 and 2 and between position 2 and 3 from the 5’ end of the spacer sequence.

[0277] The spacer sequence can comprise a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA)(DNA) motif. The spacer sequence can comprise a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA) motif. The spacer sequence can comprise a (2’-OMe)PS(2’-OMe)PS(DNA)PS(DNA)(DNA)(DNA)(DNA) motif. The spacer sequence can comprise a (2’-OMe)PS(2’- OMe)PS(DNA)PS(DNA)(RNA)(DNA)(DNA)(DNA)(DNA) motif. As used herein, “2-OMe” refers to a modified RNA whose 2’ hydroxyl group of the ribose of the RNA covalently linked to a methyl group; “RNA” refers to an unmodified RNA; “DNA” refers to an unmodified DNA.

[0278] The spacer sequence can comprise or consist of SEQ IDNO:30or31. The spacer sequence can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NO: 30 or 31. The spacer sequence can comprise or consist of SEQ ID NO: 28 or 29. The spacer sequence can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NO: 28 or 29. The spacer sequence can comprise or consist of SEQ ID NO: 11 or 12. The spacer sequence can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NO: 11 or 12. The spacer sequence can comprise or consist of SEQ ID NO: 26 or 27. The spacer sequence can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NO: 26 or 27. The spacer sequence can comprise or consist of SEQ ID NO: 41. The spacer sequence can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NO: 41.

[0279] The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of SEQ ID NOs: 110, 111, 112, or 113. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NOs: 110, 111, 112, or 113. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of SEQ ID NOs: 106, 107, 108, or 109. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NOs: 106, 107, 108, or 109. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of SEQ ID NOs: 79, 80, 81, or 82. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NOs: 79, 80, 81, or 82. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of SEQ ID NOs: 102, 103, 104, or 105. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NOs: 102, 103, 104, or 105. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of SEQ ID NOs: 79, 80, or 82. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NOs: 79, 80, or 82. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of SEQ ID NO: 132. The guide nucleic acid comprising the spacer sequence disclosed herein can comprise or consist of a sequence with at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 100% sequence identity or sequence similarity of SEQ ID NO: 132.

[0280] A guide nucleic acid as disclosed herein can be a single guide nucleic acid comprising a spacer sequence at the 5’-end and a tracrRNA at the 3’-end. The tracrRNA may be modified. For example, some of the ribonucleotides of the tracrRNA can have one or more 2’-0Me modifications. A tracr nucleic acid (e.g., tracrRNA) can have a length of from about 50 nucleotides to about 150 nucleotides.

[0281] A tracrRNA sequence can comprise more than one duplexed region (e.g., hairpin, hybridized region). A tracrRNA sequence can comprise two duplexed regions. A tracrRNA may comprise a secondary structure. A tracrRNA may contain more than one secondary structure. A tracrRNA sequence may comprise a first secondary structure and a second secondary structure and a first secondary structure comprises more nucleotides than a second secondary structure. A tracrRNA may comprise a first secondary structure, a second secondary structure, and a third secondary structure and said first secondary structure comprises less nucleotides than said second secondary structure and said second secondary structure comprises more nucleotides than said third secondary structure. The number of secondary structures and corresponding nucleotide lengths is not particularly limited.

[0282] Naturally occurring Type V CRISPR systems, unlike Type II CRISPR systems, do not require a tracrRNA for crRNA maturation and cleavage of a target nucleic acid. The tracrRNA can be modified, for example, 2-OMe modification. The tracrRNA can be a sequence of GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGA AAAAGUGGCACCGAGUCGGUGCUsususu. The tracrRNA can be a sequence of gUUUUAGagcuaGaaauagcaaGUUaAaAuAaggcuaGUccGUUAucAAcuuGaaaaagugGcaccgaguc ggugcusususu.

