Glucagon-like peptide 1 receptor agonists and uses thereof

Abstract

To provide modified glucagon-like peptide 1 (GLP1) polypeptides, fusion proteins comprising modified GLP1 polypeptides, and methods of use thereof.SOLUTION: The invention provides: an isolated polynucleotide molecule comprising a polynucleotide sequence that encodes a fusion protein consisting of a specific amino acid sequence; a vector comprising the polynucleotide molecule; a cell expressing the fusion protein encoded by the polynucleotide molecule; and a pharmaceutical composition that comprises the fusion protein consisting of the specific amino acid sequence and a pharmaceutically acceptable carrier or diluent, and is for use in reducing the blood sugar level in a subject.SELECTED DRAWING: None

Description

[Technical field]

[0001] The present invention relates to human glucagon-like peptide-1 receptor agonists and methods of treatment using said agonists. [Background technology]

[0002] Obesity is a major health problem in the United States, with two out of three Americans considered overweight or obese. Obesity is a significant underlying risk factor for developing other diseases, such as heart disease, stroke, and diabetes. Even a small reduction in weight (5-10% of initial weight) reduces the risk of developing obesity-related diseases, such as heart disease and diabetes.

[0003] Diabetes is a chronic disease characterized by high blood sugar levels and insulin resistance. If left untreated, high blood sugar levels can lead to long-term complications including heart disease, stroke, diabetic retinopathy, and amputation. Treatment of diabetes involves controlling and reducing blood sugar levels and includes exercise and dietary modification along with medications such as insulin and metformin.

[0004] One approach used for obesity treatment and glycemic control involves glucagon-like peptide (GLP)-1 receptor agonists targeting the incretin pathway. Glucagon-like peptide (GLP)-1 is a peptide hormone secreted by intestinal enteroendocrine cells. Upon oral glucose administration, GLP1 binds to its receptor, resulting in insulin secretion and reduced blood glucose levels (incretin effect). However, GLP1 is rapidly inactivated and degraded by the enzyme dipeptidyl peptidase 4 (DPP4) and has a very short half-life of 1.5 min. Therefore, long-acting derivatives of GLP1 and GLP1 receptor agonists, including fusion proteins containing GLP1, are being tested for diabetes control. GLP1 analogs, fusion proteins and GLP1 receptor agonists are disclosed, for example, in U.S. Patent No. 5,393,636, U.S. Patent No. 5,393,665, U.S. Patent No. 5,393,671, U.S. Patent No. 5,393,682, U.S. Patent No. 5,393,503, U.S. Patent No. 5,393,675, U.S. Patent No. 5,393,503, U.S. Patent No. 5,393,675, U.S. Patent No. 5,393,675, U.S. Patent No. 6,393,865, U.S. Patent No. 6,393,503, U.S. Patent No. 6,393,67 ...

[0005] However, there is a need for novel GLP1 peptide variants and GLP1 receptor agonists that are resistant to degradation by DPP4, have improved pharmacokinetics, and have high efficacy and sustained in vivo activity in glycemic control.Such GLP1 variants and GLP1 receptor agonists can be used to treat obesity and diabetes. [Prior art documents] [Patent documents]

[0006] [Patent Document 1] US7452966 [Patent Document 2] US8389689 [Patent Document 3] US8497240 [Patent Document 4] US8557769 [Patent Document 5] US8883447 [Patent Document 6] US8895694 [Patent Document 7] US9409966 [Patent Document 8] US20160194371 [Patent Document 9] US20140024586 [Patent Document 10] US20140073563 [Patent Document 11] US20120148586 [Patent Document 12] US20170114115 [Patent Document 13] US20170112904 [Patent Document 14] US20160361390 [Patent Document 15] US20150313908 [Patent Document 16] US20150259416 [Patent Document 17] WO2017074715 [Patent Document 18] , WO2016127887 [Patent Document 19] WO2015021871 [Patent Document 20] WO2014113357 [Patent Document 21] EP3034514 [Patent Document 22] EP2470198 [Patent Document 23] EP2373681 Summary of the Invention [Means for solving the problem]

[0007] According to one aspect, the present invention provides a glucagon-like peptide 1 (GLP1) variant comprising at least one amino acid modification from mature GLP1(7-37) (SEQ ID NO: 4) selected from the group consisting of: (i) an addition of an amino acid to the N-terminus, and (ii) a deletion of an amino acid from the peptide sequence. In a particular embodiment, the modification comprises the addition of an alanine or glutamine to the N-terminus.

[0008] According to one aspect, the present invention provides GLP1 receptor agonists, which comprise fusion proteins comprising GLP1 or variants thereof. In a particular embodiment, the GLP1 receptor agonists comprise GLP1 peptides or GLP1 peptide variants fused with a stable domain. In one embodiment, the stable domain is an antibody or antigen-binding fragment thereof that binds to the GLP1 receptor.

[0009] The GLP1 receptor agonist of the present invention is particularly useful for increasing the binding and / or activity of GLP1. In some embodiments, the GLP1 receptor agonist of the present invention functions by activating GLP1 and reducing blood glucose levels. In some embodiments, the GLP1 peptide variants and / or GLP1 receptor agonists of the present invention are more resistant to inactivation by dipeptidyl peptidase 4 (DPP4) and show improved in vivo half-life. The improved GLP1 agonists of the present invention provide a significant reduction in blood glucose levels that lasts for more than 10 days even with a single dose. In some embodiments, the GLP1 receptor agonist functions by enhancing glucose-responsive insulin secretion from pancreatic β cells, increasing insulin expression, inhibiting β cell apoptosis, promoting β cell neogenesis, reducing glucagon secretion, delaying gastric digestion time, promoting satiety and increasing peripheral glucose disposal capacity. In certain embodiments, the GLP1 receptor agonist is useful in preventing, treating or alleviating at least one symptom of hyperglycemia-related disease or disorder (e.g., diabetes) in a subject. In certain embodiments, GLP1 receptor agonist can be administered prophylactically or therapeutically to subjects with diabetes or at risk of diabetes.In certain embodiments, GLP1 receptor agonist is useful in preventing, treating or alleviating at least one symptom or sign of obesity, such as weight loss in subjects.

[0010] In a particular embodiment, the GLP1 receptor agonist is a fusion protein comprising a GLP1 variant and a stabilization domain, the stabilization domain comprising an immunoglobulin or a fragment thereof. In a specific embodiment, the immunoglobulin comprises a heavy chain variable region and a light chain variable region, and is a fusion protein comprising a GLP1 receptor variant and a stabilization domain comprising an immunoglobulin or a fragment thereof. In certain embodiments, the GLP1 receptor agonist binds to the GLP1 receptor, resulting in activation of the GLP1 receptor. In certain embodiments, the GLP1 receptor agonist functions by activating the GLP1 receptor, resulting in glycemic control, i.e., reduced blood glucose levels.

[0011] In one embodiment, the invention provides a fusion protein having one or more of the following characteristics: (a) comprises a GLP1 variant domain and a stabilizing domain; (b) is a GLP1 receptor agonist; (c) the GLP1 variant domain comprises the amino acid sequence of SEQ ID NO: 5, 6, 7 or 8; (d) binds to the GLP1 receptor; (e) the stabilizing domain comprises an immunoglobulin or a fragment thereof; (f) the stabilizing domain comprises an immunoglobulin Fc fragment; (g) the stabilizing domain comprises an anti-GLP1 receptor antibody or an antigen-binding fragment thereof; (h) is resistant to degradation by blood proteases for at least 72 hours; and (i) results in a significant reduction in blood glucose levels sustained for more than 10 days upon administration of a single dose.

[0012] In one aspect, the present invention provides a nucleic acid molecule encoding a GLP1 variant or a portion thereof, for example, the present invention provides a nucleic acid molecule encoding any of the amino acid sequences selected from the group consisting of SEQ ID NOs: 5, 6, 7, 8, 9, 10, 11, 12 and 13, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.

[0013] The present invention also provides nucleic acid molecules encoding any fusion protein comprising a GLP1 variant.

[0014] In a related aspect, the invention provides recombinant expression vectors capable of expressing a polypeptide comprising a GLP1 variant or a fusion protein comprising a GLP1 variant as described herein. For example, the invention includes recombinant expression vectors comprising any of the nucleic acid molecules described above, i.e., a nucleic acid molecule encoding any GLP1 variant or a fusion protein comprising a GLP1 variant. Also included within the scope of the invention are host cells into which such vectors have been introduced, as well as methods for producing a protein or fragment thereof by culturing the host cell under conditions allowing the production of the protein or fragment thereof, and recovering the protein and fragment produced therein.

[0015] In one aspect, the invention provides a pharmaceutical composition comprising a therapeutically effective amount of at least one recombinant protein or fragment thereof that specifically binds to the GLP1 receptor, and a pharma- ceutically acceptable carrier. In a related aspect, the invention features a composition that is a combination of a GLP1 receptor agonist protein and a second therapeutic agent. In one embodiment, the second therapeutic agent is any agent that is advantageously combined with the GLP1 receptor agonist. Exemplary agents that can be advantageously combined with the GLP1 receptor agonist include, but are not limited to, other agents that activate GLP1 receptor activity (including other proteins or metabolites, etc.) and / or agents that do not directly bind to the GLP1 receptor but alleviate or ameliorate or treat GLP1 receptor-related diseases or disorders (e.g., diabetes). Other combination therapies and co-formulations for the GLP1 receptor agonist proteins of the invention are disclosed elsewhere herein.

