Anti-CLL1 single domain antibodies and uses thereof

The CLL1-VHH-16 single-domain antibody addresses the challenge of targeting CLL1 in AML by providing a specific and effective therapeutic and diagnostic tool for AML, MDS, and CML, with applications in drug delivery and detection.

JP2026500340APending Publication Date: 2026-01-06CARBIOGENE THERAPEUTICS CO LTD
View PDF 1 Cites 0 Cited by

Patent Information

Application Number
JP2025535067
Authority / Receiving Office
JP · JP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2022-12-16
Filing Date
2022-12-30
Publication Date
2026-01-06

AI Technical Summary

Technical Problem

Current treatments for acute myeloid leukemia (AML) are challenging due to the heterogeneity of the disease, and there is a need for targeted therapies that can specifically target the CLL1 antigen, which is uniquely expressed on AML cells.

Method used

Development of a single-domain antibody, CLL1-VHH-16, which specifically binds to the CLL1 protein, composed of a heavy chain variable region with defined complementarity-determining regions, and is expressed using recombinant vectors in host cells for targeted tumor therapy and diagnosis.

Benefits of technology

The CLL1-VHH-16 antibody demonstrates high affinity and specificity for CLL1-positive cells, enabling effective detection and targeted treatment of AML, MDS, and CML, with potential applications in drug delivery systems and diagnostic kits.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 2026500340000010
    Figure 2026500340000010
  • Figure 2026500340000011
    Figure 2026500340000011
  • Figure 2026500340000012
    Figure 2026500340000012
Patent Text Reader

Abstract

The present invention relates to an anti-CLL1 single-domain antibody and its use. Specifically, it relates to a single-domain antibody having the amino acid sequence of SEQ ID NO: 1. The single-domain antibody of the present invention has high affinity and can specifically target CLL1-positive cells, and can be used to detect CLL1 expression in bone marrow cells of AML patients. The single-domain antibody of the present invention can be used to produce specific antibody drugs clinically used for the prevention and treatment of CLL1-targeted diseases (such as acute myeloid leukemia, myelodysplastic syndrome, or chronic myeloid leukemia), as well as to produce CLL1-targeting CAR cells and CLL1 protein detection kits. The single-domain antibody drug of the present invention has a stable structure, small molecule, is easily recombinantly expressed, and is inexpensive to produce. It can be used alone or as a drug delivery system for delivering related drugs, and has very broad prospects and important significance in fields such as pharmaceutical applications and clinical diagnosis.
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] The present invention relates to the field of biopharmaceuticals, specifically to anti-CLL1 single domain antibodies and uses thereof. [Background technology]

[0002] Acute myeloid leukemia (AML) is a malignant disease of bone marrow hematopoietic stem / progenitor cells. For a long time, anthracycline and cytarabine chemotherapy has been used to treat mild cases, while hematopoietic stem cell transplantation has been used to treat intermediate- and high-risk patients. Due to the heterogeneity of AML, treatment of AML patients remains challenging. In recent years, researchers have discovered that immunotherapy targeting CLL1 is effective in treating AML. C-type lectin-like molecule 1 (CLL1), also known as C-type lectin domain family 12 member A (CLEC12A), is a type II transmembrane glycoprotein that plays an important role in immune regulation as an inhibitory receptor. CLL1 is present in peripheral blood, bone marrow myeloid cells, and most AML cells, and is expressed on the CD34 receptor of many AML patients. + CD38 - Normal CD34, but expressed on stem cells + CD38 - The unique expression pattern of CLL1 makes it a potential target for the treatment and diagnosis of AML, as it is not expressed in stem cells. Furthermore, CLL1 is also expressed in cells of myelodysplastic syndromes (MDS) and chronic myeloid leukemia (CML).

[0003] Antibodies (Abs) are effector immune molecules produced when B cells are specifically stimulated by B cell antigen epitopes to proliferate and differentiate into plasma cells. They are immunoglobulins (Ig) that specifically bind to antigens and are responsible for humoral immunity. Ig specifically recognizes and binds to corresponding antigen epitopes that have a complementary lock-and-lock relationship via the antigen-binding groove formed by its V-region CDR. Because of their ability to specifically bind to antigens, antibodies are important in disease diagnosis and immunoprophylaxis. Antibody drugs, which consist of antibody substances (including all antibody molecules and antibody fragments with therapeutic functions), are an important tool in targeted therapy and are currently one of the most promising and valuable fields of interest in the biopharmaceutical industry.

[0004] Heavy-chain antibodies (HcAbs) are a type of naturally occurring antibody unique to camelids and cartilaginous fish. Their antibody domains are composed of only two heavy chains, lacking light chains in nature. The antigen-recognition function of heavy-chain antibodies is primarily determined by the variable regions of the heavy chains (VHHs). Because only the VHHs can recognize antigens, they are also called single-domain antibodies (sdAbs). Single-domain antibodies lack the light chains and contain only the heavy-chain variable regions. Because of their small molecular weight, they are also called nanobodies (Nbs). With a molecular weight of only approximately 13–15 kDa, a diameter of approximately 2.5 nm, and a length of 4 nm, single-domain antibodies are the smallest antibody fragments yet capable of antigen-binding. Their antigen-binding ability and stability are comparable to or even higher than those of intact antibodies. Compared to conventional antibodies, single-domain antibodies have many unique properties, including excellent stability, targeting specific antigen epitopes, flexible component combinations, and low production costs. Traditional methods for obtaining single-domain antibodies involve multiple steps, including multiple immunizations of camelids, B lymphocyte isolation, VHH domain amplification, and display library construction and screening. With the development of synthetic biology, it has become possible to construct high-quality, randomized, and large-scale single-domain antibody libraries based on total synthesis. Currently, VHH single-domain antibodies are widely used in miniaturized antibody research, drug development, and disease diagnosis and treatment due to their stable structure, small molecular weight, good solubility, resistance to various adverse environments, good formulation stability, easy recombinant expression, and ease of humanization. The development of single-domain antibodies holds great promise and great significance in fields such as pharmaceutical applications and clinical diagnosis. Summary of the Invention

[0005] One object of the present invention is to provide single domain antibodies that target the CLL1 antigen and their use in targeted tumor therapy.

[0006] To achieve the above-mentioned objectives, the present invention provides a single-domain antibody (anti-CLL1 single-domain antibody) designated CLL1-VHH-16. This single-domain antibody is composed of a heavy chain variable region (VHH), which may comprise a complementarity-determining region (CDR1) having the amino acid sequence of positions 26 to 35 of SEQ ID NO: 1, a complementarity-determining region (CDR2) having the amino acid sequence of positions 50 to 59 of SEQ ID NO: 1, and a complementarity-determining region (CDR3) having the amino acid sequence of positions 99 to 118 of SEQ ID NO: 1.

