Compositions and methods for treating sensorineural hearing loss using a stereocillin dual vector system

Abstract

The present disclosure provides compositions containing a polynucleotide encoding a stereocillin protein under the regulatory control of an outer hair cell-specific promoter, as well as a two-vector system containing said polynucleotide that can be used to promote expression of stereocillin specifically in outer hair cells. Additionally, the compositions described herein may be used to treat subjects with hearing loss, such as hearing loss associated with a mutation in stereocillin, or at risk of developing hearing loss.

Description

[Technical field]

[0001] Sequence Listing This application contains a Sequence Listing that has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. The ASCII copy created on May 4, 2022 has the name 51471-011WO2_Sequence_Listing_5_4_22_ST25 and is 113,251 bytes in size.

[0002] Technical Field Described herein are compositions and methods for the treatment of hearing loss, particularly forms of disease associated with mutations in STRC, by stereocillin (STRC) gene therapy, where expression of the STRC gene is under the regulatory control of the oncomodulin (OCM) promoter. The present disclosure provides a two-vector expression system comprising a first nucleic acid vector containing a polynucleotide encoding the N-terminal portion of the stereocillin protein and a second nucleic acid vector containing a polynucleotide encoding the C-terminal portion of the stereocillin protein. These vectors can be used to increase expression of or provide wild-type STRC to a cell or subject, for example, a subject suffering from hearing loss (e.g., sensorineural hearing loss). [Background technology]

[0003] Sensorineural hearing loss is a type of hearing loss caused by defects in the cells of the inner ear or in the neural pathways that project from the inner ear to the brain. Although sensorineural hearing loss is often acquired and can be caused by noise, infection, head trauma, ototoxic drugs, or aging, there are also congenital forms of sensorineural hearing loss that are associated with autosomal recessive mutations. One such form of autosomal recessive sensorineural hearing loss is associated with mutations in the stereocillin (STRC) gene. Stereocilin is a large protein encoded by the STRC gene at chromosome 15q15, which contains 29 exons spanning approximately 19 kb of the genome. The STRC gene is tandemly duplicated, where the second copy contains a premature stop codon within exon 20, thereby generating a STRC pseudogene. Previous studies have identified mutations in STRC in families with autosomal recessive nonsyndromic sensorineural hearing loss (Verpy et al., Nat. Genet. 29:345-9 (2001)). Expression of the stereocillin protein is restricted to stereocilia in the hair bundles of inner ear hair cells. The stereocillin protein is thought to form the horizontal upper connector and tectorial attachment crown required for normal function of the hearing apparatus (Avan et al., PNAS 116:25948-57 (2019); Verpy et al., J. Comp. Neurol. 519:194-210 (2011)). Mice lacking stereocillin have been shown to exhibit abnormal hair cell bundles with poor cohesion and hearing impairment (Verpy et al., Nature, 456:255-8 (2008)).

[0004] In recent years, efforts to treat hearing loss have increasingly focused on gene therapy as a possible solution; however, the STRC gene is too large to amenable to treatment using standard gene therapy approaches. New therapies to treat STRC-related sensorineural hearing loss are needed. Summary of the Invention

[0005] The present invention provides compositions and methods for treating sensorineural hearing loss in a subject, e.g., a human subject. The compositions and methods of the present disclosure relate to a dual vector system for delivering a polynucleotide encoding a stereocillin protein to a subject with sensorineural hearing loss or at risk of developing sensorineural hearing loss (e.g., a subject with a mutation in STRC). For example, using the compositions and methods described herein, a first nucleic acid vector and a second nucleic acid vector, each encoding a portion of a functional stereocillin protein, may be delivered to a subject by viral gene therapy. The compositions and methods described herein may be used to increase the expression of wild-type stereocillin protein in cochlear hair cells (e.g., outer hair cells).

[0006] In a first aspect, the present invention provides a two-vector system comprising: (a) a first nucleic acid vector comprising an oncomodulin (OCM) promoter having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to any one of SEQ ID NOs: 1-3 operably linked to a first polynucleotide encoding an N-terminal portion of a stereocillin protein; and (b) a second nucleic acid vector comprising a second polynucleotide encoding a C-terminal portion of a stereocillin protein.

[0007] In some embodiments, the first polynucleotide partially overlaps with the second polynucleotide. In some embodiments, the first polynucleotide and the second polynucleotide have an overlapping region having a length of at least 200 bases (b) (e.g., at least 200b, 300b, 400b, 500b, 600b, 700b, 800b, 900b, 1.0 kilobase (kb), 1.1 kb, 1.2 kb, 1.3 kb, 1.4 kb, 1.5 kb, or more). In these embodiments, when introduced into a mammalian cell, the first and second nucleic acid vectors undergo homologous recombination to form a recombinant polynucleotide encoding a full-length stereocillin protein. In some embodiments, the first nucleic acid vector comprises a polynucleotide comprising the sequence of nucleotides 225-4574 of SEQ ID NO:43. In some embodiments, the second nucleic acid vector comprises a polynucleotide comprising the sequence of nucleotides 211-4219 of SEQ ID NO:44.

[0008] In some embodiments, the first nucleic acid vector comprises a splice donor signal sequence located at the 3' end of the first polynucleotide and the second nucleic acid vector comprises a splice acceptor signal sequence located at the 5' end of the second polynucleotide, hi some embodiments, the first and second polynucleotides do not overlap.

[0009] In some embodiments, the first nucleic acid vector comprises a splice donor signal sequence located at the 3' end of the first polynucleotide and a first recombination induction region located 3' of the splice donor signal sequence, and the second nucleic acid vector comprises a second recombination induction region, a splice acceptor signal sequence at 3' of the recombination induction region, and a second polynucleotide at 3' of the splice acceptor signal sequence. In some embodiments, the first and second polynucleotides do not overlap. In some embodiments, the first recombination induction region and the second recombination induction region are the same. In some embodiments, the first recombination induction region and the second recombination induction region are AP gene fragments. In some embodiments, the AP gene fragment comprises or consists of any one of SEQ ID NOs: 47-52. In some embodiments, the AP gene fragment comprises or consists of SEQ ID NO: 50. In some embodiments, the first nucleic acid vector further comprises a degradation signal sequence located 3' of the recombination induction region, and the second nucleic acid vector further comprises a degradation signal sequence located between the recombination induction region and the splice acceptor signal sequence. In some embodiments, the first nucleic acid vector comprises a polynucleotide comprising the sequence of nucleotides 225 to 4454 of SEQ ID NO:45; and the second nucleic acid vector comprises a polynucleotide comprising the sequence of nucleotides 257 to 3597 of SEQ ID NO:46.

[0010] In some embodiments, the second nucleic acid vector further comprises an OCM promoter having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to the nucleic acid sequence of any one of SEQ ID NOs: 1-3 operably linked to the second polynucleotide, the promoter being located 5' of the second polynucleotide. In some embodiments, the OCM promoter in the second nucleic acid vector is the same (i.e., has the same nucleotide sequence) as the OCM promoter in the first nucleic acid vector. In some embodiments, the OCM promoter in the second nucleic acid vector has a different nucleotide sequence than the OCM promoter in the first nucleic acid vector.

[0011] In some embodiments, the first nucleic acid vector further comprises a polynucleotide encoding an N-terminal intein (N-intein) located 3' to the first polynucleotide. In some embodiments, the second nucleic acid vector further comprises a polynucleotide encoding a C-terminal intein (C-intein) located between the OCM promoter and the second polynucleotide. In some embodiments, the N-intein and C-intein are components of a split intein trans-splicing system.

[0012] In some embodiments, the first vector and / or the second vector comprises an intein degradation signal. In some embodiments, the degradation signal is an N-degron and / or a C-degron. In some embodiments, the N-degron and / or the C-degron are independently a CL1, PB29, SMN, CIITA, or ODC degron. In some embodiments, the degradation signal is an E. coli dihydrofolate reductase (ecDHFR) degradation signal. In some embodiments, the degradation signal is the degradation domain of FKBP12 (Banaszynski et al., Cell, 126:995-1004, 2006). In some embodiments, the degradation signal is the degradation domain of PEST (Rechsteiner and Rogers, Trends Biochem. Sci. 21:267-271, 1996). In some embodiments, the degradation signal is a UbR tag ubiquitination signal (Chassin et al., Nat. Commun. 10:2013, 2019). In some embodiments, the degradation signal is a destabilizing mutation in human ELRBD (Miyazaki et al., J. Am. Chem. Soc., 134:3942-3945, 2012).

[0013] In some embodiments, the first and second vectors, when introduced into a mammalian cell, produce first and second fusion proteins, respectively, where the first fusion protein comprises an N-terminal portion of stereocilin and an N-intein located 3' thereto, and the second fusion protein comprises a C-intein and a C-terminal portion of stereocilin located 3' thereto. In some embodiments, the C-terminus of the N-intein of the first fusion protein and the N-terminus of the C-intein of the second fusion protein can form a peptide bond, thereby generating a polypeptide that comprises, from the N-terminus to the C-terminus, the N-terminal portion of stereocilin, the N-intein, the C-intein, and the C-terminal portion of stereocilin, where the combined N-intein and C-intein can self-cleave and ligate the C-terminus of the N-terminal portion of stereocilin and the N-terminus of the C-terminal portion of stereocilin, thereby generating a full-length stereocilin protein.

[0014] In some embodiments, the split intein trans-splicing system is derived from one or more bacterial DnaE genes. In some embodiments, the one or more bacteria are Nostoc punctiforme (Npu), Synechocystis sp. PCC6803 (Ssp), Fischerella sp. flagelliforme (Nfl), Crocosphaera watsonii (Cwa) WH8502, Chroococcidiopsis cubana (Ccu) CCALA043, Trichodesmium erythraeum (Ter), Rhodothermus marinus (Rma), Saccharomyces cerevisiae (Sce), Saccharomyces castellii (Sca), Saccharomyces unisporus (Sun), Zygosaccharomyces In some embodiments, the split intein trans-splicing system is derived from a multiple sequence alignment study of DnaE to identify a consensus design (e.g., Cfa) to engineer a split intein with desired stability and activity.

[0015] In some embodiments, the N-intein has the sequence of any one of SEQ ID NOs: 8, 10, 13, 15, 17-22, 27, 29, 31, 33, 35, 37, and 39, and the C-intein has the sequence of any one of SEQ ID NOs: 9, 11, 12, 14, 16, 23-26, 28, 30, 32, 34, 36, 38, and 40. In some embodiments, the N-intein has the sequence of SEQ ID NO: 8, and the C-intein has the sequence of SEQ ID NO: 9. In some embodiments, the N-intein has the sequence of SEQ ID NO: 8, and the C-intein has the sequence of SEQ ID NO: 11. In some embodiments, the N-intein has the sequence of SEQ ID NO: 8, and the C-intein has the sequence of SEQ ID NO: 12. In some embodiments, the N-intein has the sequence of SEQ ID NO: 10, and the C-intein has the sequence of SEQ ID NO: 9. In some embodiments, the N-intein has the sequence of SEQ ID NO: 10, and the C-intein has the sequence of SEQ ID NO: 11. In some embodiments, the N-intein has a sequence of SEQ ID NO: 10 and the C-intein has a sequence of SEQ ID NO: 12. In some embodiments, the N-intein has a sequence of SEQ ID NO: 13 and the C-intein has a sequence of SEQ ID NO: 14. In some embodiments, the N-intein has a sequence of SEQ ID NO: 15 and the C-intein has a sequence of SEQ ID NO: 16. In some embodiments, the N-intein has a sequence of SEQ ID NO: 17 and the C-intein has a sequence of SEQ ID NO: 23. In some embodiments, the N-intein has a sequence of SEQ ID NO: 20 and the C-intein has a sequence of SEQ ID NO: 24. In some embodiments, the N-intein has a sequence of SEQ ID NO: 21 and the C-intein has a sequence of SEQ ID NO: 25. In some embodiments, the N-intein has a sequence of SEQ ID NO: 22 and the C-intein has a sequence of SEQ ID NO: 26. In some embodiments, the N-intein has a sequence of SEQ ID NO: 27 and the C-intein has a sequence of SEQ ID NO: 28. In some embodiments, the N-intein has a sequence of SEQ ID NO: 29 and the C-intein has a sequence of SEQ ID NO: 30. In some embodiments, the N-intein has the sequence of SEQ ID NO:31 and the C-intein has the sequence of SEQ ID NO:32.In some embodiments, the N-intein has a sequence of SEQ ID NO: 33 and the C-intein has a sequence of SEQ ID NO: 34. In some embodiments, the N-intein has a sequence of SEQ ID NO: 35 and the C-intein has a sequence of SEQ ID NO: 36. In some embodiments, the N-intein has a sequence of SEQ ID NO: 37 and the C-intein has a sequence of SEQ ID NO: 38. In some embodiments, the N-intein has a sequence of SEQ ID NO: 39 and the C-intein has a sequence of SEQ ID NO: 40. In some embodiments, the N-intein has a sequence of any one of SEQ ID NOs: 17-22 and the C-intein has a sequence of any one of SEQ ID NOs: 23-26.

[0016] In some embodiments, the split intein trans-splicing system comprises one or more inteins that trans-splice a protein only upon contact with a ligand, hi some embodiments, the ligand is selected from the group consisting of 4-hydroxytamoxifen, a peptide, a protein, a polynucleotide, an amino acid, or a nucleotide.

[0017] In some embodiments, the first nucleic acid vector further comprises a polynucleotide encoding a signal peptide. In some embodiments, the polynucleotide encoding the signal peptide is positioned 5' of the polynucleotide encoding the N-terminal portion of the stereocillin protein. In some embodiments, the polynucleotide encoding the signal peptide is positioned 3' of the polynucleotide encoding the N-terminal portion of the stereocillin protein. In some embodiments, the second nucleic acid vector further comprises a polynucleotide encoding a signal peptide. In some embodiments, the polynucleotide encoding the signal peptide is positioned 5' of the polynucleotide encoding the C-terminal portion of the stereocillin protein. In some embodiments, the polynucleotide encoding the signal peptide is positioned 3' of the polynucleotide encoding the C-terminal portion of the stereocillin protein.

[0018] In some embodiments, neither the first polynucleotide nor the second polynucleotide encodes the full-length stereocillin protein. In some embodiments, each of the first polynucleotide and the second polynucleotide encodes about half of the stereocillin protein sequence.

[0019] In some embodiments, the second nucleic acid vector further comprises a poly(A) sequence 3' to the second polynucleotide. In some embodiments, the first and second nucleic acid vectors do not include an untranslated region (UTR) of STRC. In some embodiments, the first and second nucleic acid vectors include a UTR of STRC. In some embodiments, the first nucleic acid vector includes a 5'UTR of STRC 5' of the first polynucleotide. In some embodiments, the second nucleic acid vector includes a 3'UTR of STRC 3' of the second polynucleotide.

[0020] In some embodiments, the first and second polynucleotides encoding a stereocillin protein do not contain introns (e.g., the first and second polynucleotides are portions of a STRC cDNA). In some embodiments, the first and second polynucleotides encoding a stereocillin protein contain introns.

[0021] In some embodiments, the OCM promoter has at least 85% (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO: 1. In some embodiments, the OCM promoter has at least 85% (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:2. In some embodiments, the OCM promoter has at least 85% (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:3.

[0022] In some embodiments, the two-vector system can direct cochlear outer hair cell (OHC)-specific expression of full-length stereocillin protein in mammalian cochlear OHCs. In some embodiments, the mammalian OHCs are human OHCs. In some embodiments, the mammalian OHCs are mouse OHCs.

[0023] In some embodiments, the stereocillin protein is a human stereocillin protein having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:4. In some embodiments, the stereocillin protein has the sequence of SEQ ID NO:4. In some embodiments, the human stereocillin protein is encoded by a polynucleotide having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:6. In some embodiments, a polynucleotide having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:6 encodes the stereocillin protein of SEQ ID NO:4. In some embodiments, the human stereocillin protein is encoded by a polynucleotide having the sequence of SEQ ID NO:6. In some embodiments, the STRC protein is a mouse stereocillin protein having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:5. In some embodiments, the mouse stereocillin protein has the sequence of SEQ ID NO:5. In some embodiments, the mouse stereocillin protein is encoded by a polynucleotide having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:7.In some embodiments, a polynucleotide having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:7 encodes a stereocillin protein of sequence 5. In some embodiments, a mouse stereocillin protein is encoded by a polynucleotide having the sequence of SEQ ID NO:7.

[0024] In some embodiments, the first and second vectors are viral vectors, plasmids, cosmids, or artificial chromosomes. In some embodiments, the first and second vectors are viral vectors. In some embodiments, the viral vectors are adeno-associated viral (AAV) vectors, adenoviral vectors, or lentiviral vectors. In some embodiments, the first and second vectors are AAV vectors. In some embodiments, each of the first and second AAV vectors has an AAV1, AAV2, AAV2quad(YF), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ / 8, DJ / 9, 7m8, PHP.B, PHP.eb, or PHP.S capsid. In some embodiments, each of the first and second AAV vectors has an AAV1 capsid. In some embodiments, each of the first and second AAV vectors has an AAV9 capsid. In some embodiments, each of the first and second AAV vectors comprises an AAV6 capsid. In some embodiments, each of the first and second AAV vectors has an AAV8 capsid. In some embodiments, each of the first and second AAV vectors has an Anc80 capsid. In some embodiments, each of the first and second AAV vectors has an Anc80L65 capsid. In some embodiments, each of the first and second AAV vectors has a DJ / 9 capsid. In some embodiments, each of the first and second AAV vectors has a 7m8 capsid. In some embodiments, each of the first and second AAV vectors has an AAV2 capsid. In some embodiments, the first AAV vector and the second AAV vector each have a PHP.B capsid. In some embodiments, the first AAV vector and the second AAV vector each have an AAV2quad(YF) capsid.

[0025] In another aspect, the invention provides a pharmaceutical composition comprising the two-vector system of the above aspects and embodiments, in some embodiments, the composition further comprises a pharma- ceutically acceptable carrier, diluent, or excipient.

[0026] In another aspect, the invention provides a cell (e.g., a mammalian cell, e.g., a human cell, such as an OHC, e.g., an OHC having a pathogenic mutation in the STRC gene) comprising the two-vector system of any of the preceding aspects and embodiments. In some embodiments, the cell is a mammalian OHC. In some embodiments, the mammalian OHC is a human OHC.

[0027] In another aspect, the present disclosure provides a method for expressing a stereocillin protein in a mammalian cell by contacting the cell with the two-vector system or pharmaceutical composition of the above aspects and embodiments. In some embodiments, the cell is a cochlear hair cell. In some embodiments, the cell is an OHC. In some embodiments, the cell is a human cell. In some embodiments, the cell is present in a subject (e.g., the contacting occurs in vivo).

[0028] In another aspect, the present invention provides a method for treating a subject having or at risk of developing sensorineural hearing loss by administering a therapeutically effective amount of the two-vector system or pharmaceutical composition of the above aspects and embodiments to the inner ear of the subject. In some embodiments, the sensorineural hearing loss is hereditary sensorineural hearing loss. In some embodiments, the hereditary hearing loss is autosomal recessive hearing loss. In some embodiments of any of the above aspects, the hearing loss is associated with loss of OHCs or dysfunction of OHCs. In some embodiments, the hearing loss is associated with abnormal deflection of OHC stereocilia bundles or impaired connectivity between OHC bundles and the tectorial membrane.

[0029] In another aspect, the invention provides a method for increasing STRC expression (e.g., expression of wild-type STRC, e.g., producing wild-type stereocillin protein) in a subject in need thereof, the method comprising administering a therapeutically effective amount of a two-vector system or pharmaceutical composition of the above aspects and embodiments to the inner ear of the subject.