[0016] In another aspect, the present invention provides a method of treatment for treating a disease or disorder associated with GLP1 in a subject, such as diabetes, using a GLP1 receptor agonist of the present invention, comprising administering to a subject in need thereof a therapeutically effective amount of a pharmaceutical composition comprising a GLP1 receptor agonist of the present invention. In a particular embodiment, the GLP1 receptor agonist comprises a GLP1 variant or a fusion protein comprising a GLP1 variant. The disorder to be treated is any disease that is ameliorated, alleviated, inhibited or prevented by activation of GLP1 receptor activity. or condition. In certain embodiments, the present invention provides a method for preventing, treating or alleviating at least one symptom of GLP1 receptor-related disease or disorder, comprising administering a therapeutically effective amount of the GLP1 receptor agonist of the present invention to a subject in need thereof. In some embodiments, the present invention provides a method for alleviating or reducing the severity of at least one symptom or sign of GLP1 receptor-related disease or disorder in a subject by administering a therapeutically effective amount of the GLP1 receptor agonist protein of the present invention, wherein the at least one symptom or sign is selected from the group consisting of high blood sugar level, excessive thirst, frequent urination, presence of ketone bodies in urine, fatigue, weight fluctuation, blurred vision, slow-healing pain, frequent infection, swollen or tender gums, obesity, heart disease, stroke, kidney disease, eye disease, nerve damage and high blood pressure. In certain embodiments, the present invention provides methods for reducing weight in overweight or obese subjects, comprising administering to the subject a therapeutically effective amount of a GLP1 receptor agonist of the present invention that binds to the GLP1 receptor and activates GLP1 receptor activity. In certain embodiments, the present invention provides methods for reducing blood glucose levels in a subject, comprising administering to the subject a therapeutically effective amount of a GLP1 receptor agonist of the present invention that binds to the GLP1 receptor and activates GLP1 receptor activity. In some embodiments, the GLP1 receptor agonist can be administered prophylactically or therapeutically to subjects with hyperglycemia or at risk of having hyperglycemia. Subjects at risk include, but are not limited to, elderly subjects, pregnant women, subjects with high HbA1c levels, and subjects with one or more risk factors, including obesity, high blood cholesterol, smoking, excessive alcohol intake, and / or physical inactivity. In certain embodiments, the present invention provides methods for treating type 2 diabetes that is not controlled by treatment with insulin and / or metformin, comprising administering a therapeutically effective amount of a GLP1 receptor agonist of the present invention to a subject in need thereof. In certain embodiments, the GLP1 receptor agonist of the present invention is administered to a subject in need thereof in combination with a second therapeutic agent.The second therapeutic agent can be selected from the group consisting of insulin or insulin analogs, biguanides (e.g., metformin), thiazolidinediones, sulfonylureas (e.g., clopropamide), glinides (e.g., nateglinide), alpha-glucosidase inhibitors, DPP4 inhibitors (e.g., sitagliptin), pramlintide, bromocriptine, SGLT2 inhibitors (e.g., canagliflozin), antihypertensive drugs, statins, aspirin, dietary modification, exercise, and dietary supplements. Other therapeutic agents that can be used in combination with the GLP1 receptor agonist fusion proteins of the present invention are described elsewhere herein. In certain embodiments, the second therapeutic agent can be an agent that helps prevent or reduce any possible side effect(s) associated with the GLP1 receptor agonist of the present invention, if such side effect(s) may occur. The GLP1 receptor agonist can be administered subcutaneously, intravenously, intradermally, intraperitoneally, orally, intramuscularly, or intracranially. The GLP1 receptor agonist may be administered in a dose of about 0.1 mg / kg of the subject's body weight to about 100 mg / kg of the subject's body weight. In certain embodiments, the GLP1 receptor agonist of the present invention may be administered in one or more doses including 0.1 mg to 600 mg.

[0017] The present invention also includes the use of a GLP1 receptor agonist of the present invention in the manufacture of a medicament for treating a disease or disorder that may be caused by stimulation of GLP1 receptor binding and / or activity (e.g., diabetes, including type 2 diabetes).

[0018] Other embodiments will become apparent from a summary of the following detailed description. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0019] Before describing the methods of the present invention, it is to be understood that the invention is not limited to the particular methods and experimental conditions described, as such methods and conditions may vary. The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. It should also be understood that it is not intended that the scope of the present invention be limited solely by the appended claims.

[0020] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by those skilled in the art to which this invention belongs.Although any method and material similar or equivalent to those described herein can be used in the practice or testing of this invention, the preferred method and material are described here.All publications mentioned herein are incorporated herein by reference in their entirety.

[0021] definition The term "GLP1," also known as "glucagon-like peptide 1," refers to a 31 amino acid peptide hormone released from intestinal L-cells following nutritional intake. GLP1 binds to the GLP1 receptor, enhances glucose-responsive insulin secretion from pancreatic β-cells, increases insulin expression, inhibits β-cell apoptosis, promotes β-cell neogenesis, reduces glucagon secretion, delays gastric digestion time, promotes satiety, and increases peripheral glucose disposal. In certain embodiments, the term "GLP1" refers to the mature 31 amino acid peptide hormone (SEQ ID NO: 4) that includes amino acids 7-37 of the full-length GLP1 peptide (SEQ ID NO: 3). The term also includes variants of GLP1, which include 1, 2, 3, 4, 5, or 6 amino acid substitutions, additions, or deletions. For example, the term includes variants that include the amino acid sequence of SEQ ID NO: 5, 6, 7, or 8.

[0022] As used herein, a "stabilization domain" refers to any macromolecule that, when fused to a peptide, increases the in vivo activity and / or stability of the peptide. For example, a stabilization domain can be a stabilization domain that is capable of binding to an immunoglobulin C HThe stable domain may be a polypeptide comprising three domains. In certain embodiments, the stable domain increases the serum half-life of the peptide. In certain embodiments, the stable peptide increases the in vivo efficacy of the peptide. A non-limiting example of a stable domain is the Fc portion of an immunoglobulin, such as an Fc domain of an IgG selected from the isotypes IgG1, IgG2, IgG3, and IgG4, as well as any allotype within each isotype group. In certain embodiments, the stable domain is an Fc fragment or amino acid sequence of 1 to about 200 amino acids in length that contains at least one cysteine ​​residue. As another example, the stable domain may be an immunoglobulin or an antigen-binding fragment thereof. In certain embodiments, the stable domain is an immunoglobulin comprising a heavy chain variable region and a light chain variable region, the immunoglobulin binding to a specific antigen. In certain embodiments, the stable domain may comprise an antigen-binding domain (e.g., of an IgG1 or IgG4 antibody) and an Fc domain, or may comprise only an antigen-binding portion (e.g., a Fab, F(ab')2, or scFv fragment), which may be modified to affect function. In a specific embodiment, the stability domain is an immunoglobulin comprising a heavy chain variable region and a light chain variable region, and the immunoglobulin binds to the GLP1 receptor. In another embodiment, the stability domain is a cysteine ​​residue or a short cysteine-containing peptide. Other stability domains include peptides or polypeptides that include or consist of a leucine zipper, a helix-loop motif, or a coiled-coil motif.

[0023] The term "GLP1 receptor agonist" as used herein refers to a protein that binds to the GLP1 receptor. In the context of the present invention, this term refers to a fusion protein that comprises GLP1 or a GLP1 variant fused to a stable domain. In a particular embodiment, this term includes a fusion protein that comprises a GLP1 variant fused to an immunoglobulin or a fragment thereof. In a specific embodiment, this term includes a fusion protein that comprises GLP1 or a GLP1 variant fused to the N-terminus of the light chain variable region (VL) of an immunoglobulin. In a specific embodiment, this term includes a GLP1 or a GLP1 variant fused to the N-terminus of the VL of an antibody or an antigen-binding fragment thereof that binds to the GLP1 receptor.

[0024] As used herein, the term "antibody" refers to an immunoglobulin molecule composed of four polypeptide chains, two heavy (H) and two light (L) chains inter-connected by disulfide bonds, and multimers thereof (e.g., IgM) or antigen-binding fragments thereof. Each heavy chain comprises (domain C H 1. C H 2 and C H 3), and the heavy chain constant region ("HCVR" or "V H ") or light chain variable region ("LCVR" or "V L Each light chain is composed of an Ig variable region that may be a light chain variable region ("LCVR" or "V L ") and the light chain constant region (C L ) is composed of V H Area and V L The regions can be further subdivided into regions of hypervariability, called complementarity determining regions (CDRs), interspersed with more conserved regions, called framework regions (FRs). H and V Lis composed of three CDRs and four FRs arranged from amino terminus to carboxy terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. In certain embodiments of the invention, the FRs of an antibody (or antigen-binding fragment thereof) may be identical to human germline sequences, or may be naturally occurring, or may be artificially modified. A consensus sequence of amino acids may be defined based on the aligned analysis of two or more CDRs. As used herein, the term "antigen-binding protein" also includes antibodies.

[0025] Substitution of one or more CDR residues or deletion of one or more CDR residues are also possible. Antibodies that can omit one or two CDRs for binding have been described in the scientific literature. Padlan et al. (1995 FASEBJ.9:133-139) analyzed the contact areas between antibodies and their antigens based on published crystal structures and concluded that only about 1 / 5-1 / 3 of the CDR residues actually contact the antigen. Padlan also found many antibodies in which one or two CDRs do not have any amino acids in contact with the antigen (see also Vajdos et al., 2002, J Mol Biol 320:415-428).

[0026] Methods and techniques for identifying CDRs in VR amino acid sequences are well known in the art and can be used to identify CDRs in the designated VR amino acid sequences disclosed herein. Exemplary conventions that can be used to identify CDR boundaries include, for example, Kabat's definition, Chothia's definition, and AbM's definition. In general, Kabat's definition is based on sequence diversity, Chothia's definition is based on the location of structural loop regions, and AbM's definition is a compromise between Kabat's and Chothia's approaches. See, for example, Kabat, "Sequences of Proteins of Immunological Interest," National Institutes of Health, Bethesda, Md. (1991); AI-Lazikani et al., J. Mol. Biol. 273: 927-948 (1997), and Martin et al., Proc. Natl. Acad. Sci. USA 86: 9268-9272 (1989). Public databases are also available to identify CDR sequences within antigen binding proteins or antigen binding domains of antibodies.

[0027] Molecular modeling and / or experimentation can identify CDR residues that are not in contact with the antigen based on previous testing from regions of the Kabat CDRs that lie outside the Chothia CDRs (e.g., residues H60-H65 in CDRH2 are often not required). If a CDR or its residue(s) is missing, it is usually replaced with an amino acid that occupies the corresponding position in another human antibody sequence or a consensus sequence of such sequences. Substitution positions within the CDRs and amino acids for substitution can also be selected by experiment. Experimental substitutions can be conservative or non-conservative substitutions.

[0028] As used herein, the term "antigen-binding portion" of an antigen-binding protein refers to an antigen-binding An "antigen-binding fragment" of a protein, etc., includes any naturally occurring, enzymatically accessible, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds to an antigen to form a complex. As used herein, the term "antigen-binding fragment" of an antigen-binding protein, or "antigen-binding protein fragment" refers to one or more fragments of an antigen-binding protein that retain the ability to specifically bind to the GLP1 receptor. Antigen-binding protein fragments may include Fab fragments, F(ab')2 fragments, Fv fragments, dAb fragments, CDRs, or fragments containing isolated CDRs. In certain embodiments, the term "antigen-binding fragment" refers to a polypeptide fragment of a multispecific antigen-binding molecule. An antigen-binding fragment of an antigen-binding protein or antibody can be derived, for example, from a complete protein molecule using any suitable standard technique, such as proteolytic digestion, or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antigen-binding protein variable and (optionally) constant domains. Such DNA is known and / or readily available, for example, from commercial sources, DNA libraries (including, for example, phage-antibody libraries), or can be synthesized. The DNA can be sequenced and manipulated chemically or by using molecular biology techniques to place one or more variable and / or constant domains in the appropriate conformation, or to introduce codons, generate cysteine ​​residues, modify, add or delete amino acids, etc.