[0283] A target nucleic acid can comprise DNA, RNA, or combinations thereof and can be a double-stranded nucleic acid or a single-stranded nucleic acid. A spacer sequence can hybridize to a target nucleic acid that is located 5’ or 3’ of a protospacer adjacent motif (PAM), depending upon the particular gene editor protein to be used. A PAM can vary depending upon the gene editor protein to be used. For example, when using the Cas9 from S. pyogenes, the PAM can be a sequence in the target nucleic acid that comprises the sequence 5’-NRR-3’, wherein R can be either A or G, wherein N is any nucleotide, and N is immediately 3’ of the target nucleic acid sequence targeted by the targeting region sequence. A gene editor protein can be modified such that a PAM may be different compared to a PAM for an unmodified gene editor protein. For example, when using Cas9 from S. pyogenes, the Cas9 may be modified such that the PAM no longer comprises the sequence 5’-NRR-3’, but instead comprises the sequence 5’-NNR-3’, wherein R can be either A or G, wherein N is any nucleotide, and N is immediately 3’ of the target nucleic acid sequence targeted by the spacer sequence. Other gene editor proteins may recognize other PAMs and one of skill in the art is able to determine the PAM for any particular gene editor protein. For example, Cpfl from Francisella novicida was identified as having a 5’-TTN-3’ PAM (Zetsche et al. (Cell; 163(3):759-71(2015))), but this was unable to support site specific cleavage of a target nucleic acid in vivo. Given the similarity in the guide sequence between Francisella novicida and other Cpfl proteins, such as the Cpfl from Acidaminocccus sp BV3L6, which utilize a 5’- TTTN - 3’ PAM, it is more likely that the Francisella novicida Cpfl protein recognizes and cleaves a site on a target nucleic acid proximal to a 5’-TTTN-3’ PAM with greater specificity and activity than a site on a target nucleic acid proximal to the truncated 5’-TTN-3’ PAM misidentified by Zetsche et al. The polynucleotides and CRISPR systems described in the present application may be used with a Cpfl protein (e.g., from Francisella novicida) directed to a site on a target nucleic acid proximal to a 5’-TTTN-3’ PAM.

[0284] A target nucleic acid sequence can be 20 nucleotides. A target nucleic acid can be less than 20 nucleotides. A target nucleic acid can be at least 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30 or more nucleotides. A target nucleotide can comprise ranges of nucleotides between about 5-30, and ranges between. The selection of a specific PAMs is within the knowledge of those of skill in the art based on the particular gene editor protein to be used in a given instance.

[0285] The spacer sequence of the present disclosure comprising DNA and RNA on the same strand can be chemically synthesized. Chemical synthesis of polynucleotides is well understood by one of ordinary skill in the art. Chemical synthesis of polynucleotides of the present disclosure can be conducted in solution or on a solid support. Solid phase synthesis is the preferred method of making the guide RNA for early evaluation.

[0286] The guide nucleic acid containing DNA may provide the advantage of increased specificity of targeting target nucleic acids such as DNA. Without being bound by any specific theory, spacer sequences comprising DNA in specific regions as discussed herein present the advantage of reducing off-target binding due to localized structural perturbation in the spacer leading to less off-target site-binding.

[0287] The spacer sequences of the present disclosure can also comprise modifications that, for example, increase stability of the polynucleotide. Such modifications may include phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates such as 3’-alkylene phosphonates, 5'-alkylene phosphonates, chiral phosphonates, phosphinates, phosphoramidates including 3’-amino phosphoramidate and amino alkylphosphoramidates, phosphorodiamidates, thionophosphoramidates, thiono alkylpho sphonates, thionoalkylpho sphotriesters, selenophosphates, and boranophosphates having normal 3’-5’ linkages, 2 -5’ linked analogs, and those having inverted polarity wherein one or more internucleotide linkages is a 3’ to 3’, a 5’ to 5’ or a 2’ to 2’ linkage. Suitable nucleic acid-targeting polynucleotides having inverted polarity can comprise a single 3’ to 3’ linkage at the 3’-most internucleotide linkage (i.e., a single inverted nucleoside residue in which the nucleobase is missing or has a hydroxyl group in place thereof). Various salts (e.g., potassium chloride or sodium chloride), mixed salts, and free acid forms can also be included.