[0007] The single domain antibody (anti-CLL1 single domain antibody) may be a single domain antibody that specifically binds to the CLL1 protein.

[0008] Furthermore, the amino acid sequence of the heavy chain variable region may be SEQ ID NO: 1, or an amino acid sequence having at least 80% identity to SEQ ID NO: 1 and having the same function.

[0009] Single domain antibodies (anti-CLL1 single domain antibodies) have only the variable region of a heavy chain antibody (VHH) and are composed of a framework region FR1, a complementarity determining region CDR1, a framework region FR2, a complementarity determining region CDR2, a framework region FR3, a complementarity determining region CDR3, and a framework region FR4, in that order.

[0010] The amino acid sequence of the single domain antibody CLL1-VHH-16 may be SEQ ID NO: 1. In SEQ ID NO: 1, positions 1 to 25 represent framework region FR1, positions 26 to 35 represent complementarity-determining region CDR1, positions 36 to 49 represent framework region FR2, positions 50 to 59 represent complementarity-determining region CDR2, positions 60 to 98 represent framework region FR3, positions 99 to 118 represent complementarity-determining region CDR3, and positions 119 to 129 represent framework region FR4. The nucleotide sequence of a nucleic acid molecule encoding the single domain antibody CLL1-VHH-16 (CLL1-VHH-16 gene) is shown in SEQ ID NO: 2.

[0011] The sequences of the complementarity determining regions are defined according to the Kabat numbering system.

[0012] Other variants of the single domain antibody sequences of the present invention with improved affinity and / or potency can be obtained using methods known in the art and are within the scope of the present invention. For example, antibodies with improved affinity can be obtained by amino acid substitution. Alternatively, codon optimization of the nucleotide sequence can improve the translation efficiency in an expression system for producing the antibody. Furthermore, polynucleotides containing sequences in which antibody specificity has been optimized by applying directed evolution techniques to any nucleic acid sequence of the present invention are also within the scope of the present invention.

[0013] In some embodiments, substitutions, insertions, or deletions may be made in one or more complementarity-determining regions or framework regions of the single domain antibodies of the present invention, as long as they do not substantially reduce the antigen-binding ability of the antibody. For example, conservative modifications (e.g., conservative substitutions; as is well known to those skilled in the art, conservative substitutions of amino acids do not alter the properties and function of a protein) may be made in the complementarity-determining regions and / or framework regions that do not substantially reduce binding affinity. For example, such modifications may be made outside of the antigen-contacting residues in the complementarity-determining regions.

[0014] The present invention further provides a biomaterial related to the single domain antibody CLL1-VHH-16, which may be any one of C1) to C4) below: C1) a nucleic acid molecule encoding the heavy chain variable region of the single domain antibody CLL1-VHH-16; C2) an expression cassette comprising the nucleic acid molecule according to C1); C3) A recombinant vector comprising the nucleic acid molecule according to C1), or a recombinant vector comprising the expression cassette according to C2). C4) A recombinant host cell comprising a nucleic acid molecule according to C1), or a recombinant host cell comprising an expression cassette according to C2), or a recombinant host cell comprising a recombinant vector according to C3).

[0015] wherein the recombinant host cell described in C4) is capable of expressing the single domain antibody CLL1-VHH-16.

[0016] In the biomaterial, the nucleic acid molecule may be any one of the following: D1) a DNA molecule whose nucleotide sequence or coding sequence is SEQ ID NO: 2; D2) A DNA molecule that has 75% or more identity with the nucleotide sequence defined in D1) and has the same function.

[0017] The DNA molecule shown in SEQ ID NO:2 encodes the single domain antibody CLL1-VHH-16 having the amino acid sequence of SEQ ID NO:1.

[0018] The aforementioned 75% or more identity may be 80%, 85%, 90% or 95% or more identity.

[0019] The aforementioned 80% or greater identity may be at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity. The 85% or greater identity may be at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity. The 90% or greater identity may be at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity. 95% or greater identity may be at least 95%, 96%, 97%, 98% or 99% identity.

[0020] As used herein, "identity" refers to the identity of an amino acid sequence or a nucleotide sequence. Amino acid sequence identity can be measured using an online homology search site, such as the BLAST page on the NCBI homepage. For example, in the advanced BLAST 2.1, the program blastp is used, the Expect value is set to 10, all filters are set to OFF, BLOSUM62 is used as the matrix, and the gap existence cost, per residue gap cost, and lambda ratio are set to 11, 1, and 0.85 (default values), respectively. The percent identity can be calculated by searching for amino acid sequence identity.

[0021] As used herein, a vector refers to a vector capable of introducing, amplifying, and expressing foreign DNA or a target gene in a host cell. The vector may be a cloning vector or an expression vector, including, but not limited to, a plasmid, a phage (e.g., λ phage or M13 filamentous phage), a cosmid, an artificial chromosome (e.g., yeast artificial chromosome (YAC), bacterial artificial chromosome (BAC), P1 artificial chromosome (PAC), Ti plasmid artificial chromosome (TAC)), or a viral vector (e.g., baculovirus vector, retrovirus (including lentivirus), adenovirus, adeno-associated virus, or herpes virus (e.g., herpes simplex virus)). In one or more embodiments of the present invention, the vector is a pComb3XSS plasmid and / or a pcDNA3.1 vector.