[0029] Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab')2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) the minimal recognition unit consisting of amino acid residues similar to the hypervariable region (e.g., isolated complementarity determining regions (CDRs) such as CDR3 peptides) of an antibody, or a constrained FR3-CDR3-FR4 peptide. Other engineered molecules, domain-specific antibodies, single domain antibodies, domain deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g., monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains are also encompassed within the term "antigen-binding fragment" as used herein.

[0030] An antigen-binding protein or antibody antigen-binding fragment of the invention typically comprises at least one immunoglobulin (Ig) variable domain. A variable domain may be of any size or amino acid composition and generally comprises at least one CDR adjacent to or in frame with one or more framework sequences. L V bound to the domain H In the antigen-binding fragment having the V domain, H Domain and V L The domains may be positioned relative to each other in any suitable arrangement. For example, the variable region may be a dimer, H -V H , V H -V L or V L -V L Alternatively, the antigen-binding fragment of the antigen-binding protein may contain a monomer V dimer. H or V L May contain domains.

[0031] In certain embodiments, the antigen-binding fragment may contain at least one variable domain covalently linked to at least one constant domain. Non-limiting exemplary conformations of the variable and constant domains that may be found in the antigen-binding fragments of the antibodies of the invention include: (i) V H -C H 1;(ii)V H -C H 2;(iii)V H -C H 3;(iv)V H -C H 1-C H 2;(v)V H -C H 1-C H 2-C H 3;(vi)V H -C H 2-C H 3;(vii)V H -C L ;(viii)V L -C H 1;(ix)V L -C H 2;(x)V L -C H 3;(xi)V L -C H 1-C H 2;(xii)V L -C H 1-C H 2-C H 3;(xiii)V L -C H 2-C H 3; and (xiv) V L -C L In any conformation of the variable and constant domains, including any of the exemplary conformations described above, the variable and constant domains may be either directly linked to each other or may be linked by a complete or partial hinge or linker region. The hinge region may consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60 or more) amino acids, which may be used to separate adjacent variable domains in a polypeptide molecule. and / or constant domains. In addition, antigen-binding fragments of the antigen-binding proteins of the present invention may be linked to each other and / or to one or more monomeric V H or V L The domains may include homodimers or heterodimers (or other multimers) of any of the aforementioned variable and constant domain conformations in non-covalent association.

[0032] As with intact protein molecules, antigen-binding fragments can be monospecific or multispecific (e.g., bispecific). Multispecific antigen-binding fragments of antigen-binding proteins typically contain at least two different variable domains, each capable of specifically binding to a different antigen or a different epitope on the same antigen. Any multispecific antigen-binding protein format, including the exemplary bispecific antigen-binding protein formats disclosed herein, can be adapted for use in the context of antigen-binding fragments of antigen-binding proteins of the present invention using routine techniques available in the art.

[0033] As used herein, the terms "fully human antibody," "human antibody," "fully human antigen-binding protein," or "human antigen-binding protein" are intended to include antigen-binding proteins having variable and constant regions derived from human germline immunoglobulin sequences. The human antigen-binding proteins of the invention may include amino acid residues (e.g., mutations introduced by in vitro random or site-specific mutagenesis or by in vivo somatic mutation), e.g., in the CDRs, particularly in CDR3, that are not encoded by human germline immunoglobulin sequences. However, the term "human antigen-binding protein" as used herein is not intended to include antigen-binding proteins in which CDR sequences derived from the germline of another mammalian species (e.g., mouse) have been grafted onto human FR sequences. The term includes antigen-binding proteins or antibodies recombinantly produced in or in the cells of a non-human mammal. The term is not intended to include antigen-binding proteins or antibodies isolated from or produced in a human subject.

[0034] The term "recombinant" as used herein refers to a fusion protein of the invention or a fragment thereof that is made, expressed, isolated or obtained by techniques or methods known in the art as recombinant DNA technology, including, for example, DNA splicing and transgenic expression. The term refers to a fusion protein expressed in a non-human mammal (including a transgenic non-human mammal, such as a transgenic mouse), or cell (e.g., a CHO cell) expression system, or isolated from a recombinant combinatorial human antibody library.

[0035] The terms "specifically bind," or "specifically bind to," and the like, mean that an antibody or antigen-binding fragment thereof forms a complex with an antigen that is relatively stable under physiological conditions. Specific binding is at least about 1×10 -8 M or less (e.g., low K Dindicates stronger binding.) Methods for determining whether two molecules specifically bind are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, isothermal titration calorimetry, and the like.

[0036] As used herein, the term "antigen-binding portion" of an antibody, "antigen-binding fragment" of an antibody, etc., includes any naturally occurring, enzymatically accessible, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds to an antigen to form a complex. As used herein, the term "antigen-binding fragment" of an antigen-binding protein or antibody, or "antibody fragment" refers to one or more fragments of an immunoglobulin protein that retain the ability to bind to the GLP1 receptor.

[0037] As used herein, the term "K D " refers to the equilibrium dissociation constant of a particular protein-antigen interaction.

[0038] The terms "substantial identity" or "substantially identical," when referring to a nucleic acid or a fragment thereof, indicate that, with appropriate nucleotide insertions or deletions, and optimal alignment with another nucleic acid (or its complementary strand), there is at least about 90% nucleotide sequence identity of the nucleotide bases, and more preferably at least about 95%, 96%, 97%, 98% or 99%, as measured by any well-known sequence identity algorithm, such as FASTA, BLAST or GAP, as described below. A nucleic acid molecule having substantial identity to a reference nucleic acid molecule may, in certain cases, encode a polypeptide having the same or substantially similar amino acid sequence as the polypeptide encoded by the reference nucleic acid molecule.

[0039] As applied to polypeptides, the term "substantial similarity" or "substantially similar" means that two peptide sequences share at least 90% sequence identity, and even more preferably at least 95%, 98% or 99% sequence identity, when optimally aligned, such as by the programs GAP or BESTFIT, using default gap weighting. Residue positions that are not identical preferably differ by conservative amino acid substitutions. A "conservative amino acid substitution" is one in which an amino acid residue is replaced by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, conservative amino acid substitutions do not substantially alter the functionality of a protein. When two or more amino acid sequences differ from each other by conservative substitutions, the percentage or degree of similarity can be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. See, for example, Pearson (1994) Methods Mol. Biol. 24:307-331, incorporated herein by reference. Examples of amino acid groups having side chains with similar chemical properties include: 1) aliphatic side chains: glycine, alanine, valine, leucine, and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartic acid and glutamic acid, and 7) sulfur-containing side chains: cysteine ​​and methionine. Preferred conservative amino acid substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamic acid-aspartic acid, and aspartic acid-glutamic acid. Alternatively, a conservative substitution is any change that has a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256:1443-45, which is incorporated herein by reference. A "moderately conservative" substitution is any change that has a non-negative value in the PAM250 log-likelihood matrix.

[0040] Sequence similarity for polypeptides is typically measured using sequence analysis software. Protein analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. For example, GCG software contains programs such as GAP and BESTFIT, which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species, or between a wild-type protein and its muteins. See, for example, GCG version 6.1. Polypeptide sequences can also be compared using FASTA, a program in GCG version 6.1., with default or recommended parameters. FASTA (e.g., FASTA2 and FASTA3) provides alignment and percent sequence identity of the regions of closest overlap between the query and search sequences (Pearson (2000) supra). Another algorithm that is preferred when comparing the sequences of the invention to a database containing a large number of sequences from different organisms is An example algorithm is the computer program BLAST, particularly BLASTP or TBLASTN, using default parameters. See, e.g., Altschul et al., (1990) J. Mol. Biol. 215:403-410 and (1997) Nucleic Acids Res. 25:3389-3402, each of which is incorporated herein by reference.

[0041] By the phrase "therapeutically effective amount" is meant the amount that produces the desired effect for which it is administered. The precise amount will depend on the purpose of the treatment and can be ascertained by one skilled in the art using well-known techniques (see, e.g., Lloyd (1999) The Art, Science and Technology of Pharmaceutical Compounding).

[0042] The term "subject" as used herein refers to an animal, preferably a mammal, more preferably a human, in need of alleviation, prevention and / or treatment of a disease or disorder associated with GLP1. The term includes human subjects having or at risk of having a disease or disorder associated with GLP1. For example, the term includes subjects having or at risk of developing diabetes (e.g., type 2 diabetes). In a particular embodiment, the term includes subjects having or at risk of developing obesity, stroke or myocardial infarction. The term also includes subjects having high blood glucose levels and / or high levels of one or more biomarkers for diabetes, such as HbA1c. The term also includes subjects having diabetes where standard of care therapy (e.g., metformin) is contraindicated or not tolerated, or where the disease is uncontrolled by treatment (e.g., with metformin).

[0043] As used herein, the terms "treat", "treating" or "treatment" refer to the reduction or alleviation of the severity of at least one symptom or sign of a disease or disorder associated with GLP1 by administering a therapeutic agent such as the GLP1 receptor agonist of the present invention to a subject in need thereof. These terms include the inhibition of disease progression or worsening of symptoms. These terms also include a good prognosis of the disease. That is, upon administration of a therapeutic agent such as the GLP1 receptor agonist of the present invention, the subject may have no symptoms or signs or may have low intensity symptoms or signs. For example, a subject with diabetes may have a reduced blood glucose level by administration of the GLP1 receptor agonist of the present invention. The therapeutic agent may be administered to the subject in a therapeutic dose.

[0044] The term "prevent", "preventing" or "prevention" refers to the inhibition of the onset of any symptom or sign of a disease or disorder associated with hyperglycemia by administering the GLP1 receptor agonist of the present invention. This term includes the inhibition of the onset of a symptom or sign of a GLP1 receptor-related disease or disorder in a subject at risk of developing such a disease or disorder.

[0045] Due to its rapid inactivation by the enzyme dipeptidyl peptidase 4 (DPP4), GLP1(7-37) (SEQ ID NO: 4) has a very short circulating half-life (1-2 min). Previous studies have shown that various amino acid substitutions at position 8 of GLP1(7-37) confer increased resistance to DPP4, thereby resulting in an even longer half-life. However, the susceptibility of these molecules to DPP4 cleavage remains (Deacon et al., 1998, Diabetologia 41:271-278). Therefore, there is a need to develop new molecules that are highly resistant to degradation by DPP4.