[0288] The deoxyribose or ribose ( / . e., sugar moi eties) on the deoxynucl eotide or nucleotide of the spacer sequences can be modified. The examples of modified sugar moi eties include, but are not limited to, 2’-O-methyl, 2’-O-methoxyethyl, 2’-O-aminoethyl, 2’-Flouro, N3’^P5’ phosphoramidate, 2’dimethylaminooxyethoxy, 2’ 2'dimethylaminoethoxyethoxy, 2'-guanidinidium, 2'-O-guanidinium ethyl, carbamate modified sugars, and bicyclic modified sugars. 2’-O-methyl or 2’-O-m ethoxy ethyl modifications promote the A-form or RNA-like conformation in oligonucleotides, increase binding affinity to RNA, and have enhanced nuclease resistance. Modified sugar moi eties can also include having an extra bridge bond (e.g., a methylene bridge joining the 2’-0 and 4’-C atoms of the ribose in a locked nucleic acid) or sugar analog such as a morpholine ring (e.g., as in a pho sphorodi ami date morpholino). Examples of such analogs and / or modified residues include, but are not limited to diaminopurine, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5’-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6- isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, 5-methyl-2-thiouracil, 3-(3-amino- 3-N-2-carboxypropyl) uracil, (acp3)w, 2,6-diaminopurine, methyl phosphonates, chiral-methyl phosphonates, 2'-O-methyl ribonucleotides, peptide-nucleic acids (PNAs), and the like.

[0289] The spacer sequences of the present disclosure may also contain other nucleic acids, or nucleic acid analogues. An example of a nucleic acid analogue is peptide nucleic acid (PNA). Linkers

[0290] Gene editing systems provided herein can comprise linkers that connect one or more components of the gene editing systems. The linkers may be used to link any of the protein or protein domains described herein. The linker may be as simple as a covalent bond, or it may be a polymeric linker many atoms in length. The linker can be a polypeptide or based on amino acids. The linker may not be peptide-like. The linker can be carbon bond, disulfide bond, carbonheteroatom bond, etc. The linker can be a carbon-nitrogen bond of an amide linkage. The linker can be a cyclic or acyclic, substituted or unsubstituted, branched or unbranched aliphatic or heteroaliphatic linker. The linker can be polymeric (e.g., polyethylene, polyethylene glycol, polyamide, polyester, etc.). The linker can comprise a monomer, dimer, or polymer of aminoalkanoic acid. The linker can comprise an aminoalkanoic acid (e.g., glycine, ethanoic acid, alanine, beta-alanine, 3-aminopropanoic acid, 4-aminobutanoic acid, 5-pentanoic acid, etc.). The linker can comprise a monomer, dimer, or polymer of aminohexanoic acid (Ahx). The linker can be based on a carbocyclic moiety (e.g., cyclopentane, cyclohexane). The linker can comprise a polyethylene glycol moiety (PEG). The linker can comprise amino acids. The linker can comprise a peptide. The linker can comprise an aryl or heteroaryl moiety. The linker can be based on a phenyl ring. The linker may include functionalized moieties to facilitate attachment of a nucleophile (e.g., thiol, amino) from the peptide to the linker. Any electrophile may be used as part of the linker. Exemplary electrophiles include, but are not limited to, activated esters, activated amides, alkyl halides, aryl halides, acyl halides, and isothiocyanates.