[0022] As used herein, a host cell (also referred to as a recipient cell) refers to any type of cell that can be used to introduce a vector. Host cells can be eukaryotic (e.g., plant cells, animal cells, fungi, algae) or prokaryotic (e.g., bacteria, protozoa). Host cells include not only the particular recipient cell but also its progeny. While progeny may not necessarily be completely identical to the original parent cell due to natural, accidental, or deliberate mutations and / or modifications, they are still considered to be within the scope of host cells. Suitable host cells are known in the art. Here, plant cells can be, but are not limited to, plant cells from Arabidopsis thaliana, tobacco (Nicotiana tabacum), corn (Zea mays), rice (Oryza sativa), wheat (Triticum aestivum), and the like. The animal cells may be, but are not limited to, mammalian cells (e.g., Chinese hamster ovary cells (CHO cells), African green monkey kidney cells (Vero cells), baby hamster kidney cells (BHK cells), mouse mammary carcinoma cells (C127 cells), human embryonic kidney cells (HEK293 cells), human HeLa cells, fibroblasts, bone marrow cell lines, T cells, or NK cells), avian cells (e.g., chicken or duck cells), amphibian cells (e.g., African clawed frog (Xenopus laevis) cells or Japanese giant salamander (Andrias davidianus) cells), fish cells (e.g., grass carp, common carp, rainbow trout, or catfish cells), insect cells (e.g., Sf21 cells or Sf-9 cells), etc. The fungus may be a yeast, including, but not limited to, Saccharomyces (e.g., Saccharomyces cerevisiae), Kluyveromyces (e.g., Kluyveromyces lactis), Pichia (e.g., Pichia pastoris), Schizosaccharomyces (e.g., Schizosaccharomyces pombe), and Hansenula (e.g., Hansenula polymorpha).Examples of fungi include, but are not limited to, Fusarium sp., Rhizoctonia sp., Verticillium sp., Penicillium sp., Aspergillus sp., and Cephalosporium sp. Examples of algae include, but are not limited to, Fucus sp., Achnanthes sp., Amphiprora sp., Amphora sp., Ankistrodesmus sp., Asteromonas sp., and Boekelovia sp. Bacteria include, but are not limited to, Escherichia sp., Erwinia sp., Agrobacterium sp., Flavobacterium sp., Alcaligenes sp., Pseudomonas sp., and Bacillus sp. For example, the bacterium may be Escherichia coli, Bacillus subtilis, or Bacillus pumilus. In one or more embodiments of the present invention, the host cell is E. coli TG1 and / or HEK293 cells.

[0023] As used herein, a recombinant vector refers to a recombinant DNA molecule constructed in vitro by ligating an exogenous target gene to a vector, and can be constructed by any suitable method, so long as the constructed recombinant vector delivers the exogenous target gene to a recipient cell and confers on the exogenous target gene the ability to replicate, integrate, amplify, and / or express in the recipient cell. In one or more embodiments of the present invention, the recombinant vector is pcDNA3.1-CLL1-VHH-16-hFc.

[0024] To facilitate purification, the recombinant vector pcDNA3.1-CLL1-VHH-16-hFc is prepared by adding the human IgG1Fc gene (hFc gene, nucleotide sequence SEQ ID NO: 3) to the 3' end of the gene encoding the single-domain antibody CLL1-VHH-16 (SEQ ID NO: 2) to obtain the CLL1-VHH-16-hFc fusion gene, followed by adding a BamHI cleavage site before the start codon at the 5' end of the fusion gene and an EcoRI cleavage site after the stop codon at the 3' end. The fusion gene is then cloned between the BamHI and EcoRI recognition sites of the eukaryotic expression vector pcDNA3.1 to obtain the recombinant eukaryotic expression vector pcDNA3.1-CLL1-VHH-16-hFc, which expresses the single-domain antibody CLL1-VHH-16 fused to the hFc gene at its C-terminus. The recombinant eukaryotic expression vector pcDNA3.1-CLL1-VHH-16-hFc contains the gene encoding the single domain antibody CLL1-VHH-16 shown in SEQ ID NO:2.

[0025] The nucleotide sequence (696 bp) of the human IgG1Fc gene is shown in SEQ ID NO:3, and the amino acid sequence encoded by the human IgG1Fc gene is shown in SEQ ID NO:4.

[0026] As used herein, a recombinant host cell refers to a recombinant host cell whose function has been altered by genetic manipulation or modification of a target host cell. Examples include recombinant host cells obtained by introducing an exogenous target gene or recombinant vector into a target host cell, or recombinant host cells obtained by directly editing an endogenous gene in a target host cell. Recombinant host cells encompass not only the specific recombinant host cell but also its progeny. While progeny may not necessarily be completely identical to the original parent cell due to natural, accidental, or intentional mutations and / or modifications, they are still considered to be within the scope of recombinant host cells. In one or more embodiments of the present invention, the recombinant host cell is a recombinant host cell obtained by introducing the recombinant vector pcDNA3.1-CLL1-VHH-16-hFc into HEK293 cells.

[0027] The present invention further provides a pharmaceutical composition, which may comprise the single domain antibody CLL1-VHH-16.

[0028] Additionally, the pharmaceutical composition may further comprise a pharmaceutically acceptable carrier.

[0029] The pharmaceutically acceptable carrier may be a diluent, excipient, filler, binder, wetting agent, disintegrant, absorption enhancer, adsorption carrier, surfactant, or lubricant.

[0030] The pharmaceutical composition has at least one of the following uses: M1) Use in the prevention or treatment of tumors, M2) Use in the prevention or treatment of CLL1 target-related diseases; M3) Use in drug-mediated specific recognition of tumors expressing the CLL1 antigen.

[0031] The present invention further provides a reagent or kit, which may comprise the single domain antibody CLL1-VHH-16 and have at least one of the following uses: F1) Use in detecting CLL1 protein; F2) Use in screening, diagnosing or aiding in diagnosis of CLL1 target-related diseases; F3) Use in in vivo imaging of CLL1 protein.

[0032] The kit may be, but is not limited to, a chemiluminescent immunoassay kit, an enzyme-linked immunoassay kit, a colloidal gold immunoassay kit, or a fluorescent immunoassay kit.

[0033] The present invention further provides any one of the following uses of the single domain antibody CLL1-VHH-16 and / or a biological material: E1) Use in the manufacture of a pharmaceutical for the prevention or treatment of tumors, or use in the prevention or treatment of tumors; E2) Use in the manufacture of a medicament for the prevention or treatment of a CLL1 target-related disease, or use in the prevention or treatment of a CLL1 target-related disease; E3) Use in the manufacture of a product for screening, diagnosing or aiding in diagnosis of a CLL1 target-related disease, or use in screening, diagnosing or aiding in diagnosis of a CLL1 target-related disease; E4) Use in the detection of CLL1 protein or in the manufacture of a product for the detection of CLL1 protein; E5) Use in the manufacture of a product for binding to CLL1 protein; E6) Use in the drug-mediated specific recognition of tumors expressing the CLL1 antigen or in the manufacture of a product for the drug-mediated specific recognition of tumors expressing the CLL1 antigen; E7) Use in in vivo imaging of CLL1 protein or in the manufacture of a product for in vivo imaging of CLL1 protein; E8) Use in the production of CAR cells targeting CLL1.

[0034] As used herein, a CLL1 target-associated disease may be a CLL1-positive cancer (such as leukemia).

[0035] As used herein, CLL1-positive cancers may be, but are not limited to, acute myeloid leukemia (AML), myelodysplastic syndromes (MDS), and chronic myeloid leukemia (CML).