[0046] The inventors have determined that the first step is the addition of an amino acid (i.e., Ala, Gln) to the N-terminus, or a His or Gln residue in the peptide sequence to provide higher resistance to DPP4. The inventors hypothesized that the first step would be to introduce mutations that lengthen or shorten the amino terminus of GLP1, either by deletion of Ala, to confer greater resistance to DPP4 cleavage. The inventors have shown herein that these novel GLP1 variants are indeed highly resistant to degradation by DPP4. The second step was to compensate for any weakened or reduced GLP1 activity, and thereby increase its potency, by fusing GLP1 with an anti-GLP1 receptor antibody that binds the weakened GLP1 to the GLP1 receptor. Furthermore, the inventors discovered that these fusion proteins had a long blood half-life, likely due to the inclusion of an Fc domain, and provided further reductions in blood glucose levels that were sustained for more than 10 days. The novel GLP1 variants and fusion proteins disclosed herein have significantly improved resistance to degradation by DPP4 in vitro and in vivo, as shown herein, and exhibit greatly improved efficacy in glycemic control. As used herein, the term "significantly improved" or "improved" or "increased" in the context of resistance to degradation by DPP4 refers to increased resistance to degradation upon incubation with DPP4 for more than 4 hours, more than 8 hours, more than 16 hours, more than 24 hours, more than 36 hours, or more than 70 hours, as measured by the assays described herein. As used herein, the term "significantly improved" or "improved" or "increased" in the context of reducing blood glucose levels refers to a sustained reduction in blood glucose levels in a subject for more than 1 day, more than 2 days, more than 3 days, more than 4 days, more than 5 days, more than 6 days, more than 7 days, more than 8 days, more than 9 days, or more than 10 days upon administration of the GLP1 receptor agonist of the present invention.

[0047] The GLP1 receptor agonist of the present invention binds to GLP1 receptor with high affinity, resulting in GLP1 receptor activation.In some embodiments, these proteins are useful for treating subjects suffering from diabetes.When these proteins are administered to a subject in need thereof, they can reduce the blood glucose level in the subject.They can be used alone or as adjunctive therapy with other therapeutic components or modalities known in the field of hyperglycemia treatment.

[0048] The specific GLP1 receptor agonist proteins of the present invention can be used in vitro or in vivo. It can bind to the GLP1 receptor and stimulate its activity, as measured by in vivo assay. The ability of the protein of the present invention to bind to the GLP1 receptor and enhance its activity can be measured using any standard method known to those skilled in the art, including the binding assay or activity assay described herein.

[0049] GLP1 receptor specific antigen binding proteins may not contain other labels or moieties, or they may contain N-terminal or C-terminal labels or moieties. In one embodiment, the label or moiety is biotin. In binding assays, the position of the label (if present) can determine the orientation of the peptide relative to the surface to which it binds. For example, if the surface is coated with avidin, the peptide containing N-terminal biotin is oriented so that the C-terminal part of the peptide is away from the surface. In one embodiment, the label can be a radionuclide, a fluorescent dye, or a label detectable by MRI. In certain embodiments, such labeled antigen binding proteins can be used in diagnostic assays, including imaging assays.

[0050] bioequivalence The GLP1 receptor agonists of the present invention include proteins that have an amino acid sequence that differs from that of the disclosed GLP1 receptor agonists, but that retain the ability to bind to the GLP1 receptor. Such variant GLP1 receptor agonists contain one or more additions, deletions, or substitutions of amino acids when compared to the parent sequence, but exhibit biological activity approximately equal to that of the disclosed GLP1 receptor agonists. Similarly, the GLP1 receptor agonist-encoding DNA sequences of the present invention may contain one or more nucleotide changes when compared to the disclosed sequences. The present invention also encompasses sequences that contain the above additions, deletions, or substitutions, but encode a GLP1 receptor agonist that is substantially biologically equivalent to the GLP1 receptor agonist of the present invention.

[0051] Two proteins are considered to be bioequivalent if, for example, they are pharmaceutical equivalents or substitutes whose rate and extent of absorption do not differ significantly when administered in the same molar dose, either in single or multiple doses, under similar experimental conditions. Some proteins can be considered to be pharmaceutical equivalents or substitutes, and even bioequivalent, if they are equivalent in their extent of absorption but not in their rate of absorption. Such differences in absorption rates are intentional, reflected in the label, are not necessary, for example, to obtain effective body drug concentrations during chronic use, and are not considered medically significant for the particular drug being tested.

[0052] In one embodiment, two GLP1 receptor agonist proteins are bioequivalent if they have no clinically meaningful differences in their safety, purity, or potency.

[0053] In one embodiment, two GLP1 receptor agonist proteins are bioequivalent if a patient can be switched one or more times between the reference formulation and the biologic without an expected increased risk of adverse effects, including clinically significant changes in immunogenicity, or decreased efficacy, compared to continued therapy without such switching.

[0054] In one embodiment, two GLP1 receptor agonist proteins are bioequivalent if they both act through one or more mechanisms of action common to one or more conditions of use, to the extent such mechanisms are known.

[0055] Bioequivalence can be demonstrated by in vitro and / or in vivo methods. Studies that measure bioequivalence include, for example, (a) in vivo studies in humans or other mammals that measure the concentration of the protein or its metabolites in blood, plasma, serum, or other body fluids as a function of time; (b) in vitro studies that correlate with and reasonably predict in vivo bioavailability data in humans; (c) in vivo studies in humans or other mammals that measure the relevant acute pharmacological effects of the protein (or its target) as a function of time; and (d) well-controlled clinical trials that demonstrate the safety, efficacy, or bioavailability or bioequivalence of the antigen binding protein.

[0056] Biologically equivalent variants of the GLP1 receptor agonist protein of the present invention can be constructed, for example, by making various substitutions of residues or sequences, or by deleting terminal or internal residues or sequences that are not required for biological activity.For example, cysteine ​​residues that are not required for biological activity can be deleted or replaced with other amino acids to prevent unnecessary or inappropriate intramolecular disulfide bond formation during renaturation.In other situations, biologically equivalent proteins may include variants that contain amino acid changes that modify the glycosylation characteristics of the protein, for example mutations that eliminate or remove glycosylation.

[0057] Biological characteristics of GLP1 receptor agonists In general, the GLP1 receptor agonists of the present invention function by binding to the GLP1 receptor and upon binding promote activation of the GLP1 receptor. In particular embodiments, the proteins of the present invention bind to the GLP1 receptor with high affinity. For example, the present invention includes GLP1 receptor agonists that result in activation of the GLP1 receptor as measured by luciferase assay (e.g., at 25°C or 37°C), e.g., using the assay format defined in Example 2 herein, or a substantially similar assay. In particular embodiments, the GLP1 receptor agonists are Activates the GLP1 receptor with an EC50 of less than 10 nM, less than 500 pM, or less than 250 pM as measured by luciferase assay.

[0058] The present invention also includes GLP1 receptor agonists that, when administered to a subject in need thereof, reduce blood glucose levels in vivo, for example as shown in Example 3 or in a substantially similar assay. Upon administration, the GLP1 receptor agonist affects improved glycemic control, resulting in reduced blood glucose levels. In certain embodiments, even a single therapeutically effective dose of the GLP1 receptor agonist of the present invention results in significant blood glucose reduction that lasts for more than 10 days.

[0059] The present invention also includes GLP1 receptor agonists that exhibit improved resistance to degradation by blood proteases / peptidases, as measured by mass spectrometry, or a substantially similar method, for example as shown in Example 4 herein. In certain embodiments, the GLP1 receptor agonist is resistant to degradation by dipeptidyl peptidase 4 (DPP4) for more than 4 hours, more than 6 hours, more than 12 hours, more than 24 hours, more than 48 hours, or more than 70 hours, as measured by the assay described in Example 4 herein.

[0060] The GLP1 receptor agonists of the present invention may have one or more of the above biological characteristics, or any combination thereof. Other biological characteristics of the proteins of the present invention will be apparent to those skilled in the art from a review of this disclosure, including the working examples herein.

[0061] Therapeutic Administration and Formulation The present invention provides therapeutic compositions comprising the GLP1 receptor agonists of the present invention. The therapeutic compositions of the present invention are administered with suitable carriers, excipients, and other agents incorporated into the formulation to provide improved mobility, delivery, tolerance, etc. A large number of suitable formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA. These formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, (cationic or anionic) lipid-containing vesicles (such as LIPOFECTIN™), DNA conjugates, anhydrous absorbent pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. Powell et al., "Compendium of excipients for parenteral formulations," PDA (1998) J Pharm Sci. See also Technol 52:238-311.

[0062] The dose of the GLP1 receptor agonist may vary depending on the age and size of the subject to be administered, the target disease, condition, route of administration, etc. When using the antigen-binding protein of the present invention to treat a disease or disorder in an adult patient or to prevent such a disease, it is usually advantageous to administer the antigen-binding protein of the present invention at a single dose of about 0.001 mg to about 100 mg per kg of body weight, more preferably about 0.001 mg to about 60 mg, about 0.01 mg to about 10 mg, or about 0.01 mg to about 1 mg per kg of body weight. The frequency and duration of treatment can be adjusted depending on the severity of the condition. In certain embodiments, the antigen-binding protein of the present invention or antigen-binding fragment thereof can be administered as an initial dose of at least about 0.001 mg to about 100 mg, about 0.001 mg to about 50 mg, about 0.005 mg to about 50 mg, about 0.01 mg to about 40 mg, about 30 mg, or about 10 mg. In certain embodiments, the initial dose can be followed by administration of a second or multiple subsequent doses of the GLP1 receptor agonist in an amount that can be about the same as or less than that of the initial dose, and the subsequent doses can be administered for at least 1 to 3 days, at least 1 week, at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 5 weeks, at least at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 12 weeks, or at least 14 weeks apart.

[0063] A variety of delivery systems are known and can be used to administer the pharmaceutical compositions of the invention, such as encapsulated in liposomes, microparticles, microcapsules, recombinant cells capable of expressing mutant viruses, and receptor-mediated endocytosis is possible (see, e.g., Wu et al. (1987) J. Biol. Chem. 262:4429-4432). Methods of introduction include, but are not limited to, intradermal, transdermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compositions can be administered by any convenient route, such as by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.), and the compositions can be administered together with other bioactive agents. Administration can be systemic or local. The pharmaceutical compositions can also be delivered in vesicles, particularly liposomes (see, e.g., Langer (1990) Science 249:1527-1533).

[0064] The use of nanoparticles for delivering the GLP1 receptor agonist of the present invention is also contemplated herein.Protein-conjugated nanoparticles can be used for both therapeutic and diagnostic applications.Several nanoparticles may be developed and can be conjugated to antigen-binding proteins contained in pharmaceutical compositions to target cells.Nanoparticles for drug delivery are also described, for example, in US8257740, or US8246995, each of which is incorporated herein by reference in its entirety.

[0065] In certain circumstances, the pharmaceutical composition can be delivered in a sustained release system. In one embodiment, a pump can be used. In another embodiment, a polymeric material can be used. In yet another embodiment, the sustained release system can be placed close to the target of the composition, thereby requiring a very small systemic dose.