[0291] The linker can be an amino acid or a plurality of amino acids (e.g., a peptide or protein). The linker can be a bond (e.g., a covalent bond), an organic molecule, group, polymer, or chemical moiety. The linker can be 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 4550, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110- 120, 120-130, 130-140, 140- 150, or 150200 amino acids in length. Longer or shorter linkers are also contemplated. A linker can comprise the amino acid sequence SGSETPGTSESATPES, which may also be referred to as the XTEN linker. A linker can comprise the amino acid sequence SGGS. A linker can comprise (SGGS)n, (GGGS)n, (GGGGS)n, (G)n, (EAAAK)n, (GGS)n, SGSETPGTSESATPES, or (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30, and wherein X is any amino acid. In some instances, n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15. A linker can comprise SGSETPGTSESATPES, SGGSSGSETPGTSESATPESSGGS. A linker can comprise SGGSSGGSSGSETPGTSESATPESSGGSSGGS. A linker can comprise GGSGGSPGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTE PSEGSAPGTSTEPSEGSAPGTSESATPESGPGSEPATSGGSGGS. The linker can be 24 amino acids in length. The linker can comprise the amino acid sequence SGGSSGGSSGSETPGTSESATPES. The linker can be40 amino acids in length. The linker can comprise the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSSGGSSGGS. The linker can be 64 amino acids in length. The linker can comprise the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSSGGSSGGSSGSETPGTSESATPESSGGSSG GS. The linker can be 92 amino acids in length. The linker can comprise the amino acid sequence PGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTEPSEGSAP GTSTEPSEGSAPGTSESATPESGPGSEPATS. It should be appreciated that any of the linkers provided herein may be used to link a first adenosine deaminase and a second adenosine deaminase; a deaminase (e.g., a first or a second adenosine deaminase) and a gene editor protein; a gene editor protein and an NLS; or a deaminase (e.g., a first or a second adenosine deaminase) and an NLS.

[0292] Various linker lengths and flexibilities between a deaminase (e.g., an engineered ecTadA) and a gene editor protein (e.g., a Cas9 domain), and / or between a first adenosine deaminase and a second adenosine deaminase can be employed (e.g., ranging from very flexible linkers of the form (GGGGS)n, (GGGGS)n, and (G)n to more rigid linkers of the form (EAAAK)n, (SGGS)n, and (XP)n) in order to achieve the optimal length for deaminase activity for the specific application. In some instances, n is any integer between 3 and 30. In some instances, n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15. The linker can comprise a (GGS)n motif, wherein n is 1, 3, or 7.

[0293] Additional linkers can be found in PCT Application Publication NO. WO2021 / 207712, which is hereby incorporated by reference in its entirety. ANGPTL3 Gene

[0294] The target gene for modification using the systems and methods disclosed herein can be a gene encoding ANGPTL3. ANGPTL3 has been associated with diseases and disorders such as, but not limited to, Arteriosclerosis, Atherosclerosis, Cardiovascular Diseases, Coronary heart disease, Diabetes, Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus, Fatty Liver, Hyperinsulinism, Hyperlipidemia, Hypertriglyceridemia, Hypobetalipoproteinemias, Inflammation, Insulin Resistance, Metabolic Diseases, Obesity, Malignant neoplasm of mouth, Lipid Metabolism Disorders, Lip and Oral Cavity Carcinoma, Dyslipidemias, Metabolic Syndrome X, Hypotriglyceridemia, Opitz trigonocephaly syndrome, Ischemic stroke, Hypertriglyceridemia result, Hypobetalipoproteinemia Familial 2, Familial hypobetalipoproteinemia, and Ischemic Cerebrovascular Accident. Editing the ANGPTL3 gene using any of the methods described herein may be used to treat, prevent and / or mitigate the symptoms of the diseases and disorders described herein.