[0030] In another aspect, the invention provides a method of preventing or reducing damage or death of OHCs in a subject in need thereof comprising administering to the inner ear of the subject an effective amount of a two-vector system or pharmaceutical composition of any of the preceding aspects and embodiments.

[0031] In another aspect, the invention provides a method of increasing OHC survival in a subject in need thereof comprising administering to the inner ear of the subject an effective amount of a two-vector system or pharmaceutical composition of any of the preceding aspects and embodiments.

[0032] In another aspect, the invention provides a method of increasing or improving attachment of OHC hair bundles to the tectorial membrane in a subject in need thereof, comprising administering to the inner ear of the subject an effective amount of a two-vector system or pharmaceutical composition of any of the preceding aspects and embodiments.

[0033] In some embodiments of any of the aforementioned aspects, the subject has a mutation in STRC. In some embodiments of any of the aforementioned aspects, the subject has been identified as having a mutation in STRC. In some embodiments of any of the aforementioned aspects, the method further comprises identifying the subject as having a mutation in STRC before administering the two-vector system or pharmaceutical composition. In some embodiments of any of the aforementioned aspects, the subject has autosomal recessive deafness 16 (DFNB16). In some embodiments of any of the aforementioned aspects, the subject has been identified as having DFNB16.

[0034] In some embodiments of any of the aforementioned aspects, the method further comprises assessing the subject's hearing (e.g., assessing hearing using standard tests such as audiometry, auditory brainstem response (ABR), electrocochleography (ECOG), or otoacoustic emissions) prior to administering the two-vector system or pharmaceutical composition.

[0035] In some embodiments of any of the aforementioned aspects, the method further includes assessing the subject's hearing (e.g., assessing hearing using a standard test such as audiometry, ABR, ECOG, or otoacoustic emissions) after administering the two-vector system or pharmaceutical composition.

[0036] In some embodiments of any of the above aspects, the two-vector system or pharmaceutical composition is administered locally. In some embodiments, the two-vector system or pharmaceutical composition is administered to the subject's ear (e.g., administered to the inner ear, e.g., administered into the perilymph or endolymph, e.g., administered into or through the oval window, round window or horizontal semicircular canal, or by transtympanic or intratympanic injection). In some embodiments, the vectors in the two-vector system are administered simultaneously. In some embodiments, the vectors in the two-vector system are administered sequentially.

[0037] In some embodiments of any of the foregoing aspects, the nucleic acid vector or composition is administered in an amount sufficient to prevent or reduce hearing loss, delay the onset of hearing loss, slow the progression of hearing loss, improve hearing, improve speech discrimination, improve hair cell function, prevent or reduce hair cell damage, prevent or reduce hair cell death, promote or increase hair cell survival, improve attachment of OHC hair bundles to the tectorial membrane, or increase STRC expression in hair cells.

[0038] In some embodiments of any of the aforementioned aspects, the subject is a human. In another aspect, the present invention provides a kit containing the two-vector system or pharmaceutical composition of the above aspects and embodiments.

[0039] definition As used herein, the term "about" refers to a value within 10% above or below the stated value.

[0040] As used herein, "administration" refers to providing or giving a therapeutic agent (e.g., a two-vector system containing an oncomodulin (OCM) promoter operably linked to a polynucleotide encoding a stereocillin protein) to a subject by any effective route. Exemplary administration routes are described herein below.

[0041] As used herein, the phrase "administering to the inner ear" refers to providing or imparting a therapeutic agent described herein to a subject by any route that allows for transduction of inner ear cells. Exemplary routes of administration to the inner ear include administration to the perilymph or endolymph, for example, to or through the oval window, round window, or semicircular canal (e.g., the horizontal semicircular canal), or by transtympanic or intratympanic injection, for example, to OHCs.

[0042] As used herein, the term "cell type" refers to a group of cells that share a phenotype that is statistically separable based on gene expression data. For example, cells of a common cell type may share similar structural and / or functional characteristics, such as similar gene activation patterns and antigen presentation properties. Cells of a common cell type may include cells isolated from a common tissue (e.g., epithelial, nervous, connective, or muscle tissue) and / or a common organ, tissue system, blood vessel, or other structure and / or region in the body.

[0043] As used herein, the term "cochlear hair cells" refers to a specialized group of cells in the inner ear that are involved in the detection of sound. There are two types of cochlear hair cells: inner hair cells and outer hair cells. Damage to cochlear hair cells and genetic mutations that disrupt the function of cochlear hair cells are associated with hearing loss and hearing loss.

[0044] As used herein, the terms "conservative mutation," "conservative substitution," and "conservative amino acid substitution" refer to the substitution of one or more amino acids with one or more different amino acids that exhibit similar physicochemical properties, such as polarity, electrostatic charge, and steric bulk. These properties are summarized in Table 1 below for each of the 20 naturally occurring amino acids.

[0045] [Table 1]

[0046] For the purposes of this Table, the family of conservative amino acids includes: (i) G, A, V, L, and I; (ii) D and E; (iii) C, S, and T; (iv) H, K, and R; (v) N and Q; and (vi) F, Y, and W. Thus, a conservative variation or substitution is one that replaces an amino acid with a member of the same amino acid family (e.g., Ser with Thr, Lys with Arg).

[0047] As used herein, the term "degradation signal sequence" refers to a sequence (e.g., a nucleotide sequence that can be translated into an amino acid sequence) that mediates degradation of a polypeptide in which it is contained. Degradation signal sequences can be included in the nucleic acid vectors of the invention to reduce or prevent expression of portions of the stereocillin protein that have not been recombined and / or spliced.

[0048] The terms "derived from" and "derivative" as used herein refer to a nucleic acid, peptide, or protein, or a variant or analog thereof, that contains one or more mutations and / or chemical modifications compared to a corresponding full-length wild-type nucleic acid, peptide, or protein. Non-limiting examples of chemical modifications involving nucleic acids include, for example, modifications to the base moiety, sugar moiety, phosphate moiety, phosphate-sugar backbone, or combinations thereof.

[0049] As used herein, the terms "effective amount", "therapeutically effective amount" and "sufficient amount" of a composition, vector construct, or viral vector described herein refer to an amount sufficient to achieve a beneficial or desired result, including a clinical result, when administered to a subject, including a mammal, e.g., a human, and thus "effective amount" or its synonyms depend on the context in which it is applied. For example, in the context of treating sensorineural hearing loss, it is the amount of the composition, vector construct, or viral vector sufficient to achieve a therapeutic response compared to the response obtained without administration of the composition, vector construct, or viral vector. The amount of a given composition described herein that corresponds to such an amount will vary depending on various factors, such as, for example, a given drug, pharmaceutical formulation, route of administration, type of disease or disorder, subject identity (e.g., age, sex, weight) or host being treated, but can nevertheless be routinely determined by one of skill in the art. Also, as used herein, a "therapeutically effective amount" of a composition, vector construct, or viral vector of the present disclosure is an amount that produces a beneficial or desired result in a subject compared to a control. As defined herein, a therapeutically effective amount of a composition, vector construct, or viral vector of the present disclosure may be readily determined by one of skill in the art by routine methods known in the art. Dosage regimens may be adjusted to provide the optimal therapeutic response.

[0050] As used herein, the term "endogenous" refers to a molecule (e.g., a polypeptide, nucleic acid, or cofactor) that is naturally found in a particular organism (e.g., a human) or in a particular location within an organism (e.g., an organ, tissue, or cell, e.g., a human cell, e.g., an OHC).

[0051] As used herein, the term "express" refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of the RNA transcript (e.g., by splicing, editing, 5' capping, and / or 3' end processing); (3) translation of the RNA into a polypeptide or protein; and (4) post-translational modification of the polypeptide or protein.

[0052] As used herein, the term "exogenous" refers to a molecule (e.g., a polypeptide, nucleic acid, or cofactor) that is not naturally found in a particular organism (e.g., a human) or in a particular location within an organism (e.g., an organ, tissue, or cell, e.g., a human cell, e.g., a human OHC). Exogenous material includes materials provided from an external source to an organism or a culture extracted therefrom.

[0053] As used herein, the term "exon" refers to a region in the coding region of a gene whose nucleotide sequence determines the amino acid sequence of the corresponding protein. The term exon also refers to the corresponding region of the RNA transcribed from the gene. An exon may be transcribed into a pre-mRNA and included in the mature mRNA depending on alternative splicing of the gene. The exon included in the processed mature mRNA is translated into a protein, where the sequence of the exon determines the amino acid composition of the protein.

[0054] As used herein, the term "heterologous" refers to a combination of elements that do not occur in nature. For example, a heterologous transgene refers to a transgene that is not naturally expressed by the promoter to which it is operably linked.

[0055] As used herein, the terms "increase" and "decrease" refer to a modulation resulting in a greater or lesser amount of the function, expression, or activity of a measurement indicator relative to a baseline value, respectively. For example, following administration of a composition in a manner described herein, the amount of a marker of a measurement indicator described herein (e.g., expression of a transgene) may be increased or decreased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% or more in a subject compared to the amount of the marker prior to administration. Generally, the measurement indicator is measured after administration, such as at least one week, one month, three months, or six months after the start of a treatment regimen, at which time administration has exerted the aforementioned effects.

[0056] As used herein, the term "intein", also referred to as "protein intron", refers to a portion of a protein that is typically 100-900 amino acid residues long and capable of self-cleavage and peptide bond-mediated linkage of adjacent protein fragments ("exteins"). Inteins are generated during protein splicing. The term "intein" encompasses four different classes of inteins, including maxi-inteins, mini-inteins, trans-splicing inteins, and alanine inteins. Maxi-inteins refer to spliced ​​regions at the N- and C-termini of proteins that contain an endonuclease domain. Endonuclease domains, also known as "homing endonuclease genes" or "HEGs", refer to a class of endonucleases that are encoded as genes operating alone within introns, as protein fusions with other proteins, or as self-splicing inteins. HEGs generally hydrolyze very small and often targeted regions of DNA. When HEG hydrolyzes a piece of DNA, the gene encoding HEG usually integrates itself at the cleavage site, thereby increasing the frequency of its allele. Mini-intein refers to an N-terminal and C-terminal splicing domain that lacks an endonuclease domain. Trans-splicing intein refers to an intein that is split into two or more domains that are further split into an N-terminus and a C-terminus. Alanine intein refers to an intein that has a splicing junction of alanine instead of cysteine ​​or serine. The intein of a precursor protein may be split into two genes; in such cases, the intein is called a split "intein."

[0057] As used herein, the term "intron" refers to a region in the coding region of a gene whose nucleotide sequence is not translated into the amino acid sequence of the corresponding protein. The term intron also refers to the corresponding region of the RNA transcribed from the gene. Introns are transcribed into pre-mRNA but are removed during processing and are not included in the mature mRNA.

[0058] As used herein, the term "outer hair cell-specific expression" or "OHC-specific expression" refers to the production of RNA transcripts or polypeptides primarily in cochlear OHCs as compared to other cell types in the cochlea (e.g., spiral ganglion neurons, glia or other cochlear cell types). OHC-specific expression of a transgene can be confirmed by comparing expression of the transgene (e.g., RNA or protein expression) among various cell types in the cochlea (e.g., OHCs vs. non-OHCs) using any standard technique (e.g., quantitative RT PCR, immunohistochemistry, Western blot analysis, or fluorescence measurement of a reporter (e.g., GFP) operably linked to a promoter). The OHC-specific promoter induces expression (e.g., RNA or protein expression) of a transgene to which it is operably linked, and the induced expression is at least 50% (e.g., 50%, 75%, 100%, 125%, 150%, 175%, 200% or more) greater in OHCs compared to at least two (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) of the following inner ear cell types: inner hair cells, border cells, inner phalangeal cells, inner pillar cells, outer pillar cells, first row Deiters cells, second row Deiters cells, third row Deiters cells, Hensen cells, Claudius cells, inner sulcus cells, outer sulcus cells, spiral ridge cells, root cells, interdental cells, basal cells of the stria vascularis, intermediate cells of the stria vascularis, marginal cells of the stria vascularis, spiral ganglion neurons, Schwann cells. The OHC-specific promoter induces expression (e.g., RNA or protein expression) of a transgene to which it is operably linked, and the induced expression is at least 50% (e.g., 50%, 75%, 100%, 125%, 150%, 175%, 200% or more) greater in OHCs of the cochlea compared to other cells in the cochlea.

[0059] As used herein, "local" or "local administration" refers to administration at a particular site of the body for a local rather than a systemic effect. Examples of local administration are onto the skin of a subject, inhalation, intra-articular, intrathecal, intravaginal, intravitreal, intrauterine, intralesional, lymph node, intratumor, to the inner ear, and to a mucous membrane, where administration is intended to produce a local rather than a systemic effect.

[0060] As used herein, the term "operably linked" refers to a first molecule bound to a second molecule, where the first molecule is positioned such that the first molecule affects the function of the second molecule. The two molecules may or may not be part of a single, unbroken molecule, and may or may not be adjacent. For example, a promoter is operably linked to a transcribable polynucleotide molecule if it regulates the transcription of the transcribable polynucleotide molecule of interest in a cell. Furthermore, two portions of a transcriptional regulatory element are operably linked to each other if they are linked such that the transcriptional activation function of one portion is not adversely affected by the presence of the other portion. Two transcriptional regulatory elements may be operably linked to each other via a linker polynucleotide (e.g., an intervening non-coding polynucleotide) or operably linked to each other without the presence of an intervening nucleotide.

[0061] As used herein, the term "plasmid" refers to an extrachromosomal circular double-stranded DNA molecule into which additional DNA segments can be ligated. A plasmid is a type of vector, a nucleic acid molecule that can transport another nucleic acid to which it is linked. Certain plasmids are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial plasmids having a bacterial origin of replication and episomal mammalian plasmids). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and are thereby replicated along with the host genome. Certain plasmids can direct the expression of genes to which they are operably linked.

[0062] As used herein, the term "polynucleotide" refers to a polymer of nucleosides. Generally, polynucleotides are composed of nucleosides found naturally in DNA or RNA (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine) linked by phosphodiester bonds. The term encompasses molecules containing nucleosides or nucleoside analogs with chemically or biologically modified bases, modified backbones, and the like, whether or not found in natural nucleic acids, and such molecules may be preferred for certain applications. When the application refers to polynucleotides, it is understood that both DNA, RNA, and in each case both single-stranded and double-stranded forms (and the complement of each single-stranded molecule) are provided. As used herein, "polynucleotide sequence" can refer to the polynucleotide material itself and / or to sequence information (i.e., a series of letters used as abbreviations for bases) that biochemically characterize a particular nucleic acid. Polynucleotide sequences presented herein are presented in the 5' to 3' orientation unless otherwise indicated.

[0063] As used herein, the term "promoter" refers to a recognition site on DNA to which an RNA polymerase binds. The polymerase promotes transcription of the transgene. An exemplary promoter of the present disclosure is an oncomodulin (OCM) promoter, such as an OCM promoter having a nucleic acid sequence of any one of SEQ ID NOs: 1-3, or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to a nucleic acid sequence of any one of SEQ ID NOs: 1-3.

[0064] "Percentage of amino acid sequence identity" to a reference polynucleotide or polypeptide sequence is defined as the percentage of nucleic acids or amino acids in a candidate sequence that are identical to the nucleic acids or amino acids in the reference polynucleotide or polypeptide sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percentage of sequence identity. Alignment for the purposes of measuring percentage nucleic acid or amino acid sequence identity can be achieved in a variety of ways that are within the capabilities of those skilled in the art, for example, using publicly available computer software such as BLAST, BLAST-2, or Megalign software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms required to achieve maximum alignment over the full length of the sequences being compared. For example, percentage sequence identity values ​​may be generated using the sequence comparison computer program BLAST. As an example, the percent sequence identity of a given nucleic acid or amino acid sequence A to a given nucleic acid or amino acid sequence B (which can alternatively be translated as a given nucleic acid or amino acid sequence A having a particular percentage of sequence identity to a given nucleic acid or amino acid sequence B) is calculated as follows: 100×(fraction X / Y) where X is the number of nucleotides or amino acids scored as identical matches by a sequence alignment program (e.g., BLAST) in a programmatic alignment of A and B, and Y is the total number of nucleic acids in B. If the length of nucleic acid or amino acid sequence A is not equal to the length of nucleic acid or amino acid sequence B, then the percent sequence identity of A to B will not be equal to the percent sequence identity of B to A.

[0065] As used herein, the term "pharmaceutical composition" refers to a mixture containing a therapeutic agent, optionally in combination with one or more pharma- ceutically acceptable excipients, diluents, and / or carriers, administered to a subject, such as a mammal, e.g., a human, to prevent, treat, or control a particular disease or condition that affects or may affect the subject.

[0066] As used herein, the term "pharmacologically acceptable" refers to compounds, substances, compositions, and / or dosage forms that are suitable for contact with the tissues of a subject, such as a mammal (e.g., a human), without undue toxicity, irritation, allergic response, and other significant complications, and with a reasonable benefit / risk ratio.

[0067] As used herein, the term "recombinogenic region" refers to an area of ​​homology that mediates recombination between two distinct sequences. As used herein, the term "regulatory sequence" includes promoters, enhancers, and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of a polynucleotide encoding STRC. Such regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185 (Academic Press, San Diego, Calif., 1990), which is incorporated herein by reference.

[0068] As used herein, the term "sample" refers to a specimen isolated from a subject (e.g., blood, blood components (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placenta or skin), pancreatic juice, chorionic villus samples, and cells).

[0069] As used herein, the terms "stereocillin" and "STRC" (also known as DFNB16) refer to the protein encoded by the STRC gene and the gene encoding this protein, respectively. In humans, STRC is tandemly duplicated, where the second copy contains a premature stop codon in exon 20, thereby generating a STRC pseudogene. In the context of this disclosure, STRC does not refer to the STRC pseudogene. Previous studies have identified mutations in the full-length copy of STRC in human patients with autosomal recessive nonsyndromic sensorineural hearing loss (Verpy et al., Nat. Genet. 29:345-9 (2001)). Expression of the stereocillin protein is restricted to stereocilia in hair bundles of hair cells. Stereocilin is believed to form the horizontal upper connector and tectorial attachment crown, which are necessary for normal function of the hearing apparatus (Avan et al., PNAS, 116:25948-57 (2019); Verpy et al., J. Comp. Neurol. 519:194-210 (2011)). Mice lacking stereocilin have been shown to exhibit abnormal hair cell bundles with poor cohesion and hearing impairment (Verpy et al., Nature, 456:255-8 (2008)). The present disclosure provides polynucleotides encoding full-length stereocilin proteins, which when incorporated into the vector systems described herein, may be used as therapeutic agents for treating hearing loss (e.g., sensorineural hearing loss) in a subject in need thereof.The terms "stereocillin" and "STRC" refer to mutant forms of the wild-type stereocillin protein and the nucleic acid encoding same, respectively, e.g., mutants having at least 85% (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% or more) sequence identity to the amino acid sequence of the wild-type stereocillin protein (e.g., SEQ ID NO: 4 or 5). It also refers to a variant protein or a polynucleotide having at least 85% (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity or greater) sequence identity to the nucleic acid sequence of the wild-type STRC gene (e.g., SEQ ID NO: 6 or 7), provided that the encoded STRC analog retains the therapeutic function of the wild-type STRC.