[0036] E6) The product for drug-mediated specific recognition of tumors expressing the CLL1 antigen may be a drug delivery system that specifically targets the CLL1 protein, which drug delivery system comprises the single domain antibody CLL1-VHH-16.

[0037] The drug delivery system can be a liposomal drug delivery system, a polymeric micelle drug delivery system, a polymeric disc drug delivery system, or a nanoparticle drug delivery system.

[0038] The drug delivery system can be used for targeted delivery and / or site-specific release of drugs.

[0039] The CAR cells targeting CLL1 in E8) express a chimeric antigen receptor (CAR), which may comprise the single domain antibody CLL1-VHH-16.

[0040] Furthermore, the antigen recognition domain of the chimeric antigen receptor may be the single domain antibody CLL1-VHH-16.

[0041] Furthermore, CAR cells include, but are not limited to, CAR-T cells, CAR-NK cells, CAR-macrophages (CAR-M cells), CAR-iPSCs, or CAR-PSCs.

[0042] The detection of CLL1 protein described herein may be detecting whether or not a test sample contains CLL1 protein and / or detecting the content of CLL1 protein in a test sample.

[0043] The test sample may be a cell or tissue sample.

[0044] Products for detecting the aforementioned CLL1 protein include products that detect antigen-antibody binding using enzyme immunoassay, immunofluorescence assay, radioimmunoassay, luminescence immunoassay, colloidal gold immunochromatography, agglutination assay, or immunoturbidimetry, etc.

[0045] The articles of manufacture described herein may be reagents, reagent test kits, chips, or test strips.

[0046] The present invention further provides a method for producing the single domain antibody CLL1-VHH-16, which includes constructing a recombinant expression vector containing a nucleic acid molecule encoding the heavy chain variable region of the single domain antibody CLL1-VHH-16, introducing the recombinant expression vector into host cells to obtain recombinant cells expressing the single domain antibody, culturing the recombinant cells, and isolating and purifying the single domain antibody.

[0047] Furthermore, the nucleic acid molecule encoding the heavy chain variable region of the single domain antibody CLL1-VHH-16 may be any one of the following: D1) a DNA molecule whose nucleotide sequence or coding sequence is SEQ ID NO: 2; D2) A DNA molecule that has 75% or more identity with the nucleotide sequence defined in D1) and has the same function.

[0048] Additionally, the host cell may be a HEK293 cell.

[0049] Furthermore, the introduction may be by transforming a vector containing the single domain antibody gene of the present invention into a host cell using any known transfection method, such as calcium phosphate co-precipitation, liposome-mediated transfection, electroporation, or viral vector methods.

[0050] The present invention further provides a method for diagnosing or aiding in the diagnosis of a CLL1 target-related disease, which method includes isolating a sample from a subject, detecting the content of CLL1 protein in the sample using the single domain antibody CLL1-VHH-16, and diagnosing or aiding in the diagnosis of a CLL1 target-related disease based on the content of CLL1 protein (compared to the content of CLL1 protein in a disease diagnostic criterion).

[0051] The present invention further provides a method for screening for CLL1 target-related diseases, which method includes separating a sample from a subject, detecting the content of CLL1 protein in the sample using the single domain antibody CLL1-VHH-16, and screening for CLL1 target-related diseases based on the content of CLL1 protein (compared to the content of CLL1 protein in disease diagnostic criteria).

[0052] The present invention further provides a method for preventing or treating a CLL1 target-associated disease, which method may comprise administering the single domain antibody CLL1-VHH-16 or a pharmaceutical composition described herein to a subject suffering from a CLL1 target-associated disease.

[0053] In the above method, the CLL1 target-associated disease may be a CLL1 target-associated tumor.

[0054] In the above method, the CLL1 target-associated tumor can be a CLL1-positive cancer.

[0055] In the above methods, the CLL1-positive cancer can be acute myeloid leukemia, myelodysplastic syndrome, or chronic myeloid leukemia.

[0056] The present invention further provides a method for detecting CLL1 protein in vitro, which may comprise detecting CLL1 protein using the single domain antibody CLL1-VHH-16 or a kit described herein.

[0057] The present invention further provides an antibody-drug conjugate comprising an antibody portion and a binding portion. The antibody portion can comprise the single domain antibody CLL1-VHH-16.

[0058] Additionally, the binding moiety may comprise a detectable label, a chemical agent, or a cytotoxin.

[0059] The antibody moiety and the binding moiety may be covalently bonded directly or via a linker.

[0060] The detectable label may be selected from an enzyme (e.g., horseradish peroxidase or alkaline phosphatase), a chemiluminescent agent (e.g., an acridinium ester compound, luminol and its derivatives, or a ruthenium derivative), a fluorescent dye (e.g., fluorescein or a fluorescent protein), a radionuclide, or biotin.

[0061] The chemical drug may be a drug capable of killing tumor cells.

[0062] The cytotoxin may be a tubulin inhibitor (such as maytansine or auristatin), a DNA synthesis inhibitor (such as calicheamicin), or an RNA synthesis inhibitor (such as amatoxin).

[0063] The purpose of the uses and methods of the present invention may be for the purpose of disease diagnosis, prognosis, and / or treatment, or may be for non-disease diagnosis, prognosis, and treatment, and the direct purpose may be to obtain information on intermediate results of disease diagnosis, prognosis, and / or treatment, or may be for the purpose of non-disease diagnosis, prognosis, and / or treatment.

[0064] CLL1, as described herein, is C-type lectin-like molecule 1 (CLL1), also known as C-type lectin domain family 12 member A (CLEC12A), a type II transmembrane glycoprotein that plays an important role in immunoregulation as an inhibitory receptor. CLL1 is present in peripheral blood, bone marrow myeloid cells, and most acute myeloid leukemia (AML) cells, and is expressed on the CD34 receptor of many AML cells. + CD38 - Normal CD34, but expressed on stem cells + CD38 -The unique expression pattern of CLL1 makes it a potential target for the treatment and diagnosis of AML, as it is not expressed in stem cells. Furthermore, CLL1 is also expressed in cells of myelodysplastic syndromes (MDS) and chronic myeloid leukemia (CML).