[0295] The ANGPTL3 gene encodes the Angiopoietin-Like 3 protein, which is a determinant factor of high-density lipoprotein (HDL) level in human. It positively correlates with plasma triglyceride and HDL cholesterol. The activity of ANGPTL3 is expressed predominantly in the liver. ANGPTL3 is associated with Dyslipidemias. Dyslipidemias is a genetic disease characterized by elevated level of lipids in the blood that contributes to the development of clogged arteries (atherosclerosis). These lipids include plasma cholesterol, triglycerides, or high-density lipoprotein. Dyslipidemia increases the risk of heart attacks, stroke, or other circulatory concerns. Current management includes lifestyle changes such as exercise and dietary modifications as well as use of lipid-lowering drugs such as statins. Non-statin lipid-lowering drugs include bile acid sequestrants, cholesterol absorption inhibitors, drugs for homozygous familial hypercholesteremia, fibrates, nicotinic acid, omega-3 fatty acids and / or combination products. Treatment options usually depend on the specific lipid abnormality, although different lipid abnormalities often coexist. Treatment of children is more challenging as dietary changes may be difficult to implement and lipid-lowering therapies have not been proven effective.

[0296] ANGPTL3 is also known to cause hypobetalipoproteinemia. Hypobetalipoproteinemia is an inherited disease (autosomal recessive) that affects between 1 in 1000 and 1 in 3000 people worldwide. Common symptoms of hypobetalipoproteinemia include plasma levels of LDL cholesterol or apolipoprotein B below the 5th percentile which impairs the body's ability to absorb and transport fats and can lead to retinal degeneration, neuropathy, coagulopathy, or abnormal buildup of fats in the liver called hepatic steatosis. In severely affected patients, hepatic steatosis may progress to chronic liver disease (cirrhosis). Current treatment of hypobetalipoproteinemia includes severe restriction of long-chain fatty acids to 15 grams per day to improve fat absorption. In infants with hypobetalipoproteinemia, brief supplementation with medium-chain triglycerides may be effective but amount must be closely monitored to avoid liver toxicity. Another option for treating hypobetalipoproteinemia is administration high doses of vitamin E to prevent neurologic complications. Alternatively, vitamin A (10,000-25,000 lU / d) supplementation may be effective if an elevated prothrombin time suggests vitamin K depletion.

[0297] The target tissue for the systems and methods described herein can be liver tissue. The target gene can be ANGPTL3 which may also be referred to as Angiopoietin 5, ANGPT5, ANG-5, Angiopoietin-Like Protein 3, Angiopoietin- 5, FHBL2, and ANL3. ANGPTL3 has a cytogenetic location of lp31.3 and the genomic coordinate are on Chromosome 1 on the forward strand at position 62,597,487-62,606,159.

[0298] Loss-of-function mutations that may be made in ANGPTL3 gene using the methods and systems described herein are also provided, including, but are not limited to premature stop codons, destabilizing mutations, altering splicing, etc.

[0299] The gene editing system of the present disclosure may reduce expression of functional ANGPTL3 protein encoded by the ANGPTL3 gene in the cell. The modification can reduce expression of functional ANGPTL3 protein encoded by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.9%, or 100%. The modification can reduce expression of functional ANGPTL3 protein encoded by the ANGPTL3 gene in the cell by at least 2 fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 10 fold, at least 20 fold, at least 25 fold, at least 30 fold, at least 40 fold, at least 50 fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, at least 100 fold, at least 200 fold, at least 300 fold, at least 400 fold, at least 500 fold, at least 600 fold, at least 700 fold, at least 800 fold, at least 900 fold, at least 1000 fold, at least 2000 fold, at least 3000 fold, at least 4000 fold, at least 5000 fold, at least 6000 fold, at least 7000 fold, at least 8000 fold, at least 9000 fold, or at least 10000 fold. The modification can abolish expression of functional ANGPTL3 protein encoded by the ANGPTL3 gene in the cell.

[0300] A splice site disruption generated by a gene editing system disclosed herein can result in the inclusion of intronic sequences in messenger RNA (mRNA) encoded by the ANGPTL3 gene. The splice site disruption can generate a nonsense, frameshift, or an in-frame indel mutation that result in premature stop codons or in insertion / deletion of amino acids that disrupt protein activity. The splice site disruption can generate exclusion of exonic sequences. The splice site disruption can generate exclusion of exonic sequences that results in nonsense, frameshift, or inframe indel mutations in the ANGPTL3 transcript. Canonical splice donors comprise the DNA sequence GT on the sense strand, whereas canonical splice acceptors comprise the DNA sequence AG. ...