[0070] As used herein, the term "transcriptional regulatory element" refers to a polynucleotide that at least partially controls the transcription of a gene of interest. Transcriptional regulatory elements can include promoters, enhancers, and other polynucleotides (e.g., polyadenylation signals) that control or help control gene transcription. Examples of transcriptional regulatory elements are described, for example, in Lorence, Recombinant Gene Expression: Reviews and Protocols (Humana Press, New York, NY, 2012).

[0071] As used herein, the terms "subject" and "patient" refer to an animal (e.g., a mammal such as a human). The subject treated according to the methods described herein may be a subject who has been diagnosed with hearing loss (e.g., hearing loss associated with a mutation in STRC) or who is at risk for developing the condition. Diagnosis may be performed by any method or technique known in the art. One of skill in the art will understand that the subject treated according to the present disclosure may have undergone standard testing or may not have undergone testing but has been identified as at risk due to the presence of one or more risk factors associated with the disease or condition.

[0072] As used herein, the terms "transduction" and "transducing" refer to a method of introducing a vector construct or a portion thereof into a cell. When the vector construct is contained in a viral vector, such as, for example, an AAV vector, transduction refers to viral infection of a cell and the subsequent transfer and integration of the vector construct or a portion thereof into the cellular genome.

[0073] As used herein, "treatment" and "treating" in relation to a disease or condition refer to an approach to obtain a beneficial or desired result, e.g., a clinical result. Beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, whether detectable or undetectable; reduction in the extent of the disease or condition; stabilization of the state of the disease, disorder, or condition (i.e., not worsening); prevention of the spread of the disease or condition; delaying or slowing the progression of the disease or condition; amelioration or palliative relief of the disease or condition; and remission (partial or complete). "Ameliorating" or "palliative relief" of a disease or condition means reducing the extent and / or undesirable clinical manifestations of the disease, disorder, or condition and / or slowing or prolonging the time course of progression compared to the extent or time course in the absence of treatment. "Treatment" can also mean prolonging survival compared to the expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.

[0074] As used herein, the term "vector" refers to a nucleic acid vector, e.g., a DNA vector, such as a plasmid, cosmid, or artificial chromosome, an RNA vector, a virus, or any other suitable replicon (e.g., a viral vector). A variety of vectors have been developed to deliver polynucleotides encoding foreign proteins into prokaryotic or eukaryotic cells. Examples of such expression vectors are described, for example, in Gellissen, Production of Recombinant Proteins: Novel Microbial and Eukaryotic Expression Systems (John Wiley & Sons, Marblehead, Massachusetts, 2006). Expression vectors suitable for use in the compositions and methods described herein contain polynucleotide sequences as well as additional sequence elements that are used, for example, for protein expression and / or integration of these polynucleotide sequences into the genome of a mammalian cell. Particular vectors that can be used to express STRC as described herein include vectors that contain regulatory sequences such as promoter and enhancer regions that direct gene transcription. Other vectors useful for expressing STRC contain polynucleotide sequences that increase the translation rate of STRC or improve the stability or nuclear export of mRNA resulting from gene transcription. These sequence elements include, for example, 5' and 3' untranslated regions and polyadenylation signal sites that direct efficient transcription of genes carried by the expression vector. Expression vectors suitable for use in the compositions and methods described herein may also contain a polynucleotide encoding a marker for selecting cells containing such a vector. Examples of suitable markers include genes encoding resistance to antibiotics such as ampicillin, chloramphenicol, kanamycin, or nourseothricin.

[0075] As used herein, the term "wild type" refers to the most frequently occurring genotype for a particular gene in a given organism. [Brief description of the drawings]

[0076] [Figure 1A] A series of fluorescent images of mouse cochleae transduced with an adeno-associated virus (AAV) vector expressing green fluorescent protein (GFP) under the control of the ubiquitous cytomegalovirus (CMV) promoter. Native GFP fluorescence is shown. Using a ubiquitous promoter, AAV-CMV-GFP induced GFP expression in many cell types within the cochlea, including inner hair cells (IHCs), outer hair cells (OHCs), spiral ganglion neurons, mesenchymal cells, and glia. [Figure 1B]

[0036] Figure 1 is a series of fluorescence images of mouse cochleae transduced with an AAV vector (SEQ ID NO: 1) expressing GFP under the control of the oncomodulin (OCM) promoter. Native GFP fluorescence is shown. Using an OHC-specific promoter, AAV-OCM (SEQ ID NO: 1)-GFP induced GFP expression only in OHCs. [Figure 2A] Shown are a series of photomicrographs of single paraffin sections from the basal turn of the cochlea of ​​two non-human primates (Macaca fascicularis) administered an AAV vector expressing H2B-GFP under the control of the OCM promoter of SEQ ID NO:1. A is a photomicrograph of a single paraffin section from the first animal, and B is a photomicrograph of a single paraffin section from the second animal. Panels A in A and B in B (top images) show greyscale conversion of the area surrounding the organ of Corti with nuclei originally stained with hematoxylin in blue and H2B-GFP antibody originally stained in red. Panels A' in A and B' in B (bottom images) show the remaining signal after removal of the blue hematoxylin signal, with H2B-GFP positive (red) nuclei remaining visible as a darker color after greyscale conversion. Scale bar represents 100 μm. Inner hair cells (IHCs) and outer hair cells (OHCs) are highlighted for orientation. [Figure 2B]Shown are a series of photomicrographs of single paraffin sections from the basal turn of the cochlea of ​​two non-human primates (Macaca fascicularis) administered an AAV vector expressing H2B-GFP under the control of the OCM promoter of SEQ ID NO:1. A is a photomicrograph of a single paraffin section from the first animal, and B is a photomicrograph of a single paraffin section from the second animal. Panels A in A and B in B (top images) show greyscale conversion of the area surrounding the organ of Corti with nuclei originally stained with hematoxylin in blue and H2B-GFP antibody originally stained in red. Panels A' in A and B' in B (bottom images) show the remaining signal after removal of the blue hematoxylin signal, with H2B-GFP positive (red) nuclei remaining visible as a darker color after greyscale conversion. Scale bar represents 100 μm. Inner hair cells (IHCs) and outer hair cells (OHCs) are highlighted for orientation. [Figure 3A] A series of fluorescent images of stereocillin expression in mouse organ of Corti in a 200 μm2 ROI at 16 kHz. A shows stereocillin antibody staining at the tips of the stereocilia of outer hair cells (OHCs) in wild-type CBA / CaJ mice. As shown in B, bp 232 STRC knockout (KO) animals lacked signal for the antibody. C shows stereocillin antibody staining in bp 232 STRC KO mice administered double Anc80 vectors, where the first vector carries the CMV promoter and nucleotides 1-3200 of mouse STRC cDNA, and the second vector carries nucleotides 2201-5430, creating a 1000 bp overlap between the two cDNAs in the two vectors. New stereocillin protein expression could be observed at the tips of OHC stereocilia and within the bodies of inner hair cells of Corti in treated bp 232 STRC KO mice. [Figure 3B]A series of fluorescent images of stereocillin expression in mouse organ of Corti in a 200 μm2 ROI at 16 kHz. A shows stereocillin antibody staining at the tips of the stereocilia of outer hair cells (OHCs) in wild-type CBA / CaJ mice. As shown in B, bp 232 STRC knockout (KO) animals lacked signal for the antibody. C shows stereocillin antibody staining in bp 232 STRC KO mice administered double Anc80 vectors, where the first vector carries the CMV promoter and nucleotides 1-3200 of mouse STRC cDNA, and the second vector carries nucleotides 2201-5430, creating a 1000 bp overlap between the two cDNAs in the two vectors. New stereocillin protein expression could be observed at the tips of OHC stereocilia and within the bodies of inner hair cells of Corti in treated bp 232 STRC KO mice. [Figure 3C] A series of fluorescent images of stereocillin expression in mouse organ of Corti in a 200 μm2 ROI at 16 kHz. A shows stereocillin antibody staining at the tips of the stereocilia of outer hair cells (OHCs) in wild-type CBA / CaJ mice. As shown in B, bp 232 STRC knockout (KO) animals lacked signal for the antibody. C shows stereocillin antibody staining in bp 232 STRC KO mice administered double Anc80 vectors, where the first vector carries the CMV promoter and nucleotides 1-3200 of mouse STRC cDNA, and the second vector carries nucleotides 2201-5430, creating a 1000 bp overlap between the two cDNAs in the two vectors. New stereocillin protein expression could be observed at the tips of OHC stereocilia and within the bodies of inner hair cells of Corti in treated bp 232 STRC KO mice. [Figure 4A]A series of graphs showing improved hearing function in STRC bp 232 KO mice treated with Anc80-CMV-mStrc and correlation with STRC expression in OHCs. Untreated contralateral ears showed nearly absent DPOAEs and very high ABR thresholds indicative of loss of OHC function (Figures 4A-4B, open circles), while treated STRC bp 232 KO animals showed recovery of hearing thresholds (Figures 4A-4B, filled circles). The best responders of treated animals (Figures 4A-4B, filled squares) showed hearing thresholds close to those of wild type (Figures 4A-4B, triangles). A high percentage of OHCs in STRC bp 232 KO mice expressing stereocillin after treatment with AAV-Anc80-CMV-mStrc was found to promote hearing recovery (Figure 4C). [Figure 4B] A series of graphs showing improved hearing function in STRC bp 232 KO mice treated with Anc80-CMV-mStrc and correlation with STRC expression in OHCs. Untreated contralateral ears showed nearly absent DPOAEs and very high ABR thresholds indicative of loss of OHC function (Figures 4A-4B, open circles), while treated STRC bp 232 KO animals showed recovery of hearing thresholds (Figures 4A-4B, filled circles). The best responders of treated animals (Figures 4A-4B, filled squares) showed hearing thresholds close to those of wild type (Figures 4A-4B, triangles). A high percentage of OHCs in STRC bp 232 KO mice expressing stereocillin after treatment with AAV-Anc80-CMV-mStrc was found to promote hearing recovery (Figure 4C). [Figure 4C]A series of graphs showing improved hearing function in STRC bp 232 KO mice treated with Anc80-CMV-mStrc and correlation with STRC expression in OHCs. Untreated contralateral ears showed nearly absent DPOAEs and very high ABR thresholds indicative of loss of OHC function (Figures 4A-4B, open circles), while treated STRC bp 232 KO animals showed recovery of hearing thresholds (Figures 4A-4B, filled circles). The best responders of treated animals (Figures 4A-4B, filled squares) showed hearing thresholds close to those of wild type (Figures 4A-4B, triangles). A high percentage of OHCs in STRC bp 232 KO mice expressing stereocillin after treatment with AAV-Anc80-CMV-mStrc was found to promote hearing recovery (Figure 4C). [Diagram 5] 1 shows images and graphs showing that transfection of HEK293T cells with a two-vector split-intein system leads to reconstitution of full-length stereocillin. A is a representative image of a Western blot for stereocillin protein and β-actin. B is a densitometric quantification of the band intensity of full-length stereocillin relative to actin, showing the relative expression of full-length stereocillin protein with respect to a negative (GFP) control, a positive full-length control, and the Npu intein construct. [Figure 6A] 13A-C are maps of plasmids P959 and P724, respectively, used to create an overlapping double vector system for expressing stereocillin (STRC) under the control of the mouse OCM promoter. [Figure 6B] 13A-C are maps of plasmids P959 and P724, respectively, used to create an overlapping double vector system for expressing stereocillin (STRC) under the control of the mouse OCM promoter. [Figure 7A] 1A-C are maps of plasmids P960 and P726, respectively, used to create a two-hybrid vector system for expressing STRC under the control of the mouse OCM promoter. [Figure 7B]1A-C are maps of plasmids P960 and P726, respectively, used to create a two-hybrid vector system for expressing STRC under the control of the mouse OCM promoter. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0077] Described herein are compositions and methods for treating sensorineural hearing loss in a subject (a mammalian subject, e.g., a human) by administering a first nucleic acid vector containing a promoter, such as an oncomodulin (OCM) promoter, and a polynucleotide encoding an N-terminal portion of a stereocillin (STRC) protein (e.g., a wild-type (WT) STRC protein), and a second nucleic acid vector containing a polynucleotide encoding a C-terminal portion of the STRC protein and a polyadenylation (poly(A)) sequence. When introduced into a mammalian cell, such as an outer cochlear hair cell (OHC), the polynucleotides encoded by the two nucleic acid vectors can combine to form a polynucleotide encoding a full-length STRC protein. The present disclosure also features two-vector expression systems (e.g., overlapping double vectors, trans-splicing vectors, double hybrid vectors, and split trans-splicing vectors) containing the aforementioned polynucleotides. The compositions and methods described herein can be used to specifically express a polynucleotide encoding STRC in OHCs, such that the compositions described herein can be administered to a subject (e.g., a mammalian subject, e.g., a human) to treat disorders resulting from dysfunction of OHCs, such as hearing loss (e.g., sensorineural hearing loss) and auditory neuropathy.

[0078] Stereocilin Stereocilin (also known as DFNB16) is a protein encoded by the STRC gene at chromosome 15q15, which contains 29 exons spanning approximately 19 kb of the genome. The STRC gene is tandemly duplicated, with the second copy containing a premature stop codon within exon 20, thereby generating a STRC pseudogene. Previous studies have identified two frameshift mutations and a large deletion in the full-length copy of STRC in two families with autosomal recessive nonsyndromic sensorineural hearing loss (Verpy et al., Nat. Genet. 29:345-9 (2001)). Stereocilin protein expression is restricted to stereocilia in the hair bundles of inner ear hair cells, which are thought to form the horizontal upper connector and tectorial attachment crown required for normal function of the hearing apparatus (Avan et al., PNAS, 116:25948-57 (2019); Verpy et al., J. Comp. Neurol. 519:194-210 (2011)). Mice lacking stereocillin have been shown to exhibit abnormal hair cell bundles with poor cohesion and hearing impairment (Verpy et al., Nature, 456:255-8 (2008)).

[0079] The compositions and methods described herein can be used to treat sensorineural hearing loss by administering a first nucleic acid vector containing a polynucleotide encoding the N-terminal portion of a stereocillin protein and a second nucleic acid vector containing a polynucleotide encoding the C-terminal portion of a stereocillin protein. The coding sequence for full-length STRC is too large to be included in the types of vectors commonly used in gene therapy (e.g., adeno-associated virus (AAV) vectors, which are believed to have a packaging limit of 5 kb). The compositions and methods described herein overcome this challenge by splitting the coding sequence for STRC into two different nucleic acid vectors, such that the full-length STRC sequence can be reconstituted in cells. These compositions and methods can be used to treat subjects with one or more mutations in the STRC gene, such as a mutation in STRC that reduces STRC expression, reduces STRC function, or is associated with hearing loss (e.g., subjects with DFNB16). When the first and second nucleic acid vectors are administered in a composition, the polynucleotides encoding the N-terminal and C-terminal portions of stereocillin can combine within a cell (e.g., a human cell, e.g., a cochlear hair cell) to form a single polynucleotide containing the full-length STRC coding sequence (e.g., via homologous recombination and / or splicing).

[0080] The nucleic acid vectors used in the compositions and methods described herein include polynucleotide sequences encoding wild-type stereocillin or variants thereof, e.g., polynucleotide sequences that, when combined, encode a protein having at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity) with the amino acid sequence of wild-type mammalian (e.g., human or mouse) stereocillin. The polynucleotides used in the nucleic acid vectors described herein encode the N-terminal and C-terminal portions of the stereocillin amino acid sequence in Table 2 below (e.g., two portions that, when combined, encode the full-length stereocillin amino acid sequence listed in Table 2, e.g., SEQ ID NO:4 or SEQ ID NO:5).

[0081] According to the methods described herein, a subject can be administered a composition containing a first nucleic acid vector and a second nucleic acid vector containing N-terminal and C-terminal portions, respectively, of a polynucleotide sequence encoding the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:5, or a polynucleotide sequence encoding an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:5, or an amino acid sequence containing one or more conservative amino acid substitutions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more conservative amino acid substitutions) to SEQ ID NO:4 or SEQ ID NO:5, with the proviso that the encoded stereocillin analog retains the therapeutic function of wild-type STRC. In some embodiments, up to 10% of the amino acids in the N-terminal portion of the stereocillin protein and up to 10% of the amino acids in the C-terminal portion of the stereocillin protein may be replaced with conservative amino acid substitutions. The stereocillin protein may be encoded by a polynucleotide having the sequence of SEQ ID NO:5 or SEQ ID NO:6. The stereocillin protein may also be encoded by a polynucleotide having a single nucleotide variant (SNV) that is known to be non-pathogenic in human subjects. The stereocillin protein may be a human stereocillin protein or a homologue of the human stereocillin protein from another mammalian species (e.g., mouse, rat, cow, horse, goat, sheep, donkey, cat, dog, rabbit, guinea pig, or other mammal).

[0082] [Table 2-1]

[0083] [Table 2-2]

[0084] [Table 2-3]

[0085] [Table 2-4]

[0086] [Table 2-5]

[0087] [Table 2-6]

[0088] [Table 2-7]

[0089] [Table 2-8]

[0090] [Table 2-9]

[0091] [Table 2-10]

[0092] Expression of stereocillin in mammalian cells Mutations in STRC are associated with sensorineural hearing loss. The compositions and methods described herein can be used to induce or increase the expression of WT stereocillin by administering to a subject or contacting a cell with a first nucleic acid vector containing a polynucleotide encoding the N-terminal portion of stereocillin protein and a second nucleic acid vector containing a polynucleotide encoding the C-terminal portion of stereocillin protein. To utilize nucleic acid vectors for therapeutic use in the treatment of sensorineural hearing loss, they can be directed to the interior of cells, particularly to specific cell types. A wide range of methods have been established for delivering proteins to mammalian cells and for stably expressing genes encoding proteins in mammalian cells.

[0093] Polynucleotides encoding stereocillin One platform that can be used to reach therapeutically effective intracellular concentrations of stereocillin in mammalian cells is by stably expressing a gene encoding stereocillin (e.g., by integration into the nuclear or mitochondrial genome of mammalian cells, or by episomal concatemer formation in the nucleus of mammalian cells). A gene is a polynucleotide that codes for the primary amino acid sequence of a corresponding protein. To introduce an exogenous gene into mammalian cells, the gene can be incorporated into a vector. The vector can be introduced into cells by a variety of methods, including transformation, transfection, transduction, direct uptake, particle bombardment, and encapsulation of the vector in liposomes. Examples of suitable methods for transfecting or transforming cells include calcium phosphate precipitation, electroporation, microinjection, infection, lipofection, and direct uptake. Such methods are described in further detail, for example, in Green, et al., Molecular Cloning: A Laboratory Manual, Fourth Edition (Cold Spring Harbor University Press, New York 2014), and Ausubel, et al., Current Protocols in Molecular Biology (John Wiley & Sons, New York, 2015), the disclosures of each of which are incorporated herein by reference.

[0094] STRC can also be introduced into mammalian cells by targeting a vector containing a portion of the gene encoding the stereocillin protein to cell membrane phospholipids. For example, the vector can be targeted to phospholipids on the extracellular surface of the cell membrane by binding the vector molecule to the VSV-G protein, a viral protein that has affinity for all cell membrane phospholipids. Such constructs can be generated using methods well known to those skilled in the art.

[0095] It is important for gene expression that the polynucleotide encoding the stereocillin protein is recognized and bound by mammalian RNA polymerase. Therefore, the polynucleotide may contain sequence elements that show high affinity for transcription factors that recruit RNA polymerase and promote the assembly of a transcription complex at the transcription start site. Such sequence elements include, for example, mammalian promoters, whose sequences can be recognized and bound by specific transcription initiation factors and ultimately RNA polymerase. Examples of mammalian promoters are described in Smith, et al., Mol. Sys. Biol., 3:73 (published online), the disclosure of which is incorporated herein by reference.