[0065] In the present invention, we immunized alpacas with CLL1 recombinant protein to obtain single-domain antibody genes and constructed a single-domain antibody expression library. Then, using phage display screening technology, we screened for a high-affinity anti-CLL1 single-domain antibody (CLL1-VHH-16) from the single-domain antibody expression library. After determining the antibody gene sequence, we constructed CLL1-VHH-16 using genetic engineering techniques. The resulting antibody was further subjected to functional experiments, such as affinity and specificity testing. The results demonstrate that the single-domain antibody of the present invention has high affinity and can specifically target CLL1-positive cells (cells expressing CLL1 protein) and can be successfully used to detect CLL1 expression in bone marrow cells of AML patients. The single-domain antibody of the present invention can be expressed and produced in prokaryotic cells, yeast cells, eukaryotic cells, and any recombinant system, and can be used to produce specific antibody drugs for clinical use in the prevention and treatment of CLL1-targeted diseases (such as acute myeloid leukemia, myelodysplastic syndrome, or chronic myeloid leukemia), or CLL1 protein detection kits. The single domain antibody drug of the present invention has a stable structure, a small molecule, is easy to recombinantly express, has low production costs, and can be used alone or as a drug delivery system to deliver related drugs, and has very broad prospects and important significance in fields such as pharmaceutical applications and clinical diagnosis. [Brief explanation of the drawings]

[0066] [Figure 1] This shows the results of agarose gel electrophoresis of total RNA extracted from alpaca PBMCs. [Figure 2]1 shows the results of agarose gel electrophoresis of colony PCR of a bacterial library. [Figure 3] FITC-labeled CLL1-VHH-16 antibody was used to detect CLL1 expression on various tumor cell lines, where Isotype represents the non-FITC-labeled CLL1-VHH-16-hFc antibody, and CLL1 represents the FITC-CLL1-VHH-16-hFc antibody. [Figure 4] 4 shows the results of detecting CLL1 expression on bone marrow cells of an AML patient using an FITC-labeled CLL1-VHH-16 antibody. In Figure 4, CLL1VHH-FITC represents the FITC-labeled CLL1-VHH-16 antibody (i.e., the FITC-CLL1-VHH-16-hFc antibody in Example 2), and CLL1-APC represents Biolegend's APC-labeled anti-human CLL1-specific antibody (catalog number 143405). DETAILED DESCRIPTION OF THE INVENTION

[0067] The present invention will be described in detail below with reference to specific embodiments, but the examples shown are for the purpose of illustrating the present invention and do not limit the scope of the present invention. The examples provided below can be used as a guide for those skilled in the art to make further improvements, but do not limit the present invention in any way.

[0068] Unless otherwise specified, the experimental methods in the following examples are all conventional methods and are carried out according to the techniques or conditions described in the literature in the field or according to the product instructions. Unless otherwise specified, the materials and reagents used in the following examples are all commercially available.

[0069] The pComb3XSS plasmid used in the following examples is a product of Beijing Zhuangmeng International Biogene Technology Co., Ltd. (catalog number ZK129).

[0070] The helper phage M13K07 in the following examples is a product of Chengdu Renyu Biotechnology Co., Ltd. (catalog number A001-1).

[0071] In the following examples, K562 cells (CLL1-negative cells) are products of Nanjing Kebai Biotechnology Co., Ltd. (catalog number CBP60529), MM1.S cells (CLL1-negative cells) are products of Beijing Baiou Bowei Biotechnology Co., Ltd. (catalog number bio-129535), and U937 cells (CLL1-positive cells) are products of Beijing Baiou Bowei Biotechnology Co., Ltd. (catalog number bio-73180).

[0072] The bone marrow cells of AML patients in the examples below are from Zhejiang Provincial People's Hospital.

[0073] In the example below, the method for producing CLL1-positive cells K562-CLL1 involves inserting CLL1 between the BamHI and EcoRI sites of pcDNA3.1, and then transfecting K562 cells with the recombinant vector to obtain CLL1-positive cells K562-CLL1.

[0074] The vector pcDNA3.1 used in the following examples is a product of Changsha Abiwei Biotechnology Co., Ltd. (catalog number HG-VPI0001).

[0075] Example 1: Production of anti-CLL1 single domain antibodies In this example, alpacas were immunized with CLL1 recombinant protein to obtain single-domain antibody genes, and a single-domain antibody expression library was constructed. High-affinity anti-CLL1 single-domain antibodies were then screened from the single-domain antibody expression library using phage display screening technology.

[0076] 1. Animal Immunization 1.1 Antigen acquisition The antigen, CLL1 recombinant protein, is as follows: CLL1 immunogen: CLL1-hIgG1Fc (B918601) protein is a product of Shanghai Baiying Biotechnology Co., Ltd. CLL1 screening antigen: CLL1-6xHis (B918602) protein is a product of Shanghai Baiying Biotechnology Co., Ltd.

[0077] 1.2 Alpaca immunity Alpacas (2-3 years old, weighing approximately 50 kg) were immunized four times with the CLL1 immunizing antigen CLL1-hIgG1Fc. 0.5 mg of CLL1-hIgG1Fc was injected subcutaneously every two weeks. Five ml of blood was collected before the next immunization, and the plasma was separated to measure the antibody titer after the previous immunization. The antibody titer after the fourth immunization was measured one week after the injection.

[0078] The antibody titer in serum was measured by indirect ELISA, and the procedure was as follows. (1) The immunizing antigen CLL1-hIgG1Fc was diluted with PBS to 2 μg / ml, coated onto an ELISA plate at 100 μL / well, and left overnight at 4° C. The control group was coated with 3% BSA. (2) The antigen solution was discarded, and the ELISA plate was washed three times with 200 μL of PBST solution (1×PBS solution containing 0.05% Tween 20) for 5 minutes each. (3) The ELISA plate was blocked with 200 μL of a blocking solution, PBSTB (PBST containing 2% BSA), at room temperature for 1.5 hours. (4) The blocking solution was discarded, and the ELISA plate was washed three times with 200 μL of PBST solution for 5 minutes each. (5) Using the blocking solution, the test serum was serially diluted to 1:10, 1:100, 1:1000, 1:10000, 1:100000, 1:1000000, and 1:10000000, and added to the ELISA plate at 100 μL / well and incubated at room temperature for 2 hours. (6) The serum was discarded, and the ELISA plate was washed four times with 200 μL of PBST solution for 5 minutes each. (7) 100 μL of goat anti-llama antibody (Goat Anti-Llama IgG H&L (HRP), Abcam, ab112786) diluted 1:10,000 in blocking solution was added to each well, and the plate was incubated at room temperature for 1 hour. (8) The detection antibody was discarded, and the ELISA plate was washed four times with 200 μL of PBST solution for 5 minutes each. (9) 100 μL of TMB substrate solution was added to each well, and color development was allowed to occur for 2 to 3 minutes. (10) 100 μL of reaction stop solution was added to each well. (11) The absorbance at 450 nm was measured within 30 minutes using a microplate reader. Criteria for determining positive wells: OD of immune serum sample. 450 The measured OD of non-immune serum 450 Greater than the measured value and the measured value is greater than 0.5.