[0066] The injectable preparations may include dosage forms for intravenous, subcutaneous, intradermal, intracranial, intraperitoneal and intramuscular injections, drip infusions, and the like. These injectable preparations may be prepared by publicly known methods. For example, the injectable preparations may be prepared by, for example, dissolving, suspending or emulsifying the antigen-binding protein or its salt described above in a sterile aqueous or oily medium that is conventionally used for injections. Examples of the aqueous medium for injection include physiological saline, an isotonic solution containing glucose, and other adjuvants that may be used in combination with suitable solubilizing agents such as alcohol (e.g., ethanol), polyalcohol (e.g., propylene glycol, polyethylene glycol), nonionic surfactants [e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) addition product of hydrogenated castor oil)], and the like. Examples of the oily medium include sesame oil, soybean oil, and the like, which may be used in combination with solubilizing agents such as benzyl benzoate, benzyl alcohol, and the like. The injectable solution thus prepared is preferably filled into a suitable ampoule.

[0067] The pharmaceutical composition of the present invention can be delivered subcutaneously or intravenously using a standard needle and syringe. Furthermore, for subcutaneous delivery, a pen delivery device is easily utilized in delivering the pharmaceutical composition of the present invention. Such a pen delivery device may be reusable or disposable. A reusable pen delivery device generally utilizes a replaceable cartridge containing the pharmaceutical composition. After all the pharmaceutical composition in the cartridge has been administered and the cartridge is empty, the empty cartridge can be easily discarded and replaced with a new cartridge containing the pharmaceutical composition. Thus, the pen delivery device can be reused. In a disposable pen delivery device, there is no replaceable cartridge. Instead, a disposable pen delivery device is used. The delivery device is pre-filled with the pharmaceutical composition and held in a reservoir within the device, after which the reservoir is emptied of the pharmaceutical composition the entire device is discarded.

[0068] A number of reusable pen and autoinjector delivery devices have some utility in the subcutaneous delivery of the pharmaceutical compositions of the present invention. Examples include the AUTOPEN™ (Owen Mumford, Inc, Woodstock, UK), the DISETRONIC™ pen (Disetronic Medical Systems, Burghdorf, Switzerland), the HUMALOGMIX75 / 25™ pen, the HUMALOG™ pen, the HUMALIN70 / 30™ pen (Eli Lilly and Co, Indianapolis, IN), the NOVOPEN™ I, II and III (Novo Nordisk, Copenhagen, Denmark), the NOVOPEN JUNIOR™ (Novo Nordisk, Copenhagen, Denmark), the BD™ pen (Becton Dickinson, Franklin, USA), to name just a few. Examples of disposable pen delivery devices that have some application in the subcutaneous delivery of the pharmaceutical compositions of the present invention include, but are certainly not limited to, the SOLOSTAR™ Pen (Sanofi-Aventis), FLEXPEN™ (Novo Nordisk), and KWIKPEN™ (Eli Lilly), SURECLICK™ Autoinjector (Amgen, Thousand Oaks, CA), PENLET™ (Haselmeier, Stuttgart, Germany), EPIPEN (Dey, LP), and HUMIRA™ Pen (Abbott Labs, Abbott Park, IL), to name just a few.

[0069] The above-mentioned pharmaceutical compositions for oral or parenteral use are advantageously prepared in unit dosage forms suitable for matching a certain dose of active ingredient. Such unit dosage forms include, for example, tablets, pills, capsules, injections (ampoules), suppositories, etc. The amount of GLP1 receptor agonist contained is generally about 0.001 to about 100 mg per unit dosage form, especially in the form of injection, and for other dosage forms, the amount of GLP1 receptor agonist is preferably about 0.001 to about 100 mg, and about 0.01 to about 100 mg.

[0070] Therapeutic Uses of GLP1 Receptor Agonists The GLP1 receptor agonist of the present invention is useful for treating and / or preventing diseases or disorders or conditions associated with hyperglycemia, such as diabetes, and / or alleviating at least one symptom associated with such diseases, disorders or conditions. In one embodiment, the GLP1 receptor agonist of the present invention can be administered in a therapeutic dose to a patient with diabetes (e.g., type 2 diabetes).

[0071] In certain embodiments, the GLP1 receptor agonists of the present invention are useful for treating a subject suffering from a disease or disorder selected from the group consisting of diabetes, obesity, insulin resistance, hypertension, dyslipidemia, type 2 diabetes, type 1 diabetes, prediabetes, cardiovascular disease, atherosclerosis, congestive heart failure, coronary heart disease, arteriosclerosis, peripheral arterial disease, stroke, respiratory dysfunction, renal disease, fatty liver disease, nonalcoholic steatohepatitis (NASH), and metabolic syndrome.

[0072] In certain embodiments, the GLP1 receptor agonists of the present invention are useful for treating a subject who is overweight or obese, and / or for preventing or treating one or more obesity-related disorders, such as heart disease, stroke, and diabetes.

[0073] In certain embodiments, the GLP1 receptor agonists of the present invention are useful for treating patients suffering from diabetes and / or preventing one or more complications, such as heart disease, stroke, kidney disease, retinopathy, blindness and nerve damage.

[0074] It is also contemplated herein to use one or more of the GLP1 receptor agonist proteins of the present invention prophylactically in subjects at risk of developing diabetes (e.g., type 2 diabetes).Subjects at risk include, but are not limited to, elderly subjects, pregnant women, and subjects with one or more risk factors, including a family history of obesity, high blood cholesterol, smoking, excessive alcohol intake, and / or physical inactivity.

[0075] In a further embodiment, the protein of the present invention is useful for preparing a pharmaceutical composition or medicament for the treatment of patients suffering from diseases or disorders such as diabetes and obesity. In another embodiment of the present invention, the GLP1 receptor agonist of the present invention is used as an adjunct therapeutic agent together with any other agent or any other therapeutic agent known to those skilled in the art to treat or alleviate diseases or disorders associated with hyperglycemia, such as diabetes (e.g., type 2 diabetes).

[0076] Combination Therapy The combination therapy can include the GLP1 receptor agonist of the present invention and any other therapeutic agent that can be advantageously combined with the GLP1 receptor agonist of the present invention or its bioactive fragment of the present invention.The GLP1 receptor agonist of the present invention can be synergistically combined with one or more drugs or therapeutic agents that are used to treat any disease or disorder associated with hyperglycemia (e.g., diabetes).In some embodiments, the GLP1 receptor agonist of the present invention can be combined with a second therapeutic agent to reduce blood glucose levels in a subject or to alleviate one or more symptoms of diabetes.

[0077] GLP1 receptor agonists of the present invention include insulin (insulin or insulin analogues), insulin sensitizers such as biguanides (e.g. metformin), and insulin secretion stimulants such as thiazolidinediones (e.g. rosiglitazone), sulfonylureas (e.g. clopropamide), and glinides (e.g. nateglinide), alpha-glucosidase inhibitors (e.g. acarbose), dipeptidyl peptidase 4 (DPP4) inhibitors (e.g. sitagliptin), pramlintide, bromocriptine, sodium It may be used in combination with glucose cotransporter type 2 (SGLT-2) inhibitors (e.g., canagliflozin), antihypertensives (e.g., angiotensin-converting enzyme inhibitors, angiotensin receptor antagonists, diuretics, calcium channel antagonists, alpha-adrenergic receptor antagonists, endothelin-1 receptor antagonists, organic nitrates, and protein kinase C inhibitors), statins, aspirin, different GLP1 receptor agonists, nutritional supplements, or any other therapy (e.g., exercise) to treat or manage diabetes. In certain embodiments, the GLP1 receptor agonists of the present invention can be administered in combination with a second therapeutic agent or treatment selected from the group consisting of insulin, insulin analogs, metformin, rosiglitazone, pioglitazone, clopamide, glibenclamide, glimepiride, glipizide, tolazamide, tolbutamide, nateglinide, repaglinide, acarbose, miglitol, exenatide, liraglutide, albiglutide, dulaglutide, sitagliptin, saxagliptin, linagliptin, alogliptin, pramlinitide, immediate release bromocriptine, canagliflozin, dapagliflozin, empagliflozin, dietary modification, and exercise.

[0078] As used herein, the term "in combination with" means that the other therapeutically active ingredient(s) can be administered before, simultaneously with, or after administration of the GLP1 receptor agonist of the present invention. The term "in combination with" does not include sequential administration of a GLP1 receptor agonist and a second therapeutic agent. This also includes administration or simultaneous administration.

[0079] Other therapeutic active ingredient(s) can be administered to the subject before administering the GLP1 receptor agonist of the present invention.For example, if the first component is administered 1 week, 72 hours, 60 hours, 48 ​​hours, 36 hours, 24 hours, 12 hours, 6 hours, 5 hours, 4 hours, 3 hours, 2 hours, 1 hour, 30 minutes, 15 minutes, 10 minutes, 5 minutes, or more than 1 minute before the administration of the second component, the first component can be considered to be administered "before" the second component.In other embodiments, other therapeutic active ingredient(s) can be administered to the subject after administering the GLP1 receptor agonist of the present invention. For example, a first component can be considered to be administered "after" a second component if the first component is administered 1 minute, 5 minutes, 10 minutes, 15 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 ​​hours, 60 hours, 72 hours after administration of the second component. In yet other embodiments, the other therapeutically active ingredient(s) can be administered to a subject simultaneously with administration of a GLP1 receptor agonist of the present invention. "Concurrent administration", for purposes of the present invention, includes, for example, administration of a GLP1 receptor agonist and another therapeutically active ingredient to a subject in a unit dosage form or separate dosage forms administered to the subject within about 30 minutes of each other. When administered in separate dosage forms, each dosage form can be administered via the same route (e.g., both the GLP1 receptor agonist and the other therapeutically active ingredient can be administered intravenously), or each dosage form can be administered via a different route (e.g., the GLP1 receptor agonist can be administered intravenously and the other therapeutically active ingredient can be administered orally). In any case, administration of the components in a unit dosage form or separate dosage forms by the same route, or in separate dosage forms by different routes, is considered to be "co-administration" for the purposes of this disclosure. For the purposes of this disclosure, administration of a GLP1 receptor agonist "before," "concurrently with," or "after" administration of the other therapeutically active ingredient (as these terms are defined herein above) is considered to be administration of a GLP1 receptor agonist "in conjunction with" the other therapeutically active ingredient.

[0080] The present invention includes pharmaceutical compositions in which the GLP1 receptor agonists of the present invention are co-formulated with one or more other therapeutically active ingredient(s) as described elsewhere herein.