Claims

1. A chemically modified polynucleotide encoding a fusion protein, wherein the chemically modified polynucleotide comprises a sequence of SEQ ID NO: 701.

2. A composition comprising:(1) the chemically modified polynucleotide of claim 1, and(2) a chemically modified guide nucleic acid comprising a spacer sequence and a tracr sequence.

3. The composition of claim 2, wherein the chemically modified guide nucleic acid comprises chemically modified ribonucleotides.

4. The composition of claim 2 or 3, wherein the spacer sequence comprises at least 15 nucleotide bases of a protospacer, wherein the protospacer is on a human gene that encodes proprotein convertase subtilisin-kexin type 9 (PCSK9), and wherein uracil is considered the same as thymine.

5. The composition of claim 4, wherein the protospacer comprises the sequence of CCCGCACCTTGGCGCAGCGG (SEQ ID NO: 731) and wherein the spacer sequence comprises a nucleotide base sequence of CCCGCACCUUGGCGCAGCGG, and wherein the uppercase A, T, G, C, and U represent adenine, thymine, guanine, cytosine, and uracil respectively.

6. The composition of any one of claims 2-5, wherein the spacer sequence comprises a chemically modified sequence of cscscsGCACCUUGGCGCAGCGG, wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase c represents 2’-O-Methyl- modified cytidine; and 3) the lowercase s represents phosphorothioate (PS) linkage.

7. The composition of any one of claims 2-5, wherein the tracr sequence comprises a chemically modified sequence of gUUUUAGagcuaGaaauagcaaGUUaAaAuAaggcuaGUccGUUAucAAcuuGaaaaagugGcac cgagucggugcusususu,wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl- modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

8. The composition of any one of claims 2-5, wherein the chemically modified guide nucleic acid comprises a sequence of cscscsGCACCUUGGCGCAGCGGgUUUUAGagcuaGaaauagcaaGUUaAaAuAaggcuaG UccGUUAucAAcuuGaaaaagugGcaccgagucggugcusususu,wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl- modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

9. A composition for editing a human PCSK9 gene, comprising:a. a chemically modified polynucleotide encoding a fusion protein comprising a Cas9 nickase and an adenosine deaminase, wherein the chemically modified polynucleotide comprises a region encoding the Cas9 nickase, and wherein the region encoding the Cas9 nickase comprises the sequence set forth in SEQ ID NO: 706; andb. a chemically modified guide nucleic acid comprising a sequence of cscscsGCACCUUGGCGCAGCGGgUUUUAGagcuaGaaauagcaaGUUaAaAuAa ggcuaGUccGUUAucAAcuuGaaaaagugGcaccgagucggugcusususu, wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl-modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

10. A composition for editing a human PCSK9 gene, comprising:a. a chemically modified polynucleotide encoding a fusion protein comprising a Cas9 nickase and an adenosine deaminase, wherein the chemically modified polynucleotide comprises a region encoding the adenosine deaminase, and wherein the region encoding the adenosine deaminase comprises the sequence set forth in SEQ ID NO: 704; andb. a chemically modified guide nucleic acid comprising a sequence of cscscsGCACCUUGGCGCAGCGGgUUUUAGagcuaGaaauagcaaGUUaAaAuAa ggcuaGUccGUUAucAAcuuGaaaaagugGcaccgagucggugcusususu,wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl-modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

11. A composition for editing a human PCSK9 gene, comprising:a. a chemically modified polynucleotide encoding a fusion protein comprising a Cas9 nickase and an adenosine deaminase, wherein the chemically modified polynucleotide comprises a 5’ UTR region, and wherein the 5’ UTR region comprises the sequence set forth in SEQ ID NO: 703; andb. a chemically modified guide nucleic acid comprising a sequence of cscscsGCACCUUGGCGCAGCGGgUUUUAGagcuaGaaauagcaaGUUaAaAuAa ggcuaGUccGUUAucAAcuuGaaaaagugGcaccgagucggugcusususu,wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl-modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