[0079] 1.3 Immunization results The serum titer measurement results are shown in Table 1, with positive wells indicated in bold. After four immunizations, the serum titer of the alpaca was 10 5 , meaning the antibody level is 10 5 reached. As shown in Table 1, after the fourth immunization, the antibody levels of the alpacas were 10 5 The Ag coating was the immunogen CLL1-hIgG1Fc coating, and PBSTB was the blocking solution.

[0080] 2. Phage library construction After successful immunization, peripheral blood mononuclear cells (PBMCs) from the alpacas were collected to construct a phage library (anti-CLL1 VHH phage antibody library).

[0081] 2.1 RNA extraction and reverse transcription Alpaca peripheral blood mononuclear cells (PBMCs) were isolated by density gradient centrifugation and stored in Trizol. Total RNA was extracted from the PBMCs, and the resulting total RNA was reverse transcribed into cDNA using the Takara reverse transcription kit. The specific procedure is as follows: (1) Alpaca PBMC cells preserved in Trizol were transferred to a 1.5 mL centrifuge tube, and 1 / 5 volume of chloroform was added and mixed well, followed by standing at room temperature for 5 minutes. (2) Centrifuged at 12,000 g for 15 minutes at 4°C. (3) The supernatant was transferred to a new centrifuge tube, an equal volume of isopropanol was added, and the mixture was allowed to stand at room temperature for 10 minutes. (4) Centrifuged at 12,000 g for 10 minutes at 4°C. (5) The precipitate was washed with 1 mL of 75% ethanol, centrifuged at 7500 g for 5 minutes to remove the ethanol, and dried. (6) The precipitate was dissolved in an appropriate amount of RNase-free water to obtain extracted total RNA, which was 181.2 μg (Figure 1). (7) Reverse transcription of total RNA using Takara reverse transcription kit: The total RNA sample was divided into two aliquots. One aliquot was primer-primed with the Oligo dT Primer provided with the kit, and the other aliquot was primer-primed with the Random 6-mers provided with the kit. The total RNA was reverse transcribed into cDNA according to the operating procedure described in the kit manual, yielding a total of 31.7 μg of cDNA.

[0082] 2.2 PCR of VHH target fragments of CLL1 antibodies Using 8 ng cDNA as a template, the VHH target fragments were amplified by conventional PCR, yielding a total of 83 μg.

[0083] 2.3 Enzymatic Digestion and Ligation 1. Using pComb3XSS as the phage plasmid vector, the pComb3XSS vector and the VHH PCR product (VHH target fragment) were digested with the restriction enzymes SpeI and SacI, respectively, and incubated at 37°C for 4 hours. 2. The pComb3XSS vector and VHH PCR products after enzymatic digestion were purified using a DNA recovery and purification kit and stored at 4°C. 3. The pComb3XSS vector after double enzyme digestion and the VHH target fragment were ligated and recovered, yielding a total of 3.1 μg of ligation product.

[0084] 2.4 Construction of bacterial libraries (1) 100 ng of the ligation product was electroporated into 50 μL of TG1 competent cells. (2) After recovery at 37°C for 1 hour, 100 μL of the transformed product was serially diluted 10 times and applied to a plate, followed by overnight incubation at 37°C. (3) Based on the dilution factor and the number of single colonies, the number of all transformed colonies obtained by electroporation was calculated. The volume of the bacterial library was 2.6 × 10 8 cfu. (4) Several single clones were randomly selected from the serial dilution plate and subjected to colony PCR. The results of agarose gel electrophoresis (Figure 2) showed that all the selected single clones were positive clones, with a positive rate of 100%. (5) All remaining bacterial suspensions (i.e., serial dilutions of the transformation product) were collected and uniformly spread onto 20 15 cm culture plates (containing 2xYT medium, 100 μg / mL Amp, and 2% agarose), and cultured overnight at 37°C with end-over-end mixing. (6) The colonies cultured overnight were scraped off the plate using 2xYT liquid medium, transferred to a 50 mL centrifuge tube, and the OD 600 The DNA was measured at 120°C, and glycerol was added to a final concentration of 20%. The DNA was then stored at -80°C to obtain a bacterial library. (7) The sequences of the above single clone-positive colonies were translated into protein sequences, and comparison of sequence diversity showed that they were all independent sequences with good diversity, indicating that the diversity of the bacterial library met the requirements.

[0085] 2.5 Phage library construction (1) The bacterial library was inoculated into 100 mL of 2xYT liquid medium (containing 100 μg / mL of Amp) and incubated at 37°C and 250 rpm until the OD 600 The culture was continued until the pH reached 0.5 to 0.55. (2) Helper phage M13K07 was added at a ratio of bacteria number:phage number = 1:20, and the mixture was incubated at 37°C, 250 rpm for 30 minutes. (3) Kan was added to a final concentration of 50 μg / mL, and the mixture was cultured overnight at 30°C and 250 rpm. (4) The overnight cultured bacterial solution was centrifuged at 4°C and 4000 rpm for 20 minutes, and the supernatant was transferred to a new 50 mL centrifuge tube. (5) One-quarter of the volume of 20% PEG / 2.5M NaCl solution pre-cooled to 4°C was added, mixed well, and incubated on ice for at least 30 minutes. (6) The mixture was centrifuged at 4°C and 4000 rpm for 20 minutes, the supernatant was discarded, and the mixture was mixed by inversion for 2 minutes. (7) 1 mL of PBS was added to resuspend the sample, and the mixture was centrifuged at 12,000 rpm at 4°C for 10 minutes. (8) The supernatant was transferred to a new centrifuge tube, and 1 / 4 volume of 20% PEG / 2.5M NaCl solution pre-cooled to 4°C was added, mixed well to obtain a white suspension, and incubated on ice for at least 10 minutes. (9) The cells were centrifuged at 12,000 rpm at 4°C for 10 minutes, the supernatant was discarded, and the cells were resuspended in 1 mL of PBS and centrifuged at 12,000 rpm for 10 minutes. The supernatant was transferred to a new centrifuge tube and stored at -80°C. 13 A purified phage library with a titer of pfu / mL was obtained.

[0086] 3. Affinity Screening Using the screening antigen (CLL1-6xHis), the phage library was subjected to three rounds of affinity screening, including titer determination, amplification of phage eluates, and phage purification.