[0096] Polynucleotides suitable for use in the compositions and methods described herein include those that encode a stereocillin protein downstream of a mammalian promoter (e.g., a polynucleotide that encodes an N-terminal portion of a stereocillin protein downstream of a mammalian promoter). Promoters useful for expression of a stereocillin protein in mammalian cells include OHC-specific promoters such as the oncomodulin (OCM) promoter (e.g., a polynucleotide having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence identity) to any one of the OCM promoter sequences listed in Table 3 (any one of SEQ ID NOs: 1-3).

[0097] Oncomodulin promoter The inventors have discovered a 1,140 base pair (bp) region located upstream of the OCM translation start site that is sufficient to drive gene expression in OHCs. Thus, the compositions and methods described herein can be used to express stereolinin in OHCs to treat subjects with or at risk of developing hearing loss (e.g., sensorineural hearing loss associated with mutations in STRC, such as DFNB16). The OCM promoter described herein (e.g., an OCM promoter having at least 85% sequence identity with SEQ ID NO: 1) can be used to induce OHC-specific gene expression, thereby reducing or eliminating off-target expression in other inner ear cells (e.g., cells other than OHCs), thereby targeting STRC expression to cells where STRC is endogenously expressed and improving the safety and efficacy of gene therapy by reducing the toxicity associated with off-target expression.

[0098] The compositions and methods described herein include an OCM promoter listed in Table 3 (e.g., any one of SEQ ID NOs: 1-3) capable of specifically expressing stereocillin in OHCs, such as a polynucleotide sequence having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to any one of SEQ ID NOs: 1-3.

[0099] Exemplary OCM promoter sequences are listed in Table 3.

[0100] [Table 3-1]

[0101] [Table 3-2]

[0102] [Table 3-3]

[0103] [Table 3-4]

[0104] The aforementioned polynucleotides can be included in a nucleic acid vector and operably linked to a transgene to specifically express the transgene in OHCs. In the vectors described herein, the transgene can encode the N-terminal portion of a stereocillin protein. According to the methods described herein, a subject can be administered a composition containing the aforementioned polynucleotide (e.g., any one of the polynucleotide sequences listed in Table 3 (e.g., SEQ ID NOs: 1-3), or one of the polynucleotide sequences having at least 85% sequence identity thereto (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4 or SEQ ID NO: 5), for example, treatment of hearing loss.

[0105] Once a polynucleotide encoding a stereocillin has been incorporated into the nuclear DNA of a mammalian cell, transcription of the polynucleotide can be induced by methods known in the art. For example, expression can be induced by exposing the mammalian cell to an external chemical reagent, such as an agent that modulates the binding of transcription factors and / or RNA polymerase to the mammalian promoter, thus regulating gene expression. The chemical reagent can function to promote the binding of RNA polymerase and / or transcription factors to the mammalian promoter, for example, by removing a repressor protein bound to the promoter. Alternatively, the chemical reagent can serve to increase the affinity of the mammalian promoter for RNA polymerase and / or transcription factors to increase the rate of transcription of genes located downstream of the promoter in the presence of the chemical reagent. Examples of chemical reagents that enhance polynucleotide transcription by the above mechanisms include tetracycline and doxycycline. These reagents are commercially available (Life Technologies, Carlsbad, Calif.) and can be administered to mammalian cells to promote gene expression according to established protocols.

[0106] Other DNA sequence elements that may be included in polynucleotides for use in the compositions and methods described herein include enhancer sequences. Enhancers represent another class of regulatory elements that induce conformational changes in polynucleotides containing a gene of interest such that the DNA adopts a three-dimensional orientation that favors the binding of transcription factors and RNA polymerase at the transcription start site. Thus, polynucleotides for use in the compositions and methods described herein include polynucleotides encoding STRC, and further include mammalian enhancer sequences. Many enhancer sequences are now known from mammalian genes, examples include enhancers from genes encoding mammalian globin, elastase, albumin, alpha-fetoprotein, and insulin. Enhancers for use in the compositions and methods described herein also include enhancers derived from the genetic material of viruses capable of infecting eukaryotic cells. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. Further enhancer sequences that induce the activation of eukaryotic gene transcription include the CMV enhancer and the RSV enhancer. The enhancer may be spliced ​​into the vector containing the polynucleotide encoding the protein of interest, for example, at the 5' or 3' position of the gene. In a preferred orientation, the enhancer is located 5' to the promoter, which is then located 5' to the polynucleotide encoding the stereocillin protein.

[0107] The nucleic acid vectors described herein may include a Woodchuck Post-Transcriptional Regulatory Element (WPRE). The WPRE acts at the mRNA level to increase the total amount of mRNA in the cell by facilitating nuclear export of the transcript and / or by increasing the efficiency of polyadenylation of the nascent transcript. The addition of a WPRE to a vector can result in substantial improvements in the levels of transgene expression from several different promoters, both in vitro and in vivo.

[0108] In some embodiments, the nucleic acid vectors described herein contain reporter sequences, which can be useful, for example, to verify the expression of stereocillin in cells and tissues (e.g., in OHCs). Reporter sequences that may be provided in a transgene include DNA sequences encoding β-lactamase, β-galactosidase (LacZ), alkaline phosphatase, thymidine kinase, green fluorescent protein (GFP), chloramphenicol acetyltransferase (CAT), luciferase, and other reporters known in the art. When associated with regulatory elements, such as an OHC-specific promoter that drives their expression, reporter sequences provide a signal that can be detected by conventional means, including enzyme assays, radioassays, colorimetric assays, fluorescent assays or other spectroscopic assays, fluorescence-activated cell sorting assays, and immunological assays, including enzyme-linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), and immunohistochemistry. For example, if the marker sequence is a LacZ gene, the presence of a vector carrying a signal is detected by an assay for β-galactosidase activity. Where the transgene is green fluorescent protein or luciferase, vectors carrying a signal may be visually measured by color or light production in a luminometer.

[0109] Dual vector expression system Overlapping double vector One approach to express large proteins in mammalian cells involves the use of overlapping double vectors.This approach is based on the use of two nucleic acid vectors, each of which contains a portion of the polynucleotide that encodes the protein of interest and has a defined region of sequence overlap with the other polynucleotide.Homologous recombination can occur at the overlapping region, leading to the formation of a single polynucleotide that encodes the full-length protein of interest (e.g., stereocillin protein).

[0110] Overlapping dual vectors for use in the methods and compositions described herein contain at least 200 bases of overlapping sequence (e.g., at least 200b, 300b, 400b, 500b, 600b, 700b, 800b, 900b, 1.0 kilobase (kb), 1.1 kb, 1.2 kb, 1.3 kb, 1.4 kb, 1.5 kb or more of overlapping sequence). The nucleic acid vector is designed such that the overlapping region is centered at or near a position in the stereocillin-encoding polynucleotide that corresponds to approximately half the length of the stereocillin-encoding polynucleotide, with equal amounts of overlap on either side of the central position. The center of the overlapping region can also be selected based on the size of the promoter and the location of the sequence element of interest in the stereocillin-encoding polynucleotide. In some embodiments, the polynucleotide encoding stereocillin is divided into two halves of approximately equal length with some degree of overlap (e.g., 50b, 100b, 150b, 200b, 250b, 300b, 350b, 400b, 450b, 500b, 600b, 700b, 800b, 900b, 1kb, 1.1kb, 1.2kb, 1.3kb, 1.4kb, 1.5kb or more), where the 5' half of the polynucleotide encodes the N-terminal portion of the stereocillin protein and the 3' half of the polynucleotide encodes the C-terminal portion of the stereocillin protein. Nucleic acid vectors for use in the methods and compositions described herein are also designed such that approximately half of the polynucleotides encoding stereocillin are contained within each vector (e.g., each vector contains polynucleotides encoding approximately half of the stereocillin protein).

[0111] In some embodiments, the first nucleic acid vector encodes the N-terminal portion of the stereocillin protein. In some embodiments, the second nucleic acid vector encodes the C-terminal portion of the stereocillin protein. In some embodiments, the stereocillin protein has a sequence of SEQ ID NO: 4 or has a sequence with at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity thereto. In some embodiments, the stereocillin protein has a sequence of SEQ ID NO: 5 or has a sequence with at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity thereto. In some embodiments, the polynucleotide encoding the human full-length stereocillin protein has the sequence of SEQ ID NO: 6 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity with SEQ ID NO: 6. In some embodiments, the polynucleotide encoding the mouse full-length stereocillin protein has the sequence of SEQ ID NO: 7 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity with SEQ ID NO: 7.

[0112] One exemplary overlapping dual vector system includes a first nucleic acid vector containing an OCM promoter as described above (e.g., an OCM promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence identity) with any one of SEQ ID NOs: 1-3) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4 or SEQ ID NO: 5) comprising 500 bases immediately 3' of the position selected as the central position, and a second nucleic acid vector containing a C-terminal portion of a polynucleotide encoding a stereocillin protein comprising 500 bases immediately 5' of the position selected as the central position and a poly(A) sequence (e.g., bovine growth hormone (bGH) poly(A) signal sequence). The nucleic acid vector may optionally contain a STRC untranslated region (UTR). In some embodiments, the OCM promoter is a polynucleotide having the sequence of SEQ ID NO: 1, or a variant having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO: 1. In some embodiments, the OCM promoter is a polynucleotide having the sequence of SEQ ID NO: 2, or a variant having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO: 2. In some embodiments, the OCM promoter is a polynucleotide having the sequence of SEQ ID NO:3, or a variant having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:3.

[0113] In some embodiments, the first member of the dual vector system comprises the OCM promoter of SEQ ID NO:1 (also represented by nucleotides 225-1364 of SEQ ID NO:43) operably linked to nucleotides encoding the N-terminal portion of the stereocillin protein. In certain embodiments, the nucleotide sequence encoding the N-terminal portion of the stereocillin protein is nucleotides 1375-4574 of SEQ ID NO:43. The nucleotide sequence encoding the N-terminal portion of the stereocillin protein can be partially or fully codon optimized for expression. In certain embodiments, the first member of the dual vector system comprises nucleotides 225-4574 of SEQ ID NO:43 flanked on each of the 5' and 3' sides by inverted terminal repeats. In some embodiments, the flanking inverted terminal repeats are any variant of the AAV2 inverted terminal repeat that can be encapsidated by a plasmid carrying the AAV2 Rep gene. In certain embodiments, the 5' proximal inverted terminal repeat has a sequence corresponding to nucleotides 1-130 of SEQ ID NO: 43, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity). and the 3' adjacent inverted terminal repeat has a sequence corresponding to nucleotides 4662 to 4791 of SEQ ID NO: 43, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity). It will be understood by those skilled in the art that for a given pair of inverted terminal repeat sequences in a transfer plasmid used to generate a viral vector (usually by transfecting that plasmid into cells along with other plasmids carrying the AAV genes necessary for viral vector formation) (e.g., SEQ ID NO: 43), the corresponding sequences in the viral vector may vary due to the ITRs adopting a "flip" or "flop" orientation upon recombination.Thus, the sequence of the ITRs in the transfer plasmid is not necessarily the same as that found in the viral vector prepared therefrom. However, in some very specific embodiments, the first member of the dual vector system comprises nucleotides 1 to 4791 of SEQ ID NO:43.

[0114] In some embodiments, the second member of the dual vector system comprises nucleotides encoding the C-terminal portion of the stereocillin protein immediately followed by a stop codon. In certain embodiments, the nucleotide sequence encoding the C-terminal amino acids of the stereocillin protein is nucleotides 211-3440 of SEQ ID NO: 44. The nucleotide sequence encoding the C-terminal portion of the STRC protein can be partially or fully codon optimized for expression. In some embodiments, the second member of the dual vector system comprises a WPRE sequence corresponding to nucleotides 3452-3999 of SEQ ID NO: 44. In some embodiments, the second member of the dual vector system comprises a poly(A) sequence corresponding to nucleotides 4012-4219 of SEQ ID NO: 44. In certain embodiments, the second member of the dual vector system comprises nucleotides 211-4219 of SEQ ID NO: 44 flanked on each of the 5' and 3' sides by inverted terminal repeats. In some embodiments, the flanking inverted terminal repeats are any variant of the AAV2 inverted terminal repeat that can be encapsidated by a plasmid carrying the AAV2 Rep gene. In certain embodiments, the 5' proximal inverted terminal repeat has a sequence corresponding to nucleotides 1-130 of SEQ ID NO:44, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity). and the 3'-proximal inverted terminal repeat has a sequence corresponding to nucleotides 4307 to 4436 of SEQ ID NO:44, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity).It will be understood by those skilled in the art that for a given pair of inverted terminal repeat sequences in a transfer plasmid used to create a viral vector (usually by transfecting that plasmid into cells along with other plasmids carrying AAV genes necessary for viral vector formation) (e.g., SEQ ID NO: 44), the corresponding sequences in the viral vector may vary as the ITRs "flip" or "flop" orientation upon recombination. Thus, the sequences of the ITRs in the transfer plasmid are not necessarily the same as those found in the viral vector prepared therefrom. However, in some very specific embodiments, the first member of the dual vector system comprises nucleotides 1-4436 of SEQ ID NO: 44.

[0115] Tables 4 and 5 provide transfer plasmids that may be used to produce nucleic acid vectors for use in the compositions and methods described herein. The transfer plasmid (e.g., a plasmid containing a DNA sequence delivered by a nucleic acid vector, e.g., delivered by AAV) is co-delivered into the producer cell with a helper plasmid (e.g., a plasmid providing proteins necessary for AAV production) and a rep / cap plasmid (e.g., a plasmid providing AAV capsid proteins and proteins that insert the transfer plasmid DNA sequence into the capsid shell) to generate a nucleic acid vector (e.g., an AAV vector) for administration. The nucleic acid vector containing a polynucleotide encoding the N-terminal portion of the stereocillin protein (e.g., a nucleic acid vector (e.g., an AAV vector) and a nucleic acid vector (e.g., an AAV vector) containing a polynucleotide encoding the C-terminal portion of the stereocillin protein) can be combined (e.g., into a single formulation) prior to administration.

[0116] Transfer plasmids that may be used to generate nucleic acid vectors (e.g., AAV vectors) for co-formulation or co-administration (e.g., simultaneous or sequential administration) in an overlapping dual vector system are provided in Table 4 (SEQ ID NO:43 and SEQ ID NO:44).

[0117] [Table 4-1]

[0118] [Table 4-2]

[0119] [Table 4-3]

[0120] [Table 4-4]

[0121] [Table 4-5]

[0122] [Table 4-6]

[0123] [Table 4-7]

[0124] [Table 4-8]

[0125] [Table 4-9]

[0126] [Table 4-10]

[0127] Trans-splicing dual vector A second approach to expressing large proteins in mammalian cells involves the use of trans-splicing dual vectors. This approach uses two nucleic acid vectors that contain separate nucleic acid sequences, with the polynucleotide encoding the N-terminal portion of the protein of interest not overlapping with the polynucleotide encoding the C-terminal portion of the protein of interest. Instead, the first nucleic acid vector contains a splice donor sequence 3' of the polynucleotide encoding the N-terminal portion of the protein of interest, and the second nucleic acid vector contains a splice acceptor sequence 5' of the polynucleotide encoding the C-terminal portion of the protein of interest. When the first and second nucleic acids are present in the same cell, their ITRs can link to form a single nucleic acid structure in which the linked ITRs are located between the splice donor and splice acceptor. Trans-splicing then occurs during transcription to generate a nucleic acid molecule in which the polynucleotides encoding the N-terminal and C-terminal portions of the protein of interest are adjacent, thereby forming a full-length coding sequence.

[0128] The trans-splicing dual vectors for use in the methods and compositions described herein are designed such that approximately half of the coding sequence of stereocilin is contained within each vector (e.g., each vector contains a polynucleotide encoding approximately half of the stereocilin protein, as discussed above). The decision of how to divide the polynucleotide sequence between the two nucleic acid vectors is based on the size of the promoter and the location of the sequence element of interest in the polynucleotide encoding the stereocilin protein (e.g., an exon of the STRC gene). The first vector in the trans-splicing dual vector system can contain a promoter sequence 5' of the polynucleotide encoding the N-terminal portion of the stereocilin protein. The nucleic acid vector can optionally contain a UTR of STRC (e.g., both 5' and 3' UTR of STRC, e.g., a full-length UTR). One exemplary trans-splicing dual vector system for use in the compositions and methods described herein includes a first nucleic acid vector containing an OCM promoter (e.g., any one of SEQ ID NOs: 1-3) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of a human stereocillin protein, e.g., the N-terminal portion of SEQ ID NO: 4) and a splice donor sequence at the 3' end of the polynucleotide sequence, and a second nucleic acid vector containing a splice acceptor sequence and a poly(A) sequence at the 5' end of a polynucleotide encoding a C-terminal portion of a stereocillin protein (e.g., the C-terminal portion of a human stereocillin protein, e.g., the C-terminal portion of SEQ ID NO: 4).An alternative trans-splicing dual vector system comprises a first nucleic acid vector containing an OCM promoter (e.g., any one of SEQ ID NOs: 1-3) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., an N-terminal portion of a mouse stereocillin protein, e.g., an N-terminal portion of SEQ ID NO: 5) and a splice donor sequence at 3' of the polynucleotide sequence, and a second nucleic acid vector containing a splice acceptor sequence at 5' of a polynucleotide encoding a C-terminal portion of a stereocillin protein (e.g., a C-terminal portion of a mouse stereocillin, e.g., a C-terminal portion of SEQ ID NO: 5) and a poly(A) sequence. In some embodiments, the OCM promoter is a polynucleotide having a sequence of SEQ ID NO: 1, or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 1. In some embodiments, the OCM promoter is a polynucleotide having a sequence of SEQ ID NO:2, or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:2. In some embodiments, the OCM promoter is a polynucleotide having a sequence of SEQ ID NO:3, or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:3.These nucleic acid vectors can also contain the full-length 5' and / or 3' UTR of STRC in the first and second nucleic acid vectors, respectively (for example, the first nucleic acid vector can contain the 5' UTR of human STRC in a dual vector system encoding human stereocillin or the 5' UTR of mouse STRC in a dual vector system encoding mouse stereocillin, and the second nucleic acid vector can contain the 3' UTR of human STRC in a dual vector system encoding human stereocillin or the 3' UTR of mouse STRC in a dual vector system encoding mouse stereocillin). To accommodate the UTR of STRC, the coding sequence of stereocillin can be split at a position corresponding to the length of the promoter sequence and the sequence encoding the N-terminal portion of stereocillin.

[0129] In some embodiments, the polynucleotide encoding the human full-length stereocillin protein has the sequence of SEQ ID NO: 6 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity with SEQ ID NO: 6. In some embodiments, the polynucleotide encoding the mouse full-length stereocillin protein has the sequence of SEQ ID NO: 7 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity with SEQ ID NO: 7.