[0081] Dosing regimen According to certain embodiments, a single dose of the GLP1 receptor agonist of the present invention (or a pharmaceutical composition comprising a combination of a GLP1 receptor agonist and any other therapeutically active ingredient as mentioned herein) can be administered to a subject in need thereof. According to certain embodiments of the present invention, multiple doses of the GLP1 receptor agonist of the present invention (or a pharmaceutical composition comprising a combination of a GLP1 receptor agonist and any other therapeutically active ingredient as mentioned herein) can be administered to a subject over a defined course of time. The method according to this aspect of the present invention comprises sequentially administering multiple doses of the GLP1 receptor agonist of the present invention to a subject. As used herein, "sequentially administering" refers to administering each dose of the GLP1 receptor agonist to a subject at different time points, for example on different days separated by a predetermined interval (e.g., hours, days, weeks or months). The present invention includes methods comprising sequentially administering to a patient one initial dose of a GLP1 receptor agonist, then one or more secondary doses of a GLP1 receptor agonist, and optionally then one or more tertiary doses of a GLP1 receptor agonist.

[0082] The terms "initial dose", "secondary dose" and "tertiary dose" refer to the administration of the GLP1 receptor agonist of the present invention in chronological order. Thus, the "initial dose" is the dose administered first in a treatment regimen (also called the "baseline dose"), the "secondary dose" is the dose administered after the initial dose, and the "tertiary dose" is the dose administered after the secondary dose. The initial, secondary and tertiary doses may all contain the same amount of GLP1 receptor agonist. Although there are several doses, they may generally differ from each other in terms of frequency of administration.However, in certain embodiments, the amount of GLP1 receptor agonist contained in the first, second and / or third dose differs from each other during the course of treatment (e.g., adjusts upward or downward appropriately).In certain embodiments, one or more doses (e.g., 2, 3, 4 or 5) are administered at the beginning of the treatment regimen as "loading dose", followed by subsequent doses (e.g., "maintenance dose") that are administered less frequently.

[0083] In certain exemplary embodiments of the invention, each secondary and / or tertiary dose is administered 1 to 48 hours after the immediately preceding dose (e.g., 1, 1 and 1 / 2, 2, 2 and 1 / 2, 3, 3 and 1 / 2, 4, 4 and 1 / 2, 5, 5 and 1 / 2, 6, 6 and 1 / 2, 7, 7 and 1 / 2, 8, 8 and 1 / 2, 9, 9 and 1 / 2, 10, 10 and 1 / 2, 11, 11 and 1 / 2, 12, 12 and 1 / 2, 1 1, 3, 13 1 / 2, 14, 14 1 / 2, 15, 15 1 / 2, 16, 16 1 / 2, 17, 17 1 / 2, 18, 18 1 / 2, 19, 19 1 / 2, 20, 20 1 / 2, 21, 21 1 / 2, 22, 22 1 / 2, 23, 23 1 / 2, 24, 24 1 / 2, 25, 25 1 / 2, 26, 26 1 / 2, or even longer). As used herein, the phrase "immediately preceding dose" refers to a dose of a GLP1 receptor agonist in a series of multiple doses administered to a patient just prior to administration of the next dose in the sequence with no intervening doses. In certain embodiments, each secondary and / or tertiary dose is administered every day, every 2nd day, every 3rd day, every 4th day, every 5th day, every 6th day, or every 7th day after the immediately preceding dose. In certain embodiments, each secondary and / or tertiary dose is administered every 0.5 weeks, 1 week, 2 weeks, 3 weeks, or 4 weeks after the immediately preceding dose.

[0084] The method according to this aspect of the invention can include administering any number of secondary and / or tertiary doses of GLP1 receptor agonist to the patient. For example, in certain embodiments, only one secondary dose is administered to the patient. In other embodiments, two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) secondary doses are administered to the patient. Similarly, in certain embodiments, only one tertiary dose is administered to the patient. In other embodiments, two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) tertiary doses are administered to the patient.

[0085] In certain embodiments of the invention, the frequency with which a patient is administered secondary and / or tertiary doses may vary over the course of a treatment regimen. The frequency of administration may also be adjusted by a physician over the course of treatment, depending on the needs of an individual patient following clinical trials.

[0086] dosage The amount of GLP1 receptor agonist administered to a subject according to the method of the present invention is generally a therapeutically effective amount. As used herein, the phrase "therapeutically effective amount" refers to an amount of GLP1 receptor agonist that causes one or more of the following: (a) reducing hyperglycemia levels to normal levels (e.g., preprandial blood glucose levels of 80-130 mg / dL), and / or (b) detectable improvement of one or more symptoms or signs of diabetes.

[0087] In the case of a GLP1 receptor agonist, the therapeutically effective amount is about 0.001 mg to about 100 mg, for example, about 0.001 mg, about 0.002 mg, about 0.003 mg, about 0.004 mg, about 0.005 mg, about 0.006 mg, about 0.007 mg, about 0.008 mg, about 0.009 mg, about 0.01 mg, about 0.02 mg, about 0.03 mg, about 0.04 mg, about 0.05 mg, about 0.06 mg, about 0.07 mg, about 0.08 mg, about 0.09 mg, about 0.1 mg g, about 0.2 mg, about 0.3 mg, about 0.4 mg, about 0.5 mg, about 0.6 mg, about 0.7 mg, about 0.8 mg, about 0.9 mg, about 1 mg, about 2 mg, about 3 mg, about 4 mg, about 5 mg, about 6 mg, about 7 mg, about 8 mg, about 9 mg, about 10mg, about 15mg, about 20mg, about 25mg, about 30mg, about 35mg, about 40mg, about 45mg, about 50mg, about 55mg, about 60mg, about 65mg, about 70mg, about 75mg, about 80mg, about 85mg, about The GLP1 receptor agonist may be about 90 mg, about 95 mg, or about 100 mg. In certain embodiments, 0.005 mg to 50 mg, 0.005 mg to 30 mg, 0.005 mg to 10 mg, 0.1 mg to 10 mg, or 0.1 mg to 5 mg of the GLP1 receptor agonist is administered to a subject in need thereof.

[0088] The amount of GLP1 receptor agonist contained in each dose can be expressed in milligrams of antibody per kilogram of subject body weight (i.e., mg / kg). For example, the GLP1 receptor agonist can be administered to a subject at a dose of about 0.0001 to about 100 mg per kilogram of subject body weight.

[0089] Selected embodiments In embodiment 1, the present invention provides a glucagon-like peptide 1 (GLP1) variant comprising mature GLP1(7-37) (SEQ ID NO: 4) having at least one amino acid modification selected from the group consisting of: (i) an addition of an amino acid to the N-terminus, and (ii) a deletion of an amino acid from the peptide sequence, wherein the GLP1 variant has high resistance to proteolytic cleavage and / or high blood glucose lowering potential.

[0090] In embodiment 2, the present invention provides a GLP1 variant according to embodiment 1, wherein the amino acid modification comprises the addition to the N-terminus of an amino acid selected from the group consisting of alanine (Ala) and glutamine (Gln).

[0091] In embodiment 3, the present invention provides a GLP1 variant according to embodiment 1 or 2, wherein the amino acid modification comprises the addition of Gln to the N-terminus.

[0092] In embodiment 4, the present invention provides a GLP1 variant according to embodiment 1, wherein the amino acid modification comprises a deletion of a histidine (His1) or an alanine (Ala2) from SEQ ID NO:4.

[0093] In embodiment 5, the present invention provides a GLP1 variant according to any one of embodiments 1 to 4, comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 6, 7 and 8.

[0094] In embodiment 6, the present invention provides a GLP1 variant according to embodiment 5, comprising the amino acid sequence of SEQ ID NO:6.

[0095] In embodiment 7, the present invention provides a fusion protein comprising a GLP1 variant described in any one of embodiments 1 to 6 fused to a stable domain, wherein the stable domain is an antigen-binding protein or an antigen-binding fragment thereof that specifically binds to the GLP1 receptor and comprises a heavy chain variable region (HCVR) and a light chain variable region (LCVR).

[0096] In embodiment 8, the present invention provides a fusion protein according to embodiment 7, wherein the GLP1 variant is fused to the N-terminus or C-terminus of the HCVR of the antigen binding protein or antigen binding fragment thereof.

[0097] In embodiment 9, the present invention provides a fusion protein according to embodiment 7, wherein the GLP1 variant is fused to the N-terminus or C-terminus of the LCVR of the antigen binding protein or antigen binding fragment thereof.

[0098] In embodiment 10, the present invention relates to a fusion protein comprising a GLP1 variant according to any one of embodiments 1 to 6 fused to a stabilization domain, wherein the stabilization domain is an immunological A fusion protein that is an Ig or a fragment thereof is provided.

[0099] In embodiment 11, the present invention provides a fusion protein according to embodiment 11, comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 10, 11, 12 and 13.

[0100] In embodiment 12, the present invention provides a fusion protein comprising a GLP1 variant fused to a stabilization domain, wherein the stabilization domain is an antigen binding protein or an antigen binding fragment thereof, and the antigen binding protein or fragment thereof comprises a heavy chain variable region (HCVR) and a light chain variable region (LCVR).

[0101] In embodiment 13, the present invention provides a fusion protein according to embodiment 12, wherein the GLP1 variant is fused to the N-terminus or C-terminus of the HCVR of the antigen binding protein or fragment thereof.

[0102] In embodiment 14, the present invention provides a fusion protein according to embodiment 12, wherein the GLP1 variant is fused to the N-terminus or C-terminus of the LCVR of the antigen binding protein or fragment thereof.

[0103] In embodiment 15, the present invention provides a fusion protein according to any one of embodiments 12 to 14, wherein the antigen binding protein or fragment thereof specifically binds to the GLP1 receptor.

[0104] In embodiment 16, the present invention provides a fusion protein according to any one of embodiments 12 to 15, comprising a GLP1 variant according to any one of embodiments 1 to 15.

[0105] In embodiment 17, the present invention provides a fusion protein according to any one of embodiments 12 to 16, wherein the GLP1 variant comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 6, 7 and 8.

[0106] In embodiment 18, the present invention provides a fusion protein according to embodiment 16 or 17, wherein the GLP1 variant comprises the amino acid sequence of SEQ ID NO:6.

[0107] In embodiment 19, the present invention provides a GLP1 receptor agonist comprising a GLP1 variant, wherein the GLP1 variant is fused to a stabilization domain, and the stabilization domain is an antigen binding protein or an antigen binding fragment thereof, and the antigen binding protein or fragment thereof comprises a heavy chain variable region (HCVR) and a light chain variable region (LCVR).

[0108] In embodiment 20, the present invention provides a GLP1 receptor agonist according to embodiment 19, wherein the GLP1 variant is fused to the N-terminus or C-terminus of the HCVR of the antigen binding protein or fragment thereof.

[0109] In embodiment 21, the present invention provides a GLP1 receptor agonist according to embodiment 19, wherein the GLP1 variant is fused to the N-terminus or C-terminus of the LCVR of the antigen binding protein or fragment thereof.