[0087] 3.1 First round of screening 3.1.1 First round screening method (1) The screening antigen (CLL1-6xHis) was coated onto immunotubes (50 μg / tube, 2 mL / tube of PBS as coating solution) and slowly rotated overnight at 4°C. As a control, BSA (50 μg / tube, 2 mL / tube of PBS as coating solution) was also coated onto immunotubes. (2) The liquid in the overnight-coated immunotube was discarded, and 2 mL of PBS buffer was added and washed three times at room temperature, with rotation for 5 minutes each time. (3) 2 mL of 3% non-fat dry milk was added, and the mixture was blocked by rotating at room temperature for 2 hours. (4) Discard the liquid in the blocked immunotube, add 2 mL of PBST buffer and wash three times at room temperature, rotating each time for 5 minutes. (5) The washing solution in the immunotube was discarded, and the phage library was added as an input phage library for the first round of screening according to the following formula. PBS buffer was added to make the total volume 2 mL, and the mixture was incubated with rotation at room temperature for 1 hour. TIFF2026500340000002.tif12170In the formula, V is the volume of phage added (unit: μL), T library is the phage titer. (6) Discard the liquid in the immunotube, add 2 mL of PBST (1x PBS plus 0.1% Tween 20; the same applies below) buffer, and wash the immunotube 20 times at room temperature, rotating each time for 5 minutes. (7) Discard the liquid in the immunotube, add 1 mL of 0.25 mg / mL trypsin solution, and rotate at room temperature for 30 minutes to elute. (8) 10 μL of 10% AEBSF (serine protease inhibitor) was added to stop the elution, and the solution in the immunotube was transferred to a new 1.5 mL centrifuge tube. The phage eluate from the first round of screening (abbreviated as "first round phage eluate") was obtained.

[0088] 3.1.2 Determination of initial phage titer (1) A single colony of the TG1 strain stored at -80°C was streaked onto 2xYT solid medium and cultured overnight at 37°C. (2) One single colony was picked from the single colony plate, transferred to 5 mL of 2xYT medium, and cultured overnight at 37°C. (3) Transfer 50 μL of the bacterial suspension to 5 mL of 2xYT liquid medium and measure the OD at 37°C and 250 rpm. 600 The culture was continued until the pH reached 0.5 to 0.55, and a TG1 bacterial solution was obtained. (4) 10 μL of the first-round phage eluate was serially diluted 10-fold in a 1.5 mL centrifuge tube. That is, 10 μL of the first-round phage eluate was added to 90 μL of PBS, and 10 μL of the resulting solution was added to 90 μL of PBS. This process was repeated to obtain 10 -12 The solution was diluted 12 times to obtain (5) 90 μL of TG1 bacterial solution was added to each dilution centrifuge tube, and the mixture was shaken and incubated at 37°C for 30 minutes. (6) 5 μL of the bacterial solution was taken from each dilution centrifuge tube and added dropwise to 2×YT solid medium (Amp). After leaving it to stand for several minutes, it was mixed by inversion at 37°C overnight. (7) The number of clearly distinguishable single colonies on the plate at different dilutions was counted, and the number of phage particles per ml of phage solution, i.e., the titer of the phage library, was calculated according to the following formula: TIFF2026500340000003.tif7170In the formula, T is the phage titer (unit: pfu / mL), D is the dilution factor, and N is the number of single colonies on the plate at the corresponding dilution factor.

[0089] 3.1.3 Amplification of first-round phage eluate (1) A single colony of the TG1 strain stored at -80°C was streaked onto 2xYT solid medium and cultured overnight at 37°C. (2) One single colony was picked from the single colony plate, transferred to 5 mL of 2xYT medium, and cultured overnight at 37°C. (3) Transfer 50 μL of the bacterial suspension to 5 mL of 2xYT liquid medium and measure the OD at 37°C and 250 rpm. 600 The culture was continued until the β-glucan concentration reached 0.5 to 0.55. (4) 500 μL of the first-round phage eluate was added, and the mixture was cultured at 37° C. and 250 rpm for 30 minutes. (5) All the bacterial solutions were evenly spread onto three 15 cm circular culture plates containing 100 μg / mL Amp and cultured overnight at 37°C. (6) 2xYT liquid medium was added to the surface of the culture plate, the colonies were gently scraped off with a cone rod, and the bacterial solution was collected in a 15 mL centrifuge tube to obtain the amplified bacterial sub-library. Glycerol was added to a final concentration of 20%, and the OD of the bacterial solution was measured using a spectrophotometer. 600 Measure the OD value of the eluate bacterial library 600 got the value. (7) Transfer the eluate bacterial library to 100 mL of 2xYT liquid medium (containing 100 μg / mL Amp) according to the following formula, and measure the initial OD 600 =0.1. TIFF2026500340000004.tif13170In the formula, V is the volume of the transferred bacterial solution (unit: μL), OD 600 is the OD of the constructed eluate bacterial library 600 is. (8) OD of bacterial solution 600 The mixture was cultured at 37°C and 250 rpm until the β-kappa bilayer thickness reached 0.5 to 0.55. (9) Helper phage M13K07 was added at a bacterial number:phage number = 1:20 according to the following formula. TIFF2026500340000005.tif13170In the formula, V is the volume of helper phage added (unit: mL), T helper-phage is the titer of the helper phage, OD 600 is the OD of the bacterial solution 600 value. (10) The incubation was continued at 37°C and 250 rpm for 30 minutes. (11) Kan was added to a final concentration of 50 μg / mL, and the mixture was cultured overnight at 30°C and 200 rpm.

[0090] 3.1.4 Purification of first-round phages (1) The overnight cultured bacterial solution was transferred to a new 50 mL centrifuge tube and centrifuged at 4°C and 4000 rpm for 20 minutes. (2) The supernatant was transferred to a new 50 mL centrifuge tube, and 1 / 4 volume of 20% PEG / 2.5 M NaCl solution pre-cooled to 4°C was added, mixed well, and left on ice for at least 30 minutes. (3) The mixture was centrifuged at 4°C and 4000 rpm for 20 minutes, and the supernatant was discarded. (4) 1 mL of PBS was added to resuspend and precipitate the precipitate, which was then transferred to a new 1.5 mL centrifuge tube and centrifuged at 4°C and 13,000 rpm for 15 minutes. (5) The supernatant was transferred to a new 1.5 mL centrifuge tube, and 1 / 4 of the volume of 20% PEG / 2.5 M NaCl solution pre-cooled to 4°C was added, mixed well, and left on ice for at least 10 minutes. (6) Centrifuge at 13,000 rpm at 4°C for 10 minutes, discard the supernatant, and add 1 mL of PBS to resuspend and precipitate the mixture. (7) Centrifuge at 13,000 rpm for 2 minutes at 4°C, and transfer the supernatant to a new 1.5 mL centrifuge tube to obtain the phage sublibrary for the first round of screening. Store at -80°C for long-term storage or at -20°C for short-term storage (1-2 weeks).