[0130] Double hybrid vectors A third approach for expressing large proteins in mammalian cells involves the use of double hybrid vectors. This approach combines elements of the overlapping double vector strategy and the trans-splicing strategy in that it features both an overlapping region where homologous recombination can occur and splice donor and splice acceptor sequences. In the double hybrid vector system, the overlapping region is not part of the polynucleotide sequence encoding the protein of interest, but is a recombinogenic region contained in both the first and second nucleic acid vectors, and the polynucleotides encoding the N-terminal portion of the protein of interest and the polynucleotides encoding the C-terminal portion of the protein of interest do not overlap in this approach. The recombinogenic region is 3' of the splice donor sequence of the first nucleic acid vector and 5' of the splice acceptor sequence of the second nucleic acid vector. The first and second nucleic acid sequences can then combine to form a single sequence based on one of two mechanisms: 1) recombination at the overlapping region, or 2) concatemerization of the ITRs. The remaining recombinogenic region(s) and / or the concatemerized ITRs can be removed by splicing, resulting in the formation of a contiguous polynucleotide sequence encoding the full-length protein of interest. Recombinogenic regions, splice donor sequences, and splice acceptor sequences that can be used in the compositions and methods described herein include those known to those of skill in the art. Exemplary recombinogenic regions include fragments of the F1 phage AK gene and alkaline phosphatase (AP) gene, as described in U.S. Pat. Nos. 10,494,645 and 8,236,557, which are incorporated herein by reference. In some embodiments, the AP gene fragment has the following sequence: CCCCGGGTGCGCGGCGTCGGTGGTGCCGGCGGGGGGCGCCAGGTCGCAGGCGGTGTAGGGCTCCAGGCAGGCGGCGAAGGCCATGACGTGCGCTATGAAGGTCTGCTCCTGCACGCCGTGAACCAGGTGCGCCTGCGGGCCGCGCGCGAACACCGCCACGTCCTCGCCTGCGTGGGTCTCTTCGTCCAGGGGCACTGCTGACTGCTGCCGATACTCGGGGCTCCCGCTCTCGCTCTCGGTAACATCCGGCCGGGCGCCGTCCTTGAGCACATAGCCTGGACCGTTTCCGTATAGGAGGACCGTGTAGGCCTTCCTGTCCCGGGCCTTGCCAGCGGCCAGCCCGATGAAGGAGCTCCCTCGCAGGGGGTAGCCTCCGAAGGAGAAGACGTGGGAGTGGTCGGCAGTGACGAGGCTCAGCGTGTCCTCCTCGCTGGTGAGCTGGCCCGCCCTCTCAATGGCGTCGTCGAACATGATCGTCTCAGTCAGTGCCCGGTAAGCCCTGCTTTCATGATGACCATGGTCGATGCGACCACCCTCCACGAAGAGGAAGAAGCCGCGGGGGTGTCTGCTCAGCAGGCGCAGGGCAGCCTCTGTCATCTCCATCAGGGAGGGGTCCAGTGTGGAGTCTCGGTGGATCTCGTATTTCATGTCTCCAGGCTCAAAGAGACCCATGAGATGGGTCACAGACGGGTCCAGGGAAGCCTGCATGAGCTCAGTGCGGTTCCACACGTACCGGGCACCCTGGCGTTCGCCGAGCCATTCCTGCACCAGATTCTTCCCGTCCAGCCTGGTCCCACCTTGGCTGTAGTCATCTGGGTACTCAGGGTCTGGGGTTCCCATGCGAAACATGTACTTTCGGCCTCCA (SEQ ID NO: 47).

[0131] In some embodiments, the AP gene fragment has the following sequence: CCCCGGGTGCGCGGCGTCGGTGGTGCCGGCGGGGGGCGCCAGGTCGCAGGCGGTGTAGGGCTCCAGGCAGGCGGCGAAGGCCATGACGTGCGCTATGAAGGTCTGCTCCTGCACGCCGTGAACCAGGTGCGCCTGCGGGCCGCGCGCGAACACCGCCACGTCCTCGCCTGCGTGGGTCTCTTCGTCCAGGGGCACTGCTGACTGCTGCCGATACTCGGGGCTCCCGCTCTCGCTCTCGGTAACATCCGGCCGGGCGCCGTCCTTGAGCACATAGCCTGGACCGTTTCCGTATAGGAGGACCGTGTAGGCCTTCCTGTCCCGGGCCTTGCCAGCGGCCAGCCCGATGAAGGAGCTCCCTCGCAGGGGGTAGCCTCCGAAGGAGAAGACGTGGGAGTGGTCGGCAGTGACGAGGCTCAGCGTGTCCTCCTCG CTGGTGA (SEQ ID NO: 48).

[0132] In some embodiments, the AP gene fragment has the following sequence: GCTGGCCCGCCCTCTCAATGGCGTCGTCGAACATGATCGTCTCAGTCAGTGCCCGGTAAGCCCTGCTTTCATGATGACCATGGTCGATGCGACCACCCTCCACGAAGAGGAAGAAGCCGCGGGGGTGTCTGCTCAGCAGGCGCAGGGCAGCCTCTGTCATCTCCATCAGGGAGGGGTCCAGTGTGGAGTCTCGGTGGATCTCGTATTTCATGTCTCCAGGCTCAAAGAGACCCATGAGATGGGTCACAGACGGGTCCAGGGAAGCCTGCATGAGCTCAGTGCGGTTCCACACGTACCGGGCACCCTGGCGTTCGCCGAGCCATTCCTGCACCAGATTCTTCCCGTCCAGCCTGGTCCCACCTTGGCTGTAGTCATCTGGGTACTCAGGGTCTGGGGTTCCCATGCGAAACATGTACTTTCGGCCTCCA (SEQ ID NO: 49).

[0133] In some embodiments, the AP gene fragment has the following sequence: CCCCGGGTGCGCGGCGTCGGTGGTGCCGGCGGGGCGCCAGGTCGCAGGCGGTGTAGGGCTCCAGGCAGGCGGCGAAGGCCATGACGTGCGCTATGAAGGTCTGCTCCTGCACGCCGTGAACCAGGTGCGCCTGCGGGCCGCGCGCG AACACCGCCACGTCCTCGCCTGCGTGGGTCTCTTCGTCCAGGGGCACTGCTGACTGCTGCCGATACTCGGGGCTCCCGCTCTCGCTCTCGGTAACATCCGGCCGGGCGCCGTCCTTGAGCACATAGCCTGGACCGTTTC (SEQ ID NO: 50).

[0134] In some embodiments, the AP gene fragment has the following sequence: CGTATAGGAGGACCGTGTAGGCCTTCCTGTCCCGGGCCTTGCCAGCGGCCAGCCCGATGAAGGAGCTCCCTCGCAGGGGGTAGCCTCCGAAGGAGAAGACGTGGGAGTGGTCGGCAGTGACGAGGCTCAGCGTGTCCTCCTCGCTGGTG AGCTGGCCCGCCCTCTCAATGGCGTCGTCGAACATGATCGTCTCAGTCAGTGCCCGGTAAGCCCTGCTTTCATGATGACCATGGTCGATGCGACCACCCTCCACGAAGAGGAAGAAGCCGCGGGGGTGTCTGCTCAGCAGG (SEQ ID NO: 51).

[0135] In some embodiments, the AP gene fragment has the following sequence: CGCAGGGCAGCCTCTGTCATCTCCATCAGGGAGGGGTCCAGTGTGGAGTCTCGGTGGATCTCGTATTTCATGTCTCCAGGCTCAAAGAGACCCATGAGATGGGTCACAGACGGGTCCAGGGAAGCCTGCATGAGCTCAGTGCGGTTCC ACACGTACCGGGCACCCTGGCGTTCGCCGAGCCATTCCTGCACCAGATTCTTCCCGTCCAGCCTGGTCCCACCTTGGCTGTAGTCATCTGGGTACTCAGGGTCTGGGGTTCCCATGCGAAACATGTACTTTCGCCTCCA (SEQ ID NO: 52).

[0136] The double hybrid vectors for use in the methods and compositions described herein are designed such that approximately half of the coding sequence of stereocillin is contained within each vector (e.g., each vector contains a polynucleotide encoding approximately half of the stereocillin protein). The decision of how to divide the polynucleotide sequence between the two nucleic acid vectors is based on the size of the promoter and the location of the sequence element of interest in the polynucleotide encoding the stereocillin protein (e.g., an exon of the STRC gene). The first vector in the trans-splicing double vector system can contain a promoter sequence 5' to the polynucleotide encoding the N-terminal portion of the stereocillin protein. The nucleic acid vector can optionally contain the UTRs of STRC (e.g., full-length 5' and 3' UTRs).

[0137] One exemplary double hybrid vector system includes a first nucleic acid vector containing an OCM promoter (e.g., any one of SEQ ID NOs: 1-3) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., an N-terminal portion of a human stereocillin protein, e.g., an N-terminal portion of SEQ ID NO: 4), a splice donor sequence 3' of the polynucleotide sequence, and a recombinogenic region 3' of the splice donor sequence, and a second nucleic acid vector containing a recombinogenic region (e.g., the same recombinogenic region contained in the first nucleic acid vector), a splice acceptor sequence 3' of the recombinogenic region, and a polynucleotide encoding a C-terminal portion of a stereocillin protein (e.g., a C-terminal portion of a human stereocillin protein, e.g., an N-terminal portion of SEQ ID NO: 4) and a poly(A) sequence 3' of the splice acceptor sequence. In some embodiments, the OCM promoter is a polynucleotide having the sequence of SEQ ID NO: 1 or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 1. In some embodiments, the OCM promoter is a polynucleotide having the sequence of SEQ ID NO: 2 or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 2. In some embodiments, the OCM promoter is a polynucleotide having the sequence of SEQ ID NO: 3 or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO: 3. The first and second nucleic acid vectors can also each contain the full length 5' and / or 3' UTR of STRC (e.g., the 5' UTR of human STRC can be included in the first nucleic acid vector and the 3' UTR of human STRC can be included in the second nucleic acid vector).Another exemplary double hybrid vector system includes a first nucleic acid vector containing an OCM promoter (e.g., any one of SEQ ID NOs: 1-3) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., an N-terminal portion of a mouse stereocillin protein, e.g., an N-terminal portion of SEQ ID NO: 5), a splice donor sequence 3' of the polynucleotide sequence, and a recombinogenic region 3' of the splice donor sequence, and a second nucleic acid vector containing a recombinogenic region (e.g., the same recombinogenic region contained in the first vector), a splice acceptor sequence 3' of the recombinogenic region, and a polynucleotide encoding a C-terminal portion of a stereocillin protein (e.g., a C-terminal portion of a mouse stereocillin, e.g., an C-terminal portion of SEQ ID NO: 5) and a poly(A) sequence 3' of the splice acceptor sequence. The first and second nucleic acid vectors can also each contain the full-length 5' and / or 3' UTR of STRC (e.g., the 5' UTR of mouse STRC can be included in the first nucleic acid vector and the 3' UTR of mouse STRC can be included in the second nucleic acid vector). To accommodate the UTR of STRC, the coding sequence of stereocillin can be split at a different position than in a two-hybrid vector system that does not include the UTR of STRC.

[0138] In some embodiments, the polynucleotide encoding the human full-length stereocillin protein has the sequence of SEQ ID NO: 6 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity with SEQ ID NO: 6. In some embodiments, the polynucleotide encoding the mouse full-length stereocillin protein has the sequence of SEQ ID NO: 7 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity with SEQ ID NO: 7.

[0139] The double hybrid vector used in the methods and compositions described herein can optionally include a degradation signal sequence in both the first and second nucleic acid vectors. The degradation signal sequence can be included to prevent or reduce the expression of a portion of the stereocillin protein from polynucleotides that have failed recombination and / or splicing. The degradation signal sequence is located 3' of the recombination-inducing region in the first nucleic acid vector, and is located between the recombination-inducing region and the splice acceptor in the second nucleic acid vector. Suitable degradation signal sequences that can be used in the compositions and methods described herein are known in the art and are described, for example, in International Application Publication No. WO2016 / 139321, which is incorporated herein by reference.

[0140] In some embodiments, the first member of the dual vector system comprises the OCM promoter of SEQ ID NO:1 (also represented by nucleotides 225-1364 of SEQ ID NO:45) operably linked to nucleotides encoding the N-terminal portion of the stereocillin protein. In certain embodiments, the nucleotide sequence encoding the N-terminal portion of the stereocillin protein is nucleotides 1378-4077 of SEQ ID NO:45. The nucleotide sequence encoding the N-terminal portion of the stereocillin protein can be partially or fully codon optimized for expression. In some embodiments, the first member of the dual vector system comprises a splice donor sequence corresponding to nucleotides 4078-4161 of SEQ ID NO:45. In some embodiments, the first member of the dual vector system comprises an AP head sequence corresponding to nucleotides 4168-4454 of SEQ ID NO:45. In certain embodiments, the first member of the dual vector system comprises nucleotides 225-4454 of SEQ ID NO:45 flanked on each of the 5' and 3' sides by inverted terminal repeats. In some embodiments, the flanking inverted terminal repeat is any variant of an AAV2 inverted terminal repeat that can be encapsidated by a plasmid carrying the AAV2 Rep gene. In certain embodiments, the 5' flanking inverted terminal repeat has a sequence corresponding to nucleotides 1-130 of SEQ ID NO:45, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity). and the 3'-proximal inverted terminal repeat has a sequence corresponding to nucleotides 4548 to 4677 of SEQ ID NO:45, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity).It will be understood by those skilled in the art that for a given pair of inverted terminal repeat sequences in a transfer plasmid used to create a viral vector (usually by transfecting that plasmid into cells along with other plasmids carrying AAV genes necessary for viral vector formation) (e.g., SEQ ID NO: 45), the corresponding sequences in the viral vector may vary as the ITRs "flip" or "flop" orientation upon recombination. Thus, the sequences of the ITRs in the transfer plasmid are not necessarily the same as those found in the viral vector prepared therefrom. However, in some very specific embodiments, the first member of the dual vector system comprises nucleotides 1-4677 of SEQ ID NO: 45.

[0141] In some embodiments, the second member of the dual vector system comprises nucleotides encoding the C-terminal portion of the stereocillin protein immediately followed by a stop codon. In certain embodiments, the nucleotide sequence encoding the C-terminal portion of the stereocillin protein is nucleotides 615-3344 of SEQ ID NO: 46. The nucleotide sequence encoding the C-terminal portion of the stereocillin protein can be partially or fully codon optimized for expression. In some embodiments, the second member of the dual vector system comprises a splice acceptor sequence corresponding to nucleotides 566-614 of SEQ ID NO: 46. In some embodiments, the second member of the dual vector system comprises an AP head sequence corresponding to nucleotides 257-543 of SEQ ID NO: 46. In some embodiments, the second member of the dual vector system comprises a poly(A) sequence corresponding to nucleotides 3376-3597 of SEQ ID NO: 46. In certain embodiments, the second member of the dual vector system comprises nucleotides 257-3597 of SEQ ID NO: 46 flanked on each of the 5' and 3' sides by inverted terminal repeats. In some embodiments, the flanking inverted terminal repeat is any variant of an AAV2 inverted terminal repeat that can be encapsidated by a plasmid carrying the AAV2 Rep gene. In certain embodiments, the 5' flanking inverted terminal repeat has a sequence corresponding to nucleotides 12-141 of SEQ ID NO:46, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity). and the 3'-proximal inverted terminal repeat has a sequence corresponding to nucleotides 3685 to 3814 of SEQ ID NO:46, or a sequence having at least 80% sequence identity thereto (at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity).It will be understood by those skilled in the art that for a given pair of inverted terminal repeat sequences in a transfer plasmid used to create a viral vector (usually by transfecting that plasmid into cells along with other plasmids carrying AAV genes necessary for viral vector formation) (e.g., SEQ ID NO: 46), the corresponding sequences in the viral vector may vary as the ITRs "flip" or "flop" orientation upon recombination. Thus, the sequences of the ITRs in the transfer plasmid are not necessarily the same as those found in the viral vector prepared from it. However, in some very specific embodiments, the first member of the dual vector system comprises nucleotides 12-3814 of SEQ ID NO: 46.

[0142] Transfer plasmids that may be used to generate nucleic acid vectors (e.g., AAV vectors) for co-formulation or co-administration (e.g., simultaneous or sequential administration) in a two-hybrid vector system are provided in Table 5 (SEQ ID NO:45 and SEQ ID NO:46).

[0143] [Table 5-1]

[0144] [Table 5-2]

[0145] [Table 5-3]

[0146] [Table 5-4]

[0147] [Table 5-5]

[0148] [Table 5-6]

[0149] [Table 5-7]

[0150] [Table 5-8]

[0151] Other exemplary pairs of overlapping, trans-splicing, and double hybrid vectors are listed in Table 6 below.

[0152] [Table 6]

[0153] Intein Expression System Another gene therapy approach to express large proteins in mammalian cells involves the use of inteins. Inteins, also known as "protein introns," are parts of proteins that are usually 100-900 amino acid residues long and are capable of self-excision and ligation of N- and C-terminal residues of adjacent protein fragments ("exteins"). Inteins can be divided into three different classes, including maxi-inteins, mini-inteins, and split-inteins. Maxi-inteins refer to spliced ​​regions at the N- and C-termini of proteins that are interrupted by a homing endonuclease domain (HEG). HEGs refer to a class of endonucleases that are encoded as independent genes within introns, as fusions of the protein with other proteins, or as self-splicing inteins. HEGs generally hydrolyze very small amounts and select regions of DNA. When HEG hydrolyzes a small piece of DNA, the gene encoding the HEG usually integrates itself at the cleavage site, thereby increasing the frequency of that allele. "Mini-intein" refers to an N-terminal and C-terminal splicing domain that lacks the HEG domain. "Split intein" refers to an intein that is transcribed and translated as two separate polypeptides that are linked with an extein. Alanine inteins are another class of inteins that have a splicing junction with alanine instead of cysteine ​​or serine.

[0154] The splicing domain of inteins contains two subdomains, the N-terminal splicing region and the C-terminal splicing region, which contain conserved motifs with conserved residues that mediate splicing activity. The N-terminal splicing region contains the structural motifs A, N2, B, N4, whereas the C-terminal splicing region contains the motifs F and G. The A motif contains Cys / Ser or Thr as conserved residues, the B motif contains His and Thr residues, the F motif contains Asp and His residues, and the G motif possesses two conserved residues including the penultimate His and the final Asn. The motifs C, D, E, and H are generally associated with the HEG domain of maxi-inteins.

[0155] Intein splicing has been classified into three different strategies: 1) class 1 (or classical / canonical) intein splicing, which involves (a) a (NS / NO) acyl shift that converts a peptide bond at the N-terminal splice junction into a thio(ester) bond, (b) a transesterification reaction that forms a branched intermediate, (c) an Asn cyclization reaction that removes the branched intermediate by cleaving the C-terminal splice junction, and (d) a second (SN / ON) acyl shift that links adjacent extein segments via amide bond formation; 2) class 2 inteins (also known as alanine inteins), which bypass step (a) of the classical splicing reaction; and 3) class 3 mechanisms, which involve the formation of two branched intermediates.

[0156] Among the various intein systems mentioned above, a split intein trans-splicing approach has been demonstrated to successfully overcome the size limitations of conventional gene therapy vectors (e.g., AAV: maximum size limit of approximately 5 kb). For example, Subramanyam et al. (PNAS, 110:15461-6 (2013)) employed a split intein system to reconstitute the α1C subunit of the L-type calcium channel from its two halves in cardiomyocytes. Similarly, Truong et al. (Nucleic Acids Res. 43:6450-8 (2015) show successful reconstitution of the two halves of the Cas9 protein using a split intein system. Thus, the present disclosure provides a split intein trans-splicing system for packaging and delivering a stereocillin coding sequence operably linked to an OCM promoter. This method allows two separate polynucleotides, each containing approximately half of the STRC gene and including polynucleotide sequences encoding an N-intein fragment or a C-intein fragment, to be expressed from two separate expression vectors (e.g., any one of the nucleic acid vectors disclosed herein) and post-translationally reconstituted to generate a full-length stereocillin protein. Such a system may be incorporated into a nucleic acid expression vector disclosed herein, such as, for example, a rAAV vector.