[0110] In embodiment 22, the present invention provides a GLP1 receptor agonist according to any one of embodiments 19 to 21, wherein the antigen binding protein or fragment thereof specifically binds to the GLP1 receptor.

[0111] In embodiment 23, the present invention provides a GLP1 receptor agonist according to any one of embodiments 19 to 22, comprising a GLP1 variant according to embodiment 1.

[0112] In embodiment 24, the present invention provides a GLP1 receptor agonist according to any one of embodiments 19 to 23, wherein the GLP1 variant comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 6, 7 and 8.

[0113] In embodiment 25, the present invention provides a GLP1 receptor agonist according to embodiment 23 or 24, wherein the GLP1 variant comprises the amino acid sequence of SEQ ID NO:6.

[0114] In embodiment 26, the present invention provides a GLP1 receptor agonist comprising a GLP1 variant, wherein the GLP1 variant is fused to a stable domain, and the stable domain is an immunoglobulin (Ig) or a fragment thereof.

[0115] In embodiment 27, the present invention provides a GLP1 receptor agonist according to embodiment 26, comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 10, 11, 12 and 13.

[0116] In embodiment 28, the present invention provides a pharmaceutical composition comprising a protein according to any one of embodiments 1 to 27 and a pharma- ceutically acceptable carrier or diluent.

[0117] In embodiment 29, the present invention provides an isolated polynucleotide molecule comprising a polynucleotide sequence encoding a GLP1 variant according to any one of embodiments 1-6.

[0118] In embodiment 30, the present invention provides an isolated polynucleotide molecule comprising a polynucleotide sequence encoding the fusion protein according to any one of embodiments 10-11.

[0119] In embodiment 31, the present invention provides an isolated polynucleotide molecule comprising a polynucleotide sequence encoding the GLP1 receptor agonist according to any one of embodiments 26-27.

[0120] In embodiment 32, the present invention provides a vector comprising the polynucleotide sequence described in any one of embodiments 29 to 31.

[0121] In embodiment 33, the present invention provides a cell expressing the vector described in embodiment 32.

[0122] In embodiment 34, the present invention provides a method for reducing blood glucose levels, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of a protein described in any one of embodiments 1 to 27.

[0123] In embodiment 35, the present invention provides the method of embodiment 34, wherein the subject has a disease or disorder selected from the group consisting of diabetes, obesity, insulin resistance, hypertension, dyslipidemia, type 2 diabetes, type 1 diabetes, prediabetes, cardiovascular disease, atherosclerosis, congestive heart failure, coronary heart disease, arteriosclerosis, peripheral arterial disease, stroke, respiratory dysfunction, renal disease, fatty liver disease, nonalcoholic steatohepatitis (NASH), and metabolic syndrome.

[0124] In embodiment 36, the present invention provides a method for preventing, treating or ameliorating at least one symptom, sign or complication of type 2 diabetes, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of a protein described in any one of embodiments 1 to 27.

[0125] In embodiment 37, the present invention provides the method of embodiment 36, wherein the at least one symptom, sign or complication is selected from the group consisting of high blood sugar levels, excessive thirst, frequent urination, presence of ketones in the urine, fatigue, weight fluctuations, blurred vision, slow-healing pain, frequent infections, swollen or tender gums, obesity, heart disease, stroke, kidney disease, eye disease, nerve damage and high blood pressure.

[0126] In embodiment 38, the present invention provides a method according to any one of embodiments 34 to 37, wherein the pharmaceutical composition is administered in combination with a second therapeutic agent or treatment.

[0127] In embodiment 39, the present invention provides the method of embodiment 38, wherein the second therapeutic agent or treatment is selected from the group consisting of insulin or insulin analogues, biguanides (e.g., metformin), thiazolidinediones, sulfonylureas (e.g., clopropamide), glinides (e.g., nateglinide), alpha-glucosidase inhibitors, DPP4 inhibitors (e.g., sitagliptin), pramlintide, bromocriptine, SGLT2 inhibitors (e.g., canagliflozin), antihypertensive drugs, statins, aspirin, dietary modification, exercise, and nutritional supplements.

[0128] In embodiment 40, the present invention provides a method according to any one of embodiments 34 to 39, wherein the pharmaceutical composition is administered subcutaneously, intravenously, intradermally, intraperitoneally, orally, or intramuscularly. EXAMPLES

[0129] The following examples are provided to provide those skilled in the art with a complete disclosure and description of how to make and use the methods and compositions of the present invention, but are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should be accounted for. Unless otherwise indicated, parts are parts by weight, molecular weight is average molecular weight, temperature is in degrees Celsius, room temperature is about 25°C, and pressure is atmospheric or normal pressure. EXAMPLES

[0130] Exemplary Fusion Proteins Comprising GLP1 Due to its rapid inactivation by the enzyme dipeptidyl peptidase 4 (DPP4), GLP1(7-37) has a very short circulating half-life (1-2 min). Previous studies have shown that various amino acid substitutions at position 8 of GLP1(7-37) confer increased resistance to DPP4, thereby resulting in an even longer half-life (Deacon et al., 1998, Diabetologia 41:271-278). However, the susceptibility of these molecules to DPP4 cleavage remains. Therefore, there is a need to develop new molecules that are even more resistant to DPP4.

[0131] To provide higher resistance to DPP4, the first part of the technology is to introduce mutations that lengthen or shorten the amino terminus of GLP1, either by adding amino acids (i.e. Ala, Gln) to the N-terminus or deleting His7 or Ala8 within the peptide sequence, to confer higher resistance to DPP4 cleavage. These modifications also weaken GLP1 activity, and the second part of the technology is to compensate for the reduced activity by binding the receptor with a weakened agonist using an anti-GLP1R antibody by fusing a peptide to the N-terminus of the anti-GLP1R antibody light chain sequence. As a proof of concept, as described below , a modified GLP1(7–37) ligand sequence was fused to the N-terminus of the light chain of a GLP1R antibody.

[0132] Mature GLP1 is a peptide hormone of 31 amino acids including amino acids 7 to 37 of full-length GLP1 (SEQ ID NO: 3), and has the amino acid sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (sequence number 4).

[0133] Mature GLP1 was modified by amino acid deletion or addition at the amino terminus to generate GLP1 variants. Exemplary GLP1 variants are provided below: Des-Ala-GLP1, containing the amino acid sequence HEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 5) Q-GLP1, containing the amino acid sequence QHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 6) A-GLP1, containing the amino acid sequence AHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 7) desH-GLP1, containing the amino acid sequence AEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 8)

[0134] To compensate for the possible reduced activity of the aforementioned GLP1 variants, anti-GLP1R antibodies were used to couple them to the GLP1 receptor (GLP1R) or antibody Fc fragments. Exemplary fusion proteins comprising mature GLP1 or GLP1 variants were prepared using an anti-GLP1 receptor antibody (hereinafter referred to as "mAb1"; see US Patent Application Publication No. 20060275288 [Abbott The GLP1 mutants were generated by fusion of mature GLP1 or GLP1 variants to the N-terminus of the light chain of GLP1-specific ribozymes (Galvanic Acid Lysate-Based Immunoglobulins (GAL)) and are listed below: Des-Ala-GLP1-mAb1 fused to the N-terminus of the light chain of mAb1: Des-Ala-GLP1 (SEQ ID NO: 5) Q-GLP1-mAb1 fused to the N-terminus of the light chain of mAb1: Q-GLP1 (SEQ ID NO: 6) A-GLP1-mAb1 fused to the N-terminus of the light chain of mAb1: A-GLP1 (SEQ ID NO: 7)

[0135] Fusion proteins containing mature GLP1 or GLP1 variants and immunoglobulin Fc fragments were also generated and are listed below: GLP1-hFc (SEQ ID NO: 9) A-GLP1-hFc (SEQ ID NO: 10) Q-GLP1-hFc (SEQ ID NO: 11) Des-Ala-GLP1-hFc (SEQ ID NO: 12) desH-GLP1-hFc (SEQ ID NO: 13)

[0136] Control constructs Comparator: A GLP1 analogue (dulaglutide; Eli Lilly) with an amino acid sequence characteristic of LY2189265 fused to a hIgG4 Fc domain, as disclosed in Glaesner et al., 2010 (Diabetes Metab. Res. Rev. 26:287-296), was used as a comparator (SEQ ID NO: 14) in the following examples. EXAMPLES

[0137] Luciferase assay GLP1 fusion proteins were tested for their ability to stimulate cAMP production in the reporter cell line 293 / FSC11 / Cre-Luc, which stably expresses the human GLP1 receptor and luciferase coding sequences under the control of the cAMP-responsive cre promoter.

[0138] For luciferase bioassay, 293 / FSC11 / Cre-LucGLP1R stable cells were seeded in 96-well assay plates at 30,000 cells / well in OPTIMEM supplemented with 0.1% FBS and then incubated overnight at 37°C in 5% CO2. The following day, human GLP1 (Phoenix#028-13), des-Ala-GLP1-mAb1, Q-GLP1-mAb1, or A-GLP1-mAb1 were tested in this assay to determine the dose response of the test proteins. All test compounds were purified proteins except A-GLP1-mAb1, which was used directly from culture medium after transient transfection of CHO cells with a vector encoding the modified antibody. Material in the culture medium was quantified by ELISA. Test samples were added to the cells at concentrations ranging from 0.02 pM to 100 nM.

[0139] After 5.5 h or overnight incubation at 37°C in 5% CO2, OneGIo reagent (Promega, #E6051) was added to the samples and luciferase activity was then measured using a VictorX (Perkin Elmer) plate reader. Results were analyzed using nonlinear regression (3 parameters) and Prism6 software (GraphPad) to determine EC 50 Got the value.

[0140] As shown in Table 1, the Q- and A-modified mAb1 antibody fusions exhibited EC50 values ​​of 204 pM and 312 pM, respectively, for GLP1R activation.

[0141] [Table 1]

[0142] The EC50 for des-Ala-GLP1-mAb1 was 10 nM. The EC50 for Q- and A-GLP1-hFc was 135 nM and 120 nM, while the EC50 for DesA-GLP1-hFc was undetectable. EXAMPLES

[0143] Effects of GLP1R antibody fusion Q-GLP1 on blood glucose and glucose tolerance in GLP1R-humanized mice The effects of Q-GLP1 fused to the N-terminus of the light chain of an anti-GLP1R antibody (Q-GLP1-mAb1) on blood glucose and glucose tolerance were investigated using human GLP1R protein. The GLP1R-expressing GLP1R-humanized mice were determined in 31 mice. Thirty-one GLP1R-humanized mice were divided into 4 groups of 7-8 animals. Each group received a single subcutaneous injection of isotype control, Q-GLP1-hFc, mAb1, or Q-GLP1-mAb1 at 194 nmol / kg. Mice were bled in captivity on days 0, 1, 4, 7, 11, 14, 16, and 18, and blood glucose was measured on day 22. The mean ± SEM of blood glucose levels at each time point was calculated for each group and is shown in Table 2.