12. A composition for editing a human PCSK9 gene, comprising:a. a chemically modified polynucleotide encoding a fusion protein comprising a Cas9 nickase and an adenosine deaminase, wherein the chemically modified polynucleotide comprises a 3 ’ UTR region, and wherein the 3 ’ UTR region comprises the sequence set forth in SEQ ID NO: 710; andb. a chemically modified guide nucleic acid comprising a sequence of cscscsGCACCUUGGCGCAGCGGgUUUUAGagcuaGaaauagcaaGUUaAaAuAa ggcuaGUccGUUAucAAcuuGaaaaagugGcaccgagucggugcusususu,wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl-modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

13. A composition for editing a human PCSK9 gene, comprising:a. a chemically modified polynucleotide encoding a fusion protein comprising a Cas9 nickase and an adenosine deaminase, wherein the chemically modifiedpolynucleotide comprises a region encoding a nuclear localization sequence (NLS), and wherein the region encoding the NLS comprises the sequence set forth in SEQ ID NO: 708; andb. a chemically modified guide nucleic acid comprising a sequence of cscscsGCACCUUGGCGCAGCGGgUUUUAGagcuaGaaauagcaaGUUaAaAuAa ggcuaGUccGUUAucAAcuuGaaaaagugGcaccgagucggugcusususu, wherein 1) the uppercase A, U, G, and C represent adenosine, uridine, guanosine, and cytidine, respectively; 2) the lowercase a, u, g, and c represent 2’-O-Methyl-modified adenosine, uridine, guanosine, and cytidine, respectively, and 3) the lowercase s represents phosphorothioate (PS) linkage.

14. The composition of any one of claims 9, 10, 12 and 13, wherein the chemically modified polynucleotide comprises a 5’ UTR region, and wherein the 5’ UTR region comprises the sequence set forth in SEQ ID NO: 703.

15. The composition of any one of claims 9-11 and 13, wherein the chemically modified polynucleotide comprises a 3 ’ UTR region, and wherein the 3 ’ UTR region comprises the sequence set forth in SEQ ID NO: 710.

16. The composition of any one of claims 9-12, wherein the chemically modified polynucleotide comprises a region encoding a nuclear localization sequence (NLS), and wherein the region encoding the NLS comprises the sequence set forth in SEQ ID NO: 708.

17. The composition of any one of claims 9 and 11-13, wherein the chemically modified polynucleotide comprises a region encoding the adenosine deaminase, and wherein the region encoding the adenosine deaminase comprises the sequence set forth in SEQ ID NO: 704.

18. The composition of any one of claims 10-13, wherein the chemically modified polynucleotide comprises a region encoding the Cas9 nickase, and wherein the region encoding the Cas9 nickase comprises the sequence set forth in SEQ ID NO: 706.

19. The composition of any one of claims 9-18, wherein the chemically modified polynucleotide comprises the sequence set forth in SEQ ID NO: 701.

20. A pharmaceutical composition comprising (1) the composition of any one of claims 2-19 and (2) a pharmaceutically acceptable carrier, excipient, or diluent.

21. A pharmaceutical composition comprising (1) the composition of any one of claims 2-19 and (2) a pharmaceutically acceptable carrier, excipient, or diluent, for use in treating or presenting a cardiovascular disease in a subject in need thereof.

Citation Information

Patent Citations

  • Reporter cas9 variants and methods of use thereof

    US20180142222A1

  • Evolved CAS9 proteins for gene editing

    US20190225955A1

  • Cas9 variants and methods of use thereof

    WO2016196655A1

  • New-type single-base editing technique and use thereof

    WO2020199200A1