[0157] In one example, the disclosure provides a two-vector split intein system comprising: a) a first nucleic acid vector comprising a polynucleotide comprising a sequence encoding an N-terminal portion of a human stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4), wherein the sequence encoding the N-terminal portion of the stereocillin protein comprises a polynucleotide sequence encoding an N-intein at its 3' end; and b) a second vector containing a polynucleotide comprising a sequence encoding a C-terminal portion of a human stereocillin protein (e.g., the C-terminal portion of SEQ ID NO: 4), wherein the sequence encoding the C-terminal portion of the stereocillin protein comprises a polynucleotide sequence encoding a C-intein at its 5' end.

[0158] In another example, the disclosure provides a two-vector split intein system comprising: a) a first vector containing a polynucleotide comprising a sequence encoding the N-terminal portion of a mouse stereocillin protein (e.g., the N-terminal portion of SEQ ID NO:5), wherein the sequence encoding the N-terminal portion of the stereocillin protein comprises a polynucleotide sequence encoding an N-intein at its 3' end; and b) a second vector containing a polynucleotide comprising a sequence encoding the C-terminal portion of a mouse stereocillin protein (e.g., the N-terminal portion of SEQ ID NO:5), wherein the sequence encoding the C-terminal portion of the stereocillin protein comprises a nucleic acid sequence encoding a C-intein at its 5' end.

[0159] In some embodiments, both the first vector and the second vector further comprise a promoter sequence, such as an OCM promoter sequence (e.g., an OCM promoter sequence of any one of SEQ ID NOs: 1-3) operably linked to the 5' end of the polynucleotide encoding the first fusion protein (the N-terminal portion of the stereocillin protein fused to the N-intein) and / or the 5' end of the polynucleotide encoding the second fusion protein (the C-terminal portion of the stereocillin protein fused to the C-intein). In some embodiments, the OCM promoter has the sequence of SEQ ID NO: 1 or a variant having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO: 1. In some embodiments, the OCM promoter has a sequence of SEQ ID NO:2 or a variant having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:2. In some embodiments, the OCM promoter has a sequence of SEQ ID NO:3 or a variant having at least 85% (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) sequence identity to SEQ ID NO:3.

[0160] In some embodiments, the N-intein and C-intein are derived from the same intein or split intein gene. Alternatively, the sequences of the N-intein and C-intein are derived from two different intein genes that can undergo protein trans-splicing to reconstitute the full-length stereocilin protein. In some embodiments, the same gene is derived from the same organism or different organisms. A commonly used split intein is derived from the DnaE gene from various organisms. In some embodiments, the polynucleotide encoding the stereocilin protein is split into two parts, each part corresponding to about half of the total coding sequence of the full-length gene, i.e., the N-terminal part and the C-terminal part. The polynucleotide encoding the N-terminal part of the stereocilin is fused at its 3' end in frame with the polynucleotide encoding the N-intein, whereas the polynucleotide encoding the C-terminal part of the stereocilin is fused at its 5' end in frame with the polynucleotide encoding the C-intein.

[0161] In some embodiments, the first vector and the second vector, when introduced into a cell (e.g., a cell of a subject, such as a subject with sensorineural hearing loss, e.g., DFNB16), generate a first fusion protein and a second fusion protein. In some embodiments, the first fusion protein contains an N-terminal portion of a stereocillin protein fused to an N-intein at its C-terminus. In some embodiments, the second fusion protein contains a C-terminal portion of a stereocillin protein fused to a C-intein at its N-terminus. In some embodiments, the N-intein of the first fusion protein and the C-intein of the second fusion protein selectively bind to generate a third fusion protein that contains, from the N-terminus to the C-terminus: an N-terminal portion of a stereocillin protein, an N-intein bound to a C-intein at its C-terminus, and a C-terminal portion of a stereocillin protein. In some embodiments, the N-intein bound to the C-intein can undergo a trans-splicing reaction that excises the N-intein and the C-intein and joins the C-terminus of the N-terminal portion of the stereocillin protein to the N-terminus of the C-terminal portion.

[0162] The split intein systems described herein may include a split intein encoded by a single gene that is then engineered using routine methods to encode two separate intein fragments (e.g., split inteins). In some embodiments, the split intein is encoded by two separate genes.

[0163] Split inteins of the disclosed compositions and methods can be used to identify, for example, Nostoc pentrtiforme (Npu), Synechocystis sp. PCC6803 (Ssp), Fischerella sp. PCC9605 (Fsp), Scytonema tolypothrichoides (Sto), Cyanobacteria bacterium SW_9_47_5, Nodularia spumigena (Nsp), Nostoc flagelliforme (Nfl), Crocosphaera watsonii (Cwa) WH8502, Chroococcidiopsis cubana (Ccu) CCALA043, Trichodesmium erythraeum (Ter), Rhodothermus marinus (Rma), Saccharomyces cerevisiae (Sce), Saccharomyces castellii (Sca ... The DnaE gene may be derived from a cyanobacterium such as Pyrococcus unisporus (Sun), Zygosaccharomyces bisporus (Zbi), Torulaspora pretoriensis (Tpr), Mycobacteria tuberculosis (Mtu), Mycobacterium leprae (Mle), Mycobacterium smegmatis (Msm), Pyrococcus abyssi (Pab), Pyrococcus horikoshii (Pho), Coxiella burnetti (Cbu), Coxiella neoformans (Cne), Coxiella gattii (Cga), Histoplasma capsulatum (Hca), and Porphyra purpurea chloroplast (Ppu). In some embodiments, the split is derived from multiple sequence alignment studies of DnaE to identify a consensus design (e.g., Cfa) to design a split intein with desired stability and activity (e.g., the split intein is a Cfa intein).Other split-intein systems suitable for use with the presently disclosed compositions and methods include those described in International Patent Application Publication Nos. WO2017 / 132580, WO2020 / 079034, WO2018 / 071868, WO2020 / 249723, WO2021 / 099607, WO2021 / 040703, WO2013 / 045632, WO2020 / 146627, and WO2021 / 047558, as well as U.S. Pat. Nos. 10,066,027, 10,526,401, and 8,394,604, each of which is incorporated by reference herein as it relates to split-intein systems.

[0164] In some embodiments, the first vector and the second vector further comprise a 5' inverted terminal repeat (ITR) at their 5' ends and a 3' ITR at their 3' ends. In some embodiments, the 5' ITR and the 3' ITR are ITRs of AAV. In some embodiments, the ITR of AAV is an ITR of AAV2.

[0165] In some embodiments, the two-vector split intein system of the disclosure comprises: a) from 5' to 3': i) an optional 5' ITR (e.g., the 5' ITR of AAV2); ii) a polynucleotide containing an OCM promoter (e.g., the OCM promoter of any one of SEQ ID NOs: 1-3); iii) a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of a stereocillin protein of SEQ ID NO: 4 or SEQ ID NO: 5); iv) a polynucleotide encoding an N-intein; v) an optional poly(A) sequence; and vi) an optional 3' ITR (e.g., the 3' ITR of AAV2). ), and b) a second vector containing, from 5' to 3': i) optionally a 5' ITR (e.g., the 5' ITR of AAV2); ii) a polynucleotide containing an OCM promoter (e.g., the OCM promoter of any one of SEQ ID NOs: 1 to 3); iii) a polynucleotide encoding a C-intein; iv) a polynucleotide encoding a C-terminal portion of a stereocillin protein (e.g., the C-terminal portion of the STRC protein of SEQ ID NO: 4 or SEQ ID NO: 5); (v) optionally a poly(A) sequence; and (vi) optionally a 3' ITR (e.g., the 3' ITR of AAV2).

[0166] In some embodiments, the two-vector split intein system of the disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:8 as shown below, or having an amino acid sequence having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:8.

[0167] CLSYDTEILTVEYGFLPIGKIVEERIECTVYTVDKNGFVYTQPIAQWHNRGEQEVFEYCLEDGSIIRATKDHKFMTTDGQMLPIDEIFERGL (SEQ ID NO: 8) In some embodiments, the two-vector split-intein system of the disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO:9 as shown below, or an amino acid sequence having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:9.

[0168] VKIISRKSLGTQNVYDIGVEKDHNFLLKNGLVASN (SEQ ID NO: 9) In some embodiments, the two-vector split intein system of the disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:10, as shown below, or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:10.

[0169] CLSYDTEILTVEYGFLPIGKIVEERIECTVYTVDKNGFVYTQPIAQWHNRGEQEVFEYCLEDGSIIRATKDHKFMTTDGQMLPIDEIFERGLDLKQVDGLP (SEQ ID NO: 10) In some embodiments, the two-vector split-intein system of the disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO:11 as shown below, or an amino acid sequence having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:11.

[0170] MVKIISRKSLGTQNVYDIGVEKDHNFLLKNGLVASN (SEQ ID NO: 11) In some embodiments, the two-vector split-intein system of the disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO:12 as shown below, or an amino acid sequence having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:12.

[0171] VKIISRKSLGTQNVYDIGVGEPHNFLLKNGLVASN (SEQ ID NO: 12) In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:8 or SEQ ID NO:10 (e.g., located 3' of a polynucleotide encoding an N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO:9, SEQ ID NO:11 or SEQ ID NO:12 (e.g., located 5' of a polynucleotide encoding a C-terminal portion of a stereocillin protein). In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:8 and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO:9. In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:8 and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO:11. In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having the amino acid sequence of SEQ ID NO:8 and a second vector comprising a polynucleotide encoding a C-intein polypeptide having the amino acid sequence of SEQ ID NO:12. In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having the amino acid sequence of SEQ ID NO:10 and a second vector comprising a polynucleotide encoding a C-intein polypeptide having the amino acid sequence of SEQ ID NO:9. In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having the amino acid sequence of SEQ ID NO:10 and a second vector comprising a polynucleotide encoding a C-intein polypeptide having the amino acid sequence of SEQ ID NO:11.In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having the amino acid sequence of SEQ ID NO:10, and a second vector comprising a polynucleotide encoding a C-intein polypeptide having the amino acid sequence of SEQ ID NO:12.

[0172] In some embodiments, the two-vector split intein system of the disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:13, as shown below, or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:13.

[0173] CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN (SEQ ID NO: 13) In some embodiments, the two-vector split-intein system of the disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO:14, as shown below, or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:14.

[0174] MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN (SEQ ID NO: 14) In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having the amino acid sequence of SEQ ID NO: 13 (e.g., located 3' to a polynucleotide encoding the N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having the amino acid sequence of SEQ ID NO: 14 (e.g., located 5' to a polynucleotide encoding the C-terminal portion of a stereocillin protein).

[0175] In some embodiments, the two-vector split intein system of the disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:15, as shown below, or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:15.

[0176] CLSYDTEILTVEYGFLPIGKIVEERIECTVYTVDKNGFVYTQPIAQWHNRGEQEVFEYCLEDGSIIRATKDHKFMTTDGQMLPIDEIFERGLDLKQVDGLP (SEQ ID NO: 15) In some embodiments, the two-vector split-intein system of the disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO:16, as shown below, or an amino acid sequence having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO:16.

[0177] MKRTADGSEFESPKKKRKVKIISRKSLGTQNVYDIGVEKDHNFLLKNGLVASN (SEQ ID NO: 16) In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having the amino acid sequence of SEQ ID NO: 15 (e.g., located 3' to a polynucleotide encoding the N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having the amino acid sequence of SEQ ID NO: 16 (e.g., located 5' to a polynucleotide encoding the C-terminal portion of a stereocillin protein).

[0178] In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of CFSGDTLVALTD (SEQ ID NO: 17). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLAGDTLITLA (SEQ ID NO: 18). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLQNGTRLLR (SEQ ID NO: 19). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLTGDSQVLTR (SEQ ID NO: 20). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLTYETEIMTV (SEQ ID NO: 21). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLSGNTKVRFRY (SEQ ID NO: 22). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding an N-intein peptide having an amino acid sequence with at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NOs: 17-22.

[0179] In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of GVFVHN (SEQ ID NO: 23). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of GLLVHN (SEQ ID NO: 24). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of GLIASN (SEQ ID NO: 25). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence of GLVVHN (SEQ ID NO: 26). In some embodiments, the two-vector split intein system of the present disclosure comprises a polynucleotide encoding a C-intein peptide having an amino acid sequence with at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NOs:23-26.

[0180] In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 17 (e.g., located 3' of the polynucleotide encoding the N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 23 (e.g., located 5' of the polynucleotide encoding the C-terminal portion of a stereocillin protein). In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 20 (e.g., located 3' of the polynucleotide encoding the N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 24 (e.g., located 5' of the polynucleotide encoding the C-terminal portion of a stereocillin protein). In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:21 (e.g., located 3' of a polynucleotide encoding an N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO:25 (e.g., located 5' of a polynucleotide encoding a C-terminal portion of a stereocillin protein). In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO:22 (e.g., located 3' of a polynucleotide encoding an N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO:26 (e.g., located 5' of a polynucleotide encoding a C-terminal portion of a stereocillin protein).

[0181] In some embodiments, the two-vector split intein system of the disclosure comprises one or more polynucleotides that collectively encode an N-intein and C-intein pair set forth in Table 7, as shown below, or an N-intein and C-intein pair that have at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) to an N-intein and C-intein pair set forth in Table 7. In some embodiments, the two-vector split intein system comprises a first vector comprising a polynucleotide encoding an N-intein peptide having an amino acid sequence listed in Table 7 (e.g., located 3' to a polynucleotide encoding the N-terminal portion of a stereocillin protein) and a second vector comprising a polynucleotide encoding a C-intein polypeptide having an amino acid sequence listed in a row of Table 7 as the amino acid sequence of the N-intein (e.g., located 5' to a polynucleotide encoding the C-terminal portion of a stereocillin protein).

[0182] [Table 7]

[0183] The Npu N-intein of SEQ ID NO:27 may be encoded by a polynucleotide having the DNA sequence of SEQ ID NO:41, as shown below. TGCCTGAGCTACGAGACCGAGATCCTGACCGTGGAGTACGGCCTGCTGCCCATCGGCAAGATCGTGGAGAAGAGAATCGAGTGCACCGTGTACAGCGTGGACAACAACGGCAACATCTACACCCAGCCCGTGGCCCAGTGGCACGACAGAGGCGAGC AGGAGGTGTTCGAGTACTGCCTGGAGGACGGCAGCCTGATCAGAGCCACCAAGGACCACAAGTTCATGACCGTGGACGGCCAGATGCTGCCCATCGACGAGATCTTCGAGAGAGCTGGACCTGATGAGAGTGGACAACCTGCCCAAC (SEQ ID NO: 41) The Npu C-intein of SEQ ID NO:28 may be encoded by a polynucleotide having the DNA sequence of SEQ ID NO:42, as shown below.

[0184] ATCAAGATCGCCACAAGAAAGTACCTGGGCAAGCAGAACGTGTACGACATCGGCGTGGAGAGAGACCACAACTTCGCCCTGAAGAACGGCTTCATCGCCAGCAAT (SEQ ID NO: 42) Split inteins of the present disclosure (i.e., N-inteins and C-inteins) can contain a nucleophilic amino acid at or near its N-terminus or C-terminus that is capable of undergoing a trans-splicing reaction, hi some embodiments, the nucleophilic amino acid is selected from serine, threonine, cysteine, or alanine.

[0185] In some embodiments, the first vector and / or the second vector further comprise one or more additional regulatory sequences, such as, for example, a woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), an enhancer sequence, a poly(A) sequence, a terminator sequence, or a degradation signal, among others.

[0186] In some embodiments, the split intein systems described herein include a ligand-dependent intein that effects protein splicing upon contact with a ligand (e.g., a small molecule such as 4-hydroxytamoxifen, a peptide, a protein, a polynucleotide, an amino acid, a nucleotide, etc.) Various ligand-dependent inteins are described in U.S. Patent Application Publication No. 2014 / 0065711, the disclosure of which is incorporated herein by reference with respect to ligand-dependent inteins.

[0187] The present disclosure provides vectors that contain one or more degradation signals within the intein (e.g., N-intein or C-intein) polypeptide(s) that mediate protein degradation by the ubiquitin-proteasome system and / or the autophagy-lysosomal pathway. Such sequences may be incorporated into the vector systems of the present disclosure to avoid or reduce accumulation of excised intein proteins in target cells. Exemplary degradation signals include N-degrons and C-degrons, which are peptide sequences that contain motifs that contain lysine residues that can be polyubiquitinated and subsequently targeted for degradation. In some embodiments, a degron is a degradation signal located within a protein sequence (e.g., an intein sequence) that is not present at the N- or C-terminus of the protein sequence. In some embodiments, an N-intein protein contains one or more (e.g., 2, 3, 4, 5 or more) degrons. In some embodiments, a C-intein protein contains one or more (e.g., 2, 3, 4, 5 or more) degrons. In some embodiments, the degron is a CL1 degron, which is a C-terminal destabilizing peptide that shares structural similarity with misfolded proteins and is recognized by the ubiquitination system. In some embodiments, the degron is a PB29, SMN, CIITA or ODC degron. Such degradation signals are described in International Publication No. WO2016 / 13932, which is incorporated herein by reference for its degradation signals. Another example of a degradation signal includes the degron from E. coli dihydrofolate reductase (ecDHFR), as described in WO2020 / 079034, which is incorporated herein by reference.Additional degradation signals include the FKBP12 degradation domain (Banaszynski et al., Cell, 126:995-1004, 2006), the PEST degradation domain (Rechsteiner and Rogers, Trends Biochem Sci. 21:267-271, 1996), the UbR tag ubiquitination signal (Chassin et al., Nat. Commun. 10:2013, 2019), and destabilizing mutations in human ELRBD (Miyazaki et al., J. Am. Chem. Soc., 134:3942-3945, 2012).

[0188] Vectors for the expression of stereocillin In addition to achieving high transcription and translation rates, stable expression of exogenous genes in mammalian cells can be achieved by integrating a polynucleotide containing the gene into the nuclear genome of mammalian cells. Various vectors have been developed for delivering and integrating polynucleotides encoding stereocillin into the nuclear DNA of mammalian cells. Examples of expression vectors are described, for example, in Gellissen, Production of Recombinant Proteins: Novel Microbial and Eukaryotic Expression Systems (John Wiley & Sons, Marblehead, Massachusetts, 2006). Expression vectors for use in the compositions and methods described herein contain an OCM promoter (e.g., a polynucleotide having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to any one of the promoter sequences listed in Table 3 (e.g., any one of SEQ ID NOs: 1-3)) operably linked to a polynucleotide sequence encoding a portion of a stereocillin protein (e.g., a portion of SEQ ID NO: 4 or SEQ ID NO: 5), as well as additional sequence elements used, for example, for expression of these agents and / or integration of these polynucleotide sequences into a mammalian cell genome. Vectors that can contain an OCM-specific promoter operably linked to a transgene encoding a portion of a stereocillin protein include plasmids (e.g., circular DNA molecules capable of autonomously replicating in a cell), cosmids (e.g., pWE or sCos vectors), artificial chromosomes (e.g., human artificial chromosomes (HACs), yeast artificial chromosomes (YACs), bacterial artificial chromosomes (BACs), or P1-derived artificial chromosomes (PACs)), and viral vectors. Particular vectors that can be used to express stereocillin include plasmids that contain regulatory sequences, such as enhancer regions, that direct gene transcription.Other vectors useful for expressing stereocillin proteins contain polynucleotide sequences that enhance the translation rate of the gene or improve the stability or nuclear export of the mRNA resulting from gene transcription. These sequence elements include, for example, 5' and 3' untranslated regions, internal ribosome entry sites (IRES), and polyadenylation signal sites to direct efficient transcription of the gene carried by the expression vector. Expression vectors suitable for use in the compositions and methods described herein may also contain polynucleotides encoding markers for selecting cells containing such vectors. Examples of suitable markers include genes encoding resistance to antibiotics such as ampicillin, chloramphenicol, kanamycin, or nourseothricin.