[0144] [Table 2]

[0145] Oral glucose tolerance tests (oGTTs) were performed on days 3 and 9 after an overnight fast with blood glucose measurements at 0, 15, 30, 60, and 120 minutes after bolus glucose gavaging. The mean ± SEM of blood glucose levels at each time point and the area under the glucose curve (AUC) were calculated for each group and are shown in Tables 3 and 4.

[0146] [Table 3]

[0147] [Table 4]

[0148] A single administration of Q-GLP1-mAb1 in normoglycemic GLP1R humanized mice resulted in significant glucose reduction for 14 days, whereas Q-GLP1-hFc or mAb1 had no effect on blood glucose levels (Table 2). Q-GLP1-mAb1 reduced fasting glucose levels and improved glucose tolerance on days 3 and 9 in mice, whereas Q-GLP1-hFc and mAb1 did not. These data suggest that Q-GLP1 or mAb1 antibodies alone do not alter glycemic control, however, the two fusion molecules may exert a glucose-lowering function lasting for 2 weeks after a single injection in normoglycemic animals. EXAMPLES

[0149] Stability of GLP1 mutants The stability of various GLP1 variants and fusion proteins was tested by incubating them with blood proteases and analyzing the cleaved peptides by mass spectrometry.

[0150] In the first experiment, 0.5 μg of each GLP1 fusion protein was added to 50 μL of naive mouse serum. The mixtures were then incubated at 37° C. for 6 and 24 hours, respectively. 1 μL of the serum mixtures was loaded onto a Tris-glycine gel at 0 min, 6 hours, and 24 hours.

[0151] In a second experiment, to further distinguish the stability, 2 μg of each GLP1 fusion protein was incubated with 500 ng of recombinant human DPP4 (R and D system) in PBS (pH 7.4) for 0 min, 1 h, 4 h and 72 h, respectively, at 37° C. One-fifth of the above mixture (corresponding to 400 ng of construct) was loaded onto a Tris-glycine gel.

[0152] For each experiment, a gel slice corresponding to the molecular weight of each construct was excised and subjected to in-gel trypsin digestion. The excised gel slice was destained in 50:50 acetonitrile:NH4HCO3 (50 mM), reduced with 65 mM dithiothreitol (Sigma) for 30 min at 37°C, and then alkylated with 135 mM iodoacetamide (Sigma) for 30 min at room temperature in the dark. Proteins were then digested overnight at 37°C with sequencing-grade modified porcine trypsin (Promega). Peptides were extracted twice with extraction buffer (50% ACN, 5% formic acid in H2O). Peptides extracted from each band were completely dried in a SpeedVac and renatured with 0.1% tetrafluoroacetic acid (TFA) before nanoLC-MS / MS analysis.

[0153] The renatured peptide mixture was analyzed by online reversed-phase (RP) nanoscale capillary liquid chromatography (Easy-nLC1000, Thermo Fisher Scientific). Peptides were separated by chromatographic separation and analyzed by electrospray tandem mass spectrometry (Orbitrap Elite, Thermo Fisher Scientific). The peptide mixture was injected onto a 75 μm i.d. “PepMap RSLC” column (C18, 25 cm, 100 Å, 2 μm, Thermo Fisher Scientific) at a flow rate of 250 nL / min and then eluted with 2%–35% ACN, 0.1% formic acid in a 60 min gradient. The mass spectrometer was operated in data-dependent mode to automatically change between MS and MS / MS acquisition. Survey full-scan MS spectra (m / z 350–2000) were collected in the Orbitrap at a resolution of 120,000. The most intense ions (maximum 10) were sequentially isolated for fragmentation in the hybrid ion trap using collision-induced dissociation (CID) with a target value of 5000 and a normal collision energy of 35%. Target ions already selected for MS / MS were dynamically excluded for 30 s.

[0154] MS and MS / MS peak lists were extracted and searched against an internal protein database using ProteomeDiscoverer 1.4 (Thermo Fisher Scientific). Trypsin digestion was assumed by the full search, and carboxymethylation of cysteine ​​was considered as a fixed modification, and oxidation of methionine as a variable modification. A peptide mass tolerance of 10 ppm, MS / MS mass tolerance of 0.8 Da, and a maximum error tolerance of 1 deletion cleavage were used. Extracted ion areas were computed based on extracted ion chromatograms (XICs) using Thermo Xcaliber software (Thermo Fisher Scientific).

[0155] result To characterize the susceptibility of each construct to cleavage by serum enzymes, the intact peptide (N-terminal peptide), the cleaved peptide (N-terminal peptide after cleavage), and one internal reference peptide (a stable peptide not affected by any modifications in the construct) were monitored for each construct by nanoLC-MS / MS. A decreased ratio of intact peptide to reference peptide and a concomitant increase in the ratio of cleaved peptide to reference peptide suggested enzyme-mediated cleavage of the construct over time. The cleavage percentage was calculated using the following formula: 100×area of ​​cleaved peptide / (area of ​​cleaved peptide+area of ​​uncleaved peptide).

[0156] GLP1-hFc and A-GLP1-hFc were completely cleaved by 6 hours, while desH-GLP1-hFc showed significant cleavage (2%) by 6 hours. Q-GLP1-hFc and the comparator did not show any cleavage after 24 hours of incubation (Table 5).

[0157] [Table 5]

[0158] To further distinguish the stability of Q-GLP1-hFc from the comparator, the two structures were The constructs were mixed with recombinant human DPP4, and for each construct the complete peptide (N-terminal peptide), truncated peptide (N-terminal peptide after cleavage), and one internal reference peptide (stable peptide not affected by any modifications in the construct) were monitored by nanoLC-MS / MS.

[0159] [Table 6]

[0160] The comparator showed significant cleavage (4%) by 4 hours, and over 40% cleavage by 72 hours (Table 6). In contrast, Q-GLP1-hFc did not show any cleavage even after 72 hours of incubation with DPP4 at 37°C.

[0161] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the present invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying drawings. Such modifications are intended to fall within the scope of the appended claims.

Claims

1. A fusion protein comprising a glucagon-like peptide 1 (GLP1) variant, the GLP1 variant comprising mature GLP1(7-37) (SEQ ID NO: 4) with additional amino acids at the N-terminus, the fusion protein having increased resistance to proteolytic cleavage and / or increased blood glucose lowering ability.

2. 2. The fusion protein of claim 1, wherein the amino acid is selected from the group consisting of alanine (Ala) and glutamine (Gln).

3. The fusion protein of claim 1 or 2, wherein the amino acid comprises Gln.

4. The fusion protein of any one of claims 1 to 3, wherein the GLP1 variant comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 6 and 7.

5. The fusion protein according to any one of claims 1 to 4, wherein the GLP1 variant comprises the amino acid sequence of SEQ ID NO:

6.

6. The fusion protein according to any one of claims 1 to 5, further comprising a stabilization domain, the stabilization domain being an antigen-binding protein or an antigen-binding fragment thereof that specifically binds to the GLP1 receptor and comprises a heavy chain variable region (HCVR) and a light chain variable region (LCVR).

7. The fusion protein of claim 6 , wherein the GLP1 variant is fused to the N-terminus or C-terminus of the HCVR of the antigen binding protein or antigen binding fragment thereof.

8. The fusion protein of claim 6 , wherein the GLP1 variant is fused to the N-terminus or C-terminus of the LCVR of the antigen binding protein or antigen binding fragment thereof.

9. The fusion protein according to any one of claims 6 to 8, wherein the stable domain is an antibody or a fragment thereof.

10. 1. A fusion protein comprising a glucagon-like peptide 1 (GLP1) variant fused to a stabilization domain, wherein (i) the GLP1 variant comprises mature GLP1(7-37) (SEQ ID NO: 4) with an N-terminal glutamine (Gln) addition, (ii) the stabilization domain is an antigen-binding protein or antigen-binding fragment thereof that specifically binds to the GLP1 receptor, and (iii) the fusion protein has high resistance to proteolytic cleavage and / or high blood glucose lowering ability.

11. The fusion protein of claim 10, wherein the stable domain is an antibody or antigen-binding fragment thereof comprising HCVR and LCVR.

12. The fusion protein of claim 11 , wherein the GLP1 variant is fused to the N-terminus of the LCVR of an antibody or antigen-binding fragment thereof.

13. The fusion protein according to any one of claims 10 to 12, wherein the GLP1 variant comprises the amino acid sequence of SEQ ID NO:

6.

14. A pharmaceutical composition comprising the fusion protein of any one of claims 1 to 13 and a pharma- ceutically acceptable carrier or diluent.

15. An isolated polynucleotide molecule comprising a polynucleotide sequence encoding the fusion protein of any one of claims 1 to 13.

16. A vector comprising the polynucleotide sequence of claim 15.

17. A cell expressing the vector of claim 16.

18. A method for reducing blood glucose levels, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of a protein according to any one of claims 1 to 13.

19. 20. The method of claim 18, wherein the subject has a disease or disorder selected from the group consisting of diabetes, obesity, insulin resistance, hypertension, dyslipidemia, type 2 diabetes, type 1 diabetes, prediabetes, cardiovascular disease, atherosclerosis, congestive heart failure, coronary heart disease, arteriosclerosis, peripheral arterial disease, stroke, respiratory dysfunction, renal disease, fatty liver disease, nonalcoholic steatohepatitis (NASH), and metabolic syndrome.

20. 14. A method for preventing, treating or alleviating at least one symptom, sign or complication of type 2 diabetes, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of a protein according to any one of claims 1 to 13.

21. 21. The method of claim 20, wherein the at least one symptom, sign or complication is selected from the group consisting of high blood sugar levels, excessive thirst, frequent urination, presence of ketones in the urine, fatigue, weight fluctuations, blurred vision, slow-healing sores, frequent infections, swollen or tender gums, obesity, heart disease, stroke, kidney disease, eye disease, nerve damage and high blood pressure.

22. The method of any one of claims 18 to 21, wherein the pharmaceutical composition is administered in combination with a second therapeutic agent or treatment.

23. 23. The method of claim 22, wherein the second therapeutic agent or treatment is selected from the group consisting of insulin or insulin analogs, metformin, thiazolidinediones, sulfonylureas, biguanides, clopropamide, glinides, alpha glucosidase inhibitors, nateglinide, DPP4 inhibitors, pramlintide, sitagliptin, bromocriptine, SGLT2 inhibitors, canagliflozin, antihypertensive drugs, statins, aspirin, dietary modification, exercise, and nutritional supplements.

24. The method according to any one of claims 18 to 23, wherein the pharmaceutical composition is administered subcutaneously, intravenously, intradermally, intraperitoneally, orally, or intramuscularly.

Images