[0189] Viral Vectors for Polynucleotide Delivery Viral genomes provide a rich source of vectors that can be used to efficiently deliver STRC into the genome of target cells (e.g., mammalian cells such as human cells). Viral genomes are particularly useful vectors for gene delivery because polynucleotides contained within such genomes are usually integrated into the nuclear genome of mammalian cells by generalized or specialized transduction. These processes occur as part of the natural viral replication cycle and do not require the addition of proteins or reagents to induce gene integration. Examples of viral vectors include retroviruses (e.g., Retroviridae family viral vectors), adenoviruses (e.g., Ad5, Ad26, Ad34, Ad35, and Ad48), parvoviruses (e.g., adeno-associated viruses), coronaviruses, negative strand RNA viruses such as orthomyxoviruses (e.g., influenza viruses), rhabdoviruses (e.g., rabies virus and vesicular stomatitis virus), paramyxoviruses (e.g., measles and Sendai), positive strand RNA viruses such as picornaviruses and alphaviruses, as well as double-stranded DNA viruses including adenoviruses, herpesviruses (e.g., herpes simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxviruses (e.g., vaccinia, mutated vaccinia Ankara (MVA), fowlpox, and canarypox). Other viruses include, for example, Norwalk virus, togavirus, flavivirus, reovirus, papovavirus, hepadnavirus, human papillomavirus, human foamy virus, and hepatitis virus. Examples of retroviruses include: avian leukosis sarcoma, avian C virus, mammalian C, B, and D viruses, oncoretroviruses, HTLV-BLV complex, lentiviruses, alpharetroviruses, gammaretroviruses, and spumaviruses (Coffin, JM, Retroviridae: The viruses and their replication, Virology, Third Edition (Lippincott-Raven, Philadelphia, 1996)).Other examples include murine leukemia virus, murine sarcoma virus, mouse mammary tumor virus, bovine leukemia virus, feline leukemia virus, feline sarcoma virus, avian leukemia virus, human T-cell leukemia virus, baboon endogenous virus, gibbon leukemia virus, Mason-Pfizer monkey virus, simian immunodeficiency virus, simian sarcoma virus, Rous sarcoma virus and lentivirus. Other examples of vectors are described, for example, in U.S. Patent No. 5,801,030, the disclosure of which is incorporated herein by reference as it pertains to viral vectors for use in gene therapy.

[0190] AAV vectors for polynucleotide delivery In some embodiments, the polynucleotides of the compositions and methods described herein are incorporated into rAAV vectors and / or rAAV viral particles to facilitate their introduction into cells. The rAAV vectors useful in the compositions and methods described herein are recombinant polynucleotide constructs that include (1) an OCM promoter described herein (e.g., a polynucleotide having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to any one of the promoter sequences listed in Table 3 (e.g., any one of SEQ ID NOs: 1-3)), (2) a heterologous sequence to be expressed (e.g., a polynucleotide encoding an N-terminal or C-terminal portion of a stereocillin protein), and (3) viral sequences that facilitate the integration and expression of the heterologous gene. The viral sequences may include sequences of AAV required in cis for DNA replication and packaging into viral particles (e.g., functional ITRs). In a typical application, the transgene encodes a wild-type form of a protein (e.g., stereocillin) that is mutated in subjects with a form of hereditary deafness, which may be useful for improving hearing in subjects carrying a mutation (e.g., DFNB16) associated with deafness or hearing impairment. Such rAAV vectors may also contain a marker gene or a reporter gene. In useful rAAV vectors, one or more AAV WT genes are deleted in whole or in part, but functional adjacent ITR sequences are retained. The AAV ITRs may be of any serotype suitable for a particular application. For use in the methods and compositions described herein, the ITRs may be AAV2 ITRs. Methods for using rAAV vectors are described, for example, in Tal et al., J. Biomed. Sci. 7:279 (2000), and Monahan and Samulski, Gene Delivery 7:24 (2000), the disclosures of each of which are incorporated herein by reference as they pertain to AAV vectors for gene delivery.

[0191] The polynucleotides and vectors described herein (e.g., an OCM promoter operably linked to a polynucleotide encoding the N-terminal portion, or in some embodiments, the C-terminal portion, of a stereocillin protein) can be incorporated into rAAV viral particles to facilitate the introduction of the polynucleotide or vector into cells. The capsid protein of AAV constitutes the external non-nucleic acid portion of the viral particle and is encoded by the AAV cap gene. The cAP gene encodes the three viral coat proteins VP1, VP2, and VP3 required for viral particle assembly. Construction of rAAV viral particles has been described, for example, in US 5,173,414; US 5,139,941; US ​​5,863,541; US ​​5,869,305; US 6,057,152; and US 6,376,237; as well as Rabinowitz et al., J. Virol. 76:791 (2002) and Bowles et al., J. Virol. 77:423 (2003), the disclosures of each of which are incorporated by reference herein as they pertain to AAV vectors for gene delivery.

[0192] rAAV viral particles useful in combination with the compositions and methods described herein include viral particles derived from various AAV serotypes, including AAV1, 2, 3, 4, 5, 6, 7, 8, 9, 10, rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ / 8, DJ / 9, 7m8, PHP.B, PHP.eb, and PHP.S. When targeting hair cells, AAV1, AAV2, AAV2quad(YF), AAV6, AAV8, AAV9, Anc80, Anc80L65, DJ / 9, 7m8, and PHP.B may be particularly useful. Serotypes evolved for transduction of the retina may also be used in the methods and compositions described herein. The construction and use of AAV vectors and AAV proteins of different serotypes have been described, for example, in Chao et al., Mol. Ther. 2:619 (2000); Davidson et al., Proc. Natl. Acad. Sci. USA, 97:3428 (2000); Xiao et al., J. Virol. 72:2224 (1998); Halbert et al., J. Virol. 74:1524 (2000); Halbert et al., J. Virol. 75:6615 (2001); and Auricchio et al., Hum. Molec. Genet. 10:3075 (2001), the disclosures of each of which are incorporated by reference herein as they pertain to AAV vectors for gene delivery.

[0193] Useful in conjunction with the compositions and methods described herein are pseudotyped rAAV vectors. Pseudotyped vectors include AAV vectors of a given serotype (e.g., AAV9) pseudotyped with a capsid gene from a serotype other than the given serotype (e.g., AAV1, AAV2, AAV2quad(YF), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, etc.). Techniques involving the construction and use of pseudotyped rAAV viral particles are known in the art and are described, for example, in Duan et al., J. Virol. 75:7662 (2001); Halbert et al., J. Virol. 74:1524 (2000); Zolotukhin et al., Methods, 28:158 (2002); and Auricchio et al., Hum. Molec. Genet. 10:3075 (2001).

[0194] AAV viral particles having mutations in the capsid of the viral particle can be used to infect a particular cell type more effectively than non-mutated capsid viral particles. For example, suitable AAV mutants can have ligand insertion mutations to facilitate targeting of AAV to a particular cell type. The construction and characterization of AAV capsid mutants, including insertion mutants, alanine screening mutants, and epitope tag mutants, are described in Wu et al., J. Virol. 74:8635 (2000). Other rAAV viral particles that can be used in the methods described herein include capsid hybrids generated by molecular breeding of viruses and by exon shuffling. See, for example, Soong et al., Nat. Genet., 25:436 (2000) and Kolman and Stemmer, Nat. Biotechnol. 19:423 (2001).

[0195] Pharmaceutical Compositions The nucleic acid vectors described herein may be incorporated into a vehicle for administration to a patient, such as a human patient suffering from sensorineural hearing loss. Pharmaceutical compositions containing vectors, such as viral vectors, containing polynucleotides encoding a portion of a stereocillin protein, can be prepared using methods known in the art. For example, such compositions can be prepared in a desired form, such as a lyophilized formulation or an aqueous solution, using, for example, physiologically acceptable carriers, excipients or stabilizers (Remington: The Science and Practice of Pharmacology 22nd edition, Allen, L. Ed. (2013); incorporated herein by reference).

[0196] Mixtures of the nucleic acid vectors (e.g., viral vectors) described herein may be prepared in water suitably mixed with one or more excipients, carriers, or diluents. Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof, and in oils. These preparations may contain a preservative to prevent the growth of microorganisms under ordinary storage and use conditions. Pharmaceutical forms suitable for injection use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions (described in US 5,466,468, the disclosure of which is incorporated herein by reference). In any case, the preparation may be sterile and may have sufficient fluidity for easy injection. The preparation may be stable under the conditions of manufacture and storage and may be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier may be, for example, a solvent or dispersion medium containing water, ethanol, a polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, etc.), suitable mixtures thereof, and / or vegetable oils. Proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. Prevention of microbial action may be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of injectable compositions may be brought about by the use in the composition of agents which delay absorption, for example, aluminum monostearate and gelatin.

[0197] For example, solutions containing the pharmaceutical compositions described herein are suitably buffered if necessary, and liquid diluents are first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are particularly suitable for intravenous, intramuscular, subcutaneous, and intraperitoneal administration. In this regard, sterile aqueous media that can be employed will be known to those of skill in the art in light of the present disclosure. For example, one dose may be dissolved in 1 ml of isotonic NaCl solution and added to 1000 ml of subcutaneous injection solution or injected at the intended site of injection. Some variation in dose will necessarily occur depending on the condition of the subject being treated. For local administration to the inner ear, the composition may be formulated to contain a synthetic perilymph solution. An exemplary synthetic perilymph solution contains 20-200 mM NaCl, 1-5 mM KCl, 0.1-10 mM CaCl2, 1-10 mM glucose, and 2-50 mM HEPES, and has a pH between about 6 and 9, and an osmolality of about 300 mOsm / kg. The individual responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations may meet sterility, pyrogenicity, general safety, and purity standards as required by FDA Office of Biologics standards.

[0198] Treatment method The compositions described herein may be administered to a subject having or at risk of developing sensorineural hearing loss by a variety of routes, such as local administration to the inner ear (e.g., administration to the perilymph or endolymph, e.g., administration to or through the oval window, round window, or semicircular canal (horizontal semicircular canal), or by transtympanic or intratympanic injection, e.g., administration to OHCs), intravenous, parenteral, intradermal, transdermal, intramuscular, intranasal, subcutaneous, transdermal, intratracheal, intraperitoneal, intraarterial, intravascular, inhalation, perfusion, lavage, and oral administration. The most suitable route for administration in a given case will depend on the particular composition administered, the patient, the pharmaceutical formulation method, the method of administration (e.g., time and route of administration), the patient's age, weight, sex, severity of the disease being treated, the patient's diet, and the patient's excretion rate. The compositions may be administered once, or more than once (e.g., annually, twice a year, three times a year, bimonthly, or monthly). In some embodiments, the first nucleic acid vector and the second nucleic acid vector are administered simultaneously (e.g., in one composition). In some embodiments, the first nucleic acid vector and the second nucleic acid vector are administered sequentially (e.g., the second nucleic acid vector is administered immediately after the first nucleic acid vector, or 5 minutes, 10 minutes, 15 minutes, 20 minutes, 25 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 8 hours, 12 hours, 1 day, 2 days, 7 days, 2 weeks, 1 month, or more after the first nucleic acid vector). The first nucleic acid vector and the second nucleic acid vector can have the same capsid or different capsids (e.g., AAV capsids).

[0199] Subjects that may be treated as described herein are those who have or are at risk of developing sensorineural hearing loss. The compositions and methods described herein can be used to treat subjects who have a mutation in STRC (e.g., a mutation that reduces the function or expression of STRC, or a STRC mutation associated with sensorineural hearing loss, such as a subject with DFNB16), a family history of autosomal recessive sensorineural hearing loss or hearing impairment (e.g., a family history of STRC-associated hearing loss), or subjects whose STRC mutation status and / or STRC activity level are unknown. The methods described herein may include screening the subject for a mutation in STRC prior to treatment with or administration of the compositions described herein. Subjects can be screened for a mutation in STRC using standard methods known to those skilled in the art (e.g., genetic testing). The methods described herein may also include evaluating hearing in the subject prior to treatment with or administration of the compositions described herein. Hearing can be evaluated using standard tests such as audiometry, auditory brainstem response (ABR), electrocochleography (ECOG), and otoacoustic emissions. The compositions and methods described herein may also be administered as a prophylactic treatment to patients at risk of developing hearing loss or auditory neuropathy, for example, patients with a family history of inherited hearing loss or patients carrying a STRC mutation who have not yet demonstrated hearing loss or hearing impairment.

[0200] Treatment may include administration of a composition containing a nucleic acid vector (e.g., an AAV viral vector) as described herein in various unit doses. Each unit dose will typically contain a predetermined amount of the therapeutic composition. The amount administered, as well as the particular route of administration and formulation, is within the skill of one of ordinary skill in the clinical arts. The unit dose need not be administered as a single injection, but may include continuous infusion over a set period of time. Administration may be performed using a syringe pump to control the rate of infusion to minimize damage to the inner ear (e.g., the cochlea). When the nucleic acid vector is an AAV vector (e.g., an AAV1, AAV2, AAV2quad(YF), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ / 8, DJ / 9, 7m8, PHP.B, PHP.eb, or PHP.S vector), the viral vector may be administered in a concentration of, for example, about 1×10 9 Vector genome (VG) / mL ~ approx. 1 x 10 16 VG / mL (e.g., 1×10 9 VG / mL, 2×10 9 VG / mL, 3×10 9 VG / mL, 4×10 9 VG / mL, 5×10 9 VG / mL, 6×10 9 VG / mL, 7×10 9 VG / mL, 8×10 9 VG / mL, 9×10 9 VG / mL, 1×10 10 VG / mL, 2×10 10 VG / mL, 3×10 10 VG / mL, 4×10 10 VG / mL, 5×10 10 VG / mL, 6×10 10 VG / mL, 7×10 10 VG / mL, 8×10 10 VG / mL, 9×10 10 VG / mL, 1×10 11 VG / mL, 2×10 11 VG / mL, 3×10 11 VG / mL, 4×10 11 VG / mL, 5×1011 VG / mL、6×10 11 VG / mL、7×10 11 VG / mL、8×10 11 VG / mL、9×10 11 VG / mL、1×10 12 VG / mL、2×10 12 VG / mL、3×10 12 VG / mL、4×10 12 VG / mL、5×10 12 VG / mL、6×10 12 VG / mL、7×10 12 VG / mL、8×10 12 VG / mL、9×10 12 VG / mL、1×10 13 VG / mL、2×10 13 VG / mL、3×10 13 VG / mL、4×10 13 VG / mL、5×10 13 VG / mL、6×10 13 VG / mL、7×10 13 VG / mL、8×10 13 VG / mL、9×10 13 VG / mL、1×10 14 VG / mL、2×10 14 VG / mL、3×10 14 VG / mL、4×10 14 VG / mL、5×10 14 VG / mL、6×10 14 VG / mL、7×10 14 VG / mL、8×10 14 VG / mL、9×10 14 VG / mL、1×10 15 VG / mL、2×10 15 VG / mL、3×10 15 VG / mL、4×10 15 VG / mL、5×10 15 VG / mL、6×10 15 VG / mL、7×10 15 VG / mL、8×10 15 VG / mL、9×10 15 VG / mL、or 1×10 16The AAV vector may be administered to a patient in a volume of 1 μL to 200 μL (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 μL) at a dose of about 1×10 7 VG / ear ~ approx. 2 x 10 15 VG / ear (e.g. 1×10 7 VG / ear, 2×10 7 VG / ear, 3×10 7 VG / ear, 4×10 7 VG / ear, 5×10 7 VG / ear, 6×10 7 VG / ear, 7×10 7 VG / ear, 8×10 7 VG / ear, 9×10 7 VG / ear, 1×10 8 VG / ear, 2×10 8 VG / ear, 3×10 8 VG / ear, 4×10 8 VG / ear, 5×10 8 VG / ear, 6×10 8 VG / ear, 7×10 8 VG / ear, 8×10 8 VG / ear, 9×10 8 VG / ear, 1×10 9 VG / ear, 2×10 9 VG / ear, 3×10 9 VG / ear, 4×10 9 VG / ear, 5×10 9 VG / ear, 6×10 9 VG / ear, 7×10 9 VG / ear, 8×10 9 VG / ear, 9×10 9 VG / ear, 1×10 10 VG / ear, 2×10 10 VG / ear, 3×10 10 VG / ear, 4×10 10 VG / ear, 5×10 10 VG / ear, 6×10 10 VG / ear, 7×10 10 VG / ear, 8×10 10 VG / ear, 9×1010 VG / ear, 1×10 11 VG / ear, 2×10 11 VG / ear, 3×10 11 VG / ear, 4×10 11 VG / ear, 5×10 11 VG / ear, 6×10 11 VG / ear, 7×10 11 VG / ear, 8×10 11 VG / ear, 9×10 11 VG / ear, 1×10 12 VG / ear, 2×10 12 VG / ear, 3×10 12 VG / ear, 4×10 12 VG / ear, 5×10 12 VG / ear, 6×10 12 VG / ear, 7×10 12 VG / ear, 8×10 12 VG / ear, 9×10 12 VG / ear, 1×10 13 VG / ear, 2×10 13 VG / ear, 3×10 13 VG / ear, 4×10 13 VG / ear, 5×10 13 VG / ear, 6×10 13 VG / ear, 7×10 13 VG / ear, 8×10 13 VG / ear, 9×10 13 VG / ear, 1×10 14 VG / ear, 2×10 14 VG / ear, 3×10 14 VG / ear, 4×10 14 VG / ear, 5×10 14 VG / ear, 6×10 14 VG / ear, 7×10 14 VG / ear, 8×10 14 VG / ear, 9×10 14 VG / ear, 1×10 15 VG / ear, or 2×10 15 The subject may be administered a dose of 100 mg / ear (VG / ear).

[0201] The compositions described herein are administered in an amount sufficient to improve hearing, increase expression of a stereocillin protein (e.g., a WT stereocillin protein, such as a stereocillin protein having a sequence of SEQ ID NO: 4 or 5, e.g., expression in cochlear hair cells, e.g., outer hair cells), enhance stereocillin function, improve OHC structure, improve OHC function, prevent or reduce OHC damage or death, improve attachment of OHC hair bundles to the tectorial membrane, or improve OHC viability. Hearing may be assessed using standard hearing tests (e.g., audiometry, ABR, electrocochleography (ECOG), and otoacoustic emissions), and may be improved by 5% or more (e.g., 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 200% or more) compared to hearing measurements obtained before treatment. In some embodiments, the composition is administered in an amount sufficient to improve the subject's ability to understand speech. The compositions described herein may also be administered in an amount sufficient to delay or prevent the onset or progression of sensorineural hearing loss (e.g., in subjects who carry a genetic mutation in the STRC gene associated with hearing loss or have a family history of hearing loss (e.g., autosomal recessive hearing loss) but do not exhibit hearing impairment, or in subjects who exhibit mild to moderate hearing loss). Expression of stereocillin may be assessed using immunohistochemistry, Western blot analysis, quantitative real-time PCR, or other methods known in the art for detecting protein or mRNA, and may increase by 5% or more (e.g., 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 200% or more) compared to the expression of stereocillin before administration of the compositions described herein.The function of the OHCs or the function of the stereocillin protein encoded by the nucleic acid vector administered to the subject may be indirectly assessed based on a hearing test, and may be improved by 5% or more (e.g., 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 200% or more) compared to the function of the OHCs or the function of the protein before administration of the compositions described herein. These effects may occur, for example, within 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 15 weeks, 20 weeks, 25 weeks or more after administration of the compositions described herein. Depending on the dose and route of administration used for the treatment, the patient may be evaluated 1 month, 2 months, 3 months, 4 months, 5 months, 6 months or more after administration of the composition. Depending on the results of the evaluation, the patient may receive additional treatment.

[0202] kit The compositions described herein can be provided in a kit for use in treating a subject with sensorineural hearing loss, such as, for example, sensorineural hearing loss associated with a mutation in the STRC gene. The compositions can include a polynucleotide described herein (e.g., a polynucleotide having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to any one of the OCM promoter sequences listed in Table 3 (e.g., any one of SEQ ID NOs: 1-3) operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein, and a polynucleotide encoding a C-terminal portion of a stereocillin protein. The kit may comprise a nucleic acid vector system (e.g., a two-vector system as described herein) containing such a polynucleotide. The nucleic acid vector may be packaged in an AAV viral capsid (e.g., AAV1, AAV2, AAV2quad(YF), AAV6, AAV8, AAV9, Anc80, Anc80L65, DJ / 9, 7m8, or PHP.B). The kit may further comprise a package insert instructing a user of the kit, e.g., a physician, to practice the methods described herein. The kit may optionally include a syringe or other device for administering the composition.

[0203] Working Example The following examples are presented to provide one of ordinary skill in the art with an illustration of how the compositions and methods described herein can be used, made, and evaluated, and are intended to be purely illustrative of the disclosure and are not intended to limit the scope of what the inventors regard as their disclosure.

[0204] Example 1: The OCM promoter sequence drives transgene expression in OHCs in the mouse cochlea in vivo. To determine the efficacy of the constructed OCM promoter (SEQ ID NO: 1) in inducing transgenes in OHCs in vivo, mouse cochleae were transduced with either an AAV vector expressing GFP under the control of the cytomegalovirus (CMV) promoter or an AAV vector expressing GFP under the control of the OCM promoter. Specifically, AAV-OCM-GFP virus was injected into 2-day-old CBA / CaJ mice via the posterior semicircular canal at a dose of 7.7E+9 vector genomes per ear. Mice were allowed to recover from surgery and were euthanized 19 days later and perfused with 10% neutral buffered formalin. Inner ear temporal bones were harvested and decalcified in 8% EDTA for 3 days. Cochleae were removed from the decalcified temporal bones, immunostained with myosin 7a (Myo7a) antibody, which labels all hair cells, and mounted on slides for confocal image analysis. Native GFP fluorescence is shown. Using a ubiquitous promoter, AAV-CMV-GFP induced GFP expression in many cell types within the cochlea, including inner hair cells, outer hair cells, spiral ganglion neurons, mesenchymal cells, and glia (Figure 1A). Using an outer hair cell-specific promoter, AAV-OCM (SEQ ID NO: 1)-GFP induced GFP expression only in outer hair cells (Figure 1B).

[0205] Example 2. OCM promoter-driven GFP expression is enhanced in outer hair cells in the non-human primate organ of Corti. To examine the specificity of the OCM promoter of SEQ ID NO: 1 in vivo in non-human primates, non-human primates (Macaca fascicularis) were injected into the ears of the animal with an AAV vector containing nuclear-targeted H2B-eGFP operably linked to the OCM promoter of SEQ ID NO: 1. Adult non-human primates were injected with 40 μl of vector (3.41 × 10 13 / ml) was injected.

[0206] At 4 weeks of age, animals were sacrificed and fixed via cardiac perfusion in 10% NBF, after which their temporal bones were harvested and kept in 10% NBF for an additional 4–10 days. Ears were decalcified in formic acid (Immunocal) for 6 days, embedded in paraffin, and cut into 5 μm sections.

[0207] Sections were labeled with an antibody against GFP and stained with a secondary antibody conjugated with alkaline phosphatase, developing a red color stain by reaction of the fast red dye with the alkaline phosphatase of the secondary antibody. Sections were counterstained with blue hematoxylin to visualize all nuclei, imaged with a color camera at 20x magnification, and converted to grayscale (Figure 2A-B, upper images (panels A and B, respectively). Figure 2A is a photomicrograph of a single paraffin section from the first animal, and Figure 2B is a photomicrograph of a single paraffin section from the second animal). To visualize the red signal of the colored anti-GFP staining, all blue (hematoxylin) colors were extracted from the color images using the image processing software GIMP utilizing selected color tools, and then converted to grayscale. Only nuclei with red signal nuclear H2B-GFP remained visible (Figure 2A-B, lower images (panels A' and B', respectively). Scale indicates 100 μm. The inner hair cells (IHCs) and outer hair cells (OHCs) are highlighted for orientation.

[0208] Example 3. Anc80-CMV-mStrc duplicated double vector system rescued hearing in stereocillin-deficient mice. Using CRISPR-Cas9 technology, we generated stereocillin-deficient mice in the CBA / CaJ background by creating a frameshift at base pair position 232 of STRC. Wild-type animals in the CBA / CaJ background showed clear stereocillin antibody staining at the tips of stereocilia in outer hair cells (OHCs) (Figure 3A, lower panel), whereas Strc-KO animals at base pair 232 lacked antibody signal (Figure 3B, lower panel). Mouse STRC was encapsulated in a double Anc80 vector, where the first vector carried the CMV promoter and cDNA nucleotides 1-3200 of mouse STRC, and the second vector carried amino acids 2201-5430, resulting in a 1000 base pair overlap between the two halves of the full-length cDNA. After delivery of both vectors at a concentration of 1E10 vg / ear via the posterior semicircular canal into the cochleae of early postnatal bp232 Strc-KO mice, novel stereocillin protein expression was observed in the tips of OHCs and in the bodies of inner hair cells of the organ of Corti in treated bp232 Strc-KO mice (Figure 3C, lower panel).Four weeks after treatment with Anc80-CMV-mStrc(duplicate), we assessed distortion product otoacoustic emissions (DPOAEs) as a direct index of OHC function, and measured auditory brainstem responses (ABRs) as an index of an intact ascending auditory pathway. Untreated contralateral ears in bp232 Strc-KO animals ("untreated ears") showed nearly absent DPOAEs and very high ABR thresholds indicative of loss of OHC function (Figures 4A-4B, open circles), whereas treated bp232 Strc-KO animals ("treated ears") showed recovery of hearing thresholds (Figures 4A-4B, filled circles). The best responders of treated bp232 Strc-KO animals (Figures 4A-4B, filled squares) showed hearing thresholds close to those of wild type ("CBA / CaJ") (Figures 4A-4B, triangles). A high percentage of OHCs in bp232 Strc-KO mice expressing stereocillin after treatment with AAV-Anc80-CMV-mStrc were found to promote hearing recovery (Figure 4C).

[0209] Example 4.2 The vector split-intein system reconstituted full-length stereocillin in vitro. To generate the experimental plasmids, DNA encoding amino acids 1-746 of stereocillin ("N-Strc") was genetically fused to the Npu N-intein fragment (SEQ ID NO: 41, encoding the Npu N-intein of SEQ ID NO: 27) and cloned into a plasmid containing a constitutively active CMV promoter to generate CMV.N-Strc-N-Npu. DNA encoding amino acids 747-1809 of stereocillin ("C-Strc") was genetically fused downstream of the Npu C-intein fragment (SEQ ID NO: 42, encoding the Npu C-intein of SEQ ID NO: 28) and cloned into a plasmid containing a CMV promoter to generate CMV.C-Npu-C-Strc. As a control, the full-length stereocillin coding sequence ("FL-Strc") was also cloned into the CMV plasmid to generate CMV.FL-Strc. CMV.GFP was used as a negative control.

[0210] HEK293T cells were transfected with either a control plasmid or a combination of N-Strc and C-Strc plasmids using Lipofectamine 3000 kit (Life Technologies) and incubated for 3 days under standard cell culture conditions. Cell cultures were washed with PBS, cells were lysed and proteins were extracted. Protein lysate concentrations were measured using a BCA assay and constant masses of protein were loaded for Western blotting using antibodies against beta-actin and stereocillin. Densitometer measurements of protein band intensity were used to determine the relative amount of full-length stereocillin derived from the samples.

[0211] As shown in Figures 5A-5B, the intein designs examined produced full-length stereocillin bands. Example 5. AAV dual vector system for OCM promoter-driven stereocillin expression.

[0212] An AAV dual vector system using stereocillin coding sequence overlap for homologous recombination was designed using two plasmids. The first plasmid contained the mouse OCM promoter of SEQ ID NO: 1 operably linked to the N-terminal portion of mouse STRC encoded by the first 3200 nucleotides of the coding sequence and flanked by 5' and 3' ITR sequences (plasmid P959; SEQ ID NO: 43; FIG. 6A). The second plasmid (P724; SEQ ID NO: 44; FIG. 6B) contained, from 5' to 3', a 500 nucleotide overlap of the STRC sequence encoded by the first plasmid, followed by 2730 nucleotides encoding the remaining C-terminal portion of mouse STRC, a woodchuck posttranscriptional regulatory element (WPRE), and a polyadenylation sequence of bovine growth hormone (bGH). These elements in the second plasmid were also flanked by 5' and 3' ITR sequences.

[0213] AAV viral vectors are synthesized by transfecting HEK293T cells with one of these plasmids together with a rep / cap-containing plasmid and an adenovirus helper plasmid using standard protocols. The plasmids are packaged into AAV8 serotype vectors using standard methods and obtained from commercial sources. The cell culture medium and cells are then harvested to extract and purify the AAV. The AAV from the cells is released from the cells via three cycles of freeze-thawing, and the cell culture medium is harvested to obtain the secreted AAV. The AAV from the cell culture medium is concentrated by adding PEG8000 to the solution, incubated at 4°C, and centrifuged to recover the AAV particles. The AAV particles are purified by passing all the AAV through an iodoxanol density gradient centrifugation, and the buffer is exchanged into PBS with 0.01% Pluronic F68 by passing the purified AAV and buffer through a 100 kDa molecular weight cutoff centrifugation column. The AAV vectors derived from each of the two plasmids are used in combination by administration to the mouse ear (e.g., local administration to the inner ear).

[0214] An alternative design of the AAV dual vector system utilized a first plasmid (P960; SEQ ID NO: 45; FIG. 7A) containing, in 5' to 3' order, the mouse OCM promoter of SEQ ID NO: 1 operably linked to the 2700 nucleotides encoding the N-terminal portion of mouse stereocillin, an AP splice donor, an AP head sequence, and a 3'ITR sequence. The second plasmid of this system contained, in 5' to 3' order, the 5'ITR sequence, an AP head sequence homologous to the AP head sequence in the first plasmid, an AP splice acceptor, 2730 nucleotides encoding the remaining C-terminal portion of mouse stereocillin, a bGH polyA sequence, and a 3'ITR (P726; SEQ ID NO: 46; FIG. 7B). An AAV viral vector incorporating parts of these two plasmids is synthesized as described above.

[0215] Example 6. Administration of a composition containing a two-vector system containing an OCM promoter operably linked to a coding sequence for stereocillin to a subject with sensorineural hearing loss. According to the methods disclosed herein, a practitioner of skill in the art can treat a patient, e.g., a human patient, with sensorineural hearing loss (e.g., sensorineural hearing loss associated with a mutation in STRC, such as DFNB16), to improve or restore hearing. To this end, a practitioner of skill in the art can administer to a human patient a composition containing a two-vector nucleic acid expression system, such a system utilizing two AAV vectors (e.g., AAV1, AAV2, AAV2quad(YF), AAV6, AAV9, Anc80, Anc80L65, DJ / 9, 7m8, or PHP.B vectors) that together contain an OCM promoter (e.g., a polynucleotide having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to any one of SEQ ID NOs:1-3) operably linked to a STRC transgene.

[0216] The two-vector system may be an overlapping dual vector system containing a first and a second AAV vector. The overlapping dual vector system may include a first AAV vector comprising an OCM promoter operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4) and a second AAV vector comprising a polynucleotide encoding a C-terminal portion of a stereocillin protein, where the 3' end of the coding sequence for stereocillin in the first vector overlaps with the 5' end of the coding sequence for stereocillin in the second vector. In another example, the two-vector system may be a trans-splicing dual vector system containing a first and a second AAV vector. A trans-splicing dual vector system may comprise a first AAV vector comprising an OCM promoter operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4) and a splice donor signal sequence 3' of the polynucleotide, and a second AAV vector comprising a splice acceptor signal sequence 5' of the polynucleotide encoding the C-terminal portion of the stereocillin protein. In another example, the two-vector system may be a dual hybrid vector system containing a first and a second AAV vector. The two-hybrid vector system may comprise a first AAV vector comprising an OCM promoter operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4), a splice donor signal sequence 3' of the polynucleotide, and a first recombinogenic region 3' of the splice donor signal sequence, and a second AAV vector comprising a second recombinogenic region, a splice acceptor signal sequence 3' of the recombinogenic region, and a polynucleotide encoding a C-terminal portion of a stereocillin protein 3' of the splice acceptor signal sequence. In yet another example, the two-vector system may be a split intein trans-splicing system comprising a first AAV vector and a second AAV vector.The split intein trans-splicing two-vector system may include a first AAV vector comprising an OCM promoter operably linked to a polynucleotide encoding an N-terminal portion of a stereocillin protein (e.g., the N-terminal portion of SEQ ID NO: 4) and a polynucleotide encoding an N-terminal intein (N-intein) 3' thereto, and a second AAV vector comprising an OCM promoter operably linked to a polynucleotide encoding a C-terminal intein (C-intein) and a polynucleotide encoding a C-terminal portion of a stereocillin protein 3' thereto. The aforementioned two-vector system may further comprise regulatory sequences such as, for example, enhancers, poly(a) sequences, and untranslated regions (UTRs, e.g., 5'UTR and 3'UTR).

[0217] A composition containing an AAV vector may be administered to a patient, for example, by local administration to the inner ear (e.g., by injection into the perilymph or via the round window membrane) to treat sensorineural hearing loss.

[0218] After administering the composition to the patient, a physician skilled in the art can monitor the expression of the therapeutic protein encoded by the transgene and the improvement of the patient in response to the treatment by various methods. For example, the physician can monitor the patient's hearing by performing standard tests such as hearing test, ABR, electrocochleography (ECOG), and otoacoustic emissions after administration of the composition. The finding that the patient shows improvement in hearing in one or more tests after administration of the composition compared to the hearing test results before administration of the composition indicates that the patient is responding well to the treatment. Subsequent doses can be determined and administered as necessary.

[0219] Other embodiments Various modifications and variations of the disclosure described herein will be apparent to those skilled in the art without departing from the scope and spirit of the disclosure. Although the disclosure has been described in connection with specific embodiments, it should be understood that the disclosure claimed should not be unnecessarily limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the disclosure that are apparent to those skilled in the art are intended to be within the scope of the disclosure. Other embodiments are within the scope of the claims.

Claims

1. A two-vector system comprising: a) a first nucleic acid vector comprising an oncomodulin (OCM) promoter having at least 85% sequence identity to a nucleic acid sequence of any one of SEQ ID NOs: 1-3, said OCM promoter being operably linked to a first polynucleotide encoding an N-terminal portion of a stereocillin protein; b) a second nucleic acid vector comprising a second polynucleotide encoding a C-terminal portion of the stereocillin protein.

2. The two-vector system of claim 1 , wherein the first polynucleotide partially overlaps with the second polynucleotide.

3. 2. The two-vector system of claim 1, wherein, when introduced into a mammalian cell, the first nucleic acid vector and the second nucleic acid vector undergo homologous recombination to form a recombinant polynucleotide encoding a full-length stereocillin protein.

4. 2. The two-vector system of claim 1 , wherein the first nucleic acid vector comprises a splice donor signal sequence located at the 3' end of the first polynucleotide and the second nucleic acid vector comprises a splice acceptor signal sequence located at the 5' end of the second polynucleotide.

5. 2. The two-vector system of claim 1 , wherein the first nucleic acid vector comprises a splice donor signal sequence located at the 3' end of the first polynucleotide and a first recombinogenic region located at the 3' end of the splice donor signal sequence, and the second nucleic acid vector comprises a second recombinogenic region, a splice acceptor signal sequence at the 3' end of the second recombinogenic region, and the second polynucleotide at the 3' end of the splice acceptor signal sequence.

6. The two-vector system of claim 1 , wherein the first and second polynucleotides do not overlap.

7. 6. The two-vector system of claim 5, wherein the first nucleic acid vector further comprises a degradation signal sequence located at the 3' end of the first recombinogenic region and the second nucleic acid vector further comprises a degradation signal sequence located between the second recombinogenic region and the splice acceptor signal sequence.

8. The two-vector system of claim 1, wherein the second nucleic acid vector further comprises an OCM promoter having at least 85% sequence identity to a nucleic acid sequence of any one of SEQ ID NOs: 1-3, the OCM promoter being operably linked to the second polynucleotide, and the OCM promoter being located at the 5' end of the second polynucleotide.

9. 2. The two-vector system of claim 1, wherein the first nucleic acid vector further comprises a polynucleotide encoding an N-terminal intein (N-intein) located at the 3' end of the first polynucleotide.

10. 10. The two-vector system of claim 9, wherein the second nucleic acid vector further comprises a polynucleotide encoding a C-terminal intein (C-intein) located between the OCM promoter and the second polynucleotide.

11. 11. The two-vector system of claim 10, wherein the N-intein and the C-intein are components of a split intein trans-splicing system.

12. The two-vector system of claim 11 , wherein the split intein trans-splicing system is derived from one or more bacterial DnaE genes.

13. 2. The two-vector system of claim 1 , wherein the OCM promoter has at least 85% sequence identity to the nucleic acid sequence of SEQ ID NO:

1.

14. The two-vector system of claim 1, wherein the stereocillin protein is a human stereocillin protein having at least 85% sequence identity to the nucleic acid sequence of SEQ ID NO: 4, and the human stereocillin protein is encoded by a polynucleotide having at least 85% sequence identity to the nucleic acid sequence of SEQ ID NO:

6.

15. 2. The two-vector system of claim 1, wherein the first and second nucleic acid vectors are adeno-associated virus (AAV) vectors, and the AAV vectors have an AAV1, AAV2, AAV2quad(Y-F), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, rhlO, rh39, rh43, rh74, Anc80, Anc80L65, DJ / 8, DJ / 9, 7m8, PHP.B, PHP.eb, or PHP.S capsid.

16. A human outer hair cell (OHC) comprising a two-vector system described in any one of claims 1 to 15.

17. A composition comprising a two-vector system described in any one of claims 1 to 15 for use in a method for expressing the stereocillin protein in human OHC.

18. A composition comprising a two-vector system described in any one of claims 1 to 15 for use in a method for treating a subject having or at risk of developing sensorineural hearing loss.

19. A composition comprising the two-vector system of any one of claims 1 to 15 for use in a method for increasing expression of STRC in a subject in need thereof.

20. The composition of claim 18 , wherein the subject has a mutation in STRC.

21. 20. The composition of claim 18, wherein the subject is identified as having a mutation in STRC.

22. 20. The composition of claim 18, wherein the two-vector system is administered locally to the ear.

Images