[0091] 3.1.5 Titering the Phage Sublibrary from the First Round of Screening The method was the same as for measuring the initial titer of phage in step 3.1.2.

[0092] 3.2 Second round of screening 3.2.1 Second-round screening method The screening method was the same as that of the first round of screening in step 3.1.1. The phage sublibrary obtained by amplification and purification in the first round of screening (the phage sublibrary of the first round of screening) was used as the input phage library for the second round of screening, and the phage eluate for the second round of screening was obtained.

[0093] 3.2.2 Titering of second-round phage eluate The measurement method was the same as that for measuring the initial phage titer in step 3.1.2.

[0094] 3.2.3 Amplification and purification of second-round phage eluate The method was the same as the amplification and purification of the first-round phage eluate in steps 3.1.3 and 3.1.4, to obtain the phage sublibrary for the second-round screening.

[0095] 3.2.4 Titering the phage sublibrary from the second round of screening The method was the same as for titering the phage sublibrary from the first round of screening in step 3.1.5.

[0096] 3.3 Third round of screening 3.3.1 Third round screening method The screening method was the same as that of the first round of screening in step 3.1.1. The phage sublibrary obtained by amplification and purification in the second round of screening (the phage sublibrary of the second round of screening) was used as the input phage library for the third round of screening, and the phage eluate for the third round of screening was obtained.

[0097] 3.3.2 Titering the phage eluate from the third round The measurement method was the same as that for measuring the initial phage titer in step 3.1.2.

[0098] 3.3.3 Third-round phage eluate amplification The method was the same as that for amplifying the first-round phage eluate in step 3.1.3. The third-round amplified phage eluate was obtained.

[0099] 3.4 Results of the three rounds of screening The results of three rounds of affinity screening are shown in Table 2. TIFF2026500340000006.tif38170In the table, *1Enrichment level is the screening titer divided by the input titer. The larger the value, the higher the enrichment level of antibodies in the input library. *2Fold difference is the screening titer divided by the control titer. The larger the value, the higher the content of positive antibodies in the screening library.

[0100] The results showed that after three rounds of screening, the enrichment level was 1.3 × 10 -2 The monoclonality of the clones was confirmed by ELISA.

[0101] 4. Selection of CLL1 VHH-positive single clones 4.1 ELISA determination of CLL1 VHH-positive single clones (1) A suitable dilution of bacterial suspension was taken from the phage eluate amplified in the third round, and the suspension was uniformly applied to a solid medium plate containing 100 μg / mL of Amp and cultured overnight at 37°C. (2) 192 single clone colonies were randomly picked and transferred to a 96-well cell culture plate (P1-P2), and 200 μL of 2xYT medium (containing 100 μg / mL Amp) was added to each well and cultured overnight at 37°C. (3) 5 μL of the overnight cultured bacterial solution was transferred to a new 96-well cell culture plate with 200 μL of 2xYT liquid medium (containing 100 μg / mL Amp) added to each well, and cultured at 37°C for 5 hours. (4) Helper phage M13K07 was added at a bacterial number:phage number = 1:20 according to the following formula. TIFF2026500340000007.tif13170In the formula, V is the volume of helper phage added (unit: mL), T helper-phage is the titer of the helper phage. (5) After incubation at 37°C for 30 minutes, Kan was added to a final concentration of 50 μg / mL, and the mixture was cultured overnight at 30°C. (6) The overnight cultured bacterial solution was centrifuged at 4°C and 4000 rpm for 10 minutes to obtain the supernatant, which was then stored at 4°C. (7) The screening antigen was diluted to 1 μg / ml with PBS, coated onto an ELISA plate at 100 μL / well, and left overnight at 4° C. The control group was coated with 3% BSA. (8) The antigen solution was discarded, 200 μL of PBS buffer was added to each well, and the ELISA plate was washed three times at room temperature for 10 minutes each. (9) 200 μL of blocking solution PBSTB (PBST containing 2% BSA) was added to each well, and the ELISA plate was blocked at room temperature for 1 hour. (10) The blocking solution was discarded, and 200 μL of PBST (1×PBS containing 0.1% Tween 20) buffer was added to each well, and the ELISA plate was washed three times at room temperature for 10 minutes each. (11) 100 μL of blocking solution was added to each well, and then 100 μL of the supernatant obtained by centrifugation in the above step (6) was added, followed by incubation at room temperature for 2 hours. (12) The liquid in the ELISA plate was discarded, and 200 μL of PBST buffer was added to each well, followed by washing three times for 10 minutes each. (13) M13 Bacteriophage HRP Antibody, Mouse Mab (Beijing Yiqiao Shenzhou Technology Co., Ltd., catalog number 11973-MM05T-H) diluted 1:30,000 in blocking solution was added to each well at 100 μL / well and incubated at room temperature for 1 hour. (14) The liquid in the ELISA plate was discarded, and 200 μL of PBST buffer was added to each well, followed by washing six times for 5 minutes each. (15) Add 100 μL of TMB single component coloring solution to each well, allow to develop in the dark for 1 to 3 minutes, add 100 μL of 1M HCl to each well to stop the coloring, and measure the OD using a microplate reader. 450 The value was read. OD 450 A value of >0.5 is considered positive, and the resulting positive clone is a phage containing a single domain antibody capable of binding to the CLL1 protein.

[0102] 4.2 ELISA secondary validation of CLL1 VHH-positive single clones To eliminate false-positive results, clones that initially tested positive were subjected to ELISA secondary validation using the same method as in step 4.1.

[0103] 4.3 Sequencing of CLL1 VHH-positive single clones Five microliters of the 181 positive clones from the secondary ELISA plate were inoculated into 1 mL of 2xYT medium (containing 100 μg / mL of Amp), and the OD was measured at 37°C and 250 rpm. 600 The culture was continued until the antibody titer reached 0.8 to 1.0, and 0.5 mL of the bacterial solution was sampled and sequenced to obtain different antibody sequences.

[0104] 5. Production of anti-CLL1 single domain antibodies 5.1 Structure and sequence of anti-CLL1 single domain antibodies The antibody gene sequences obtained by sequencing the positive single clones in step 4.3 were selected and used to produce anti-CLL1 single-domain antibodies (CLL1-VHH) by genetic engineering. One of the antibodies was designated CLL1-VHH-16.

[0105] A single domain antibody has only the variable region of a heavy chain antibody (VHH), and is composed of a framework region FR1, a complementarity-determining region CDR1, a framework region FR2, a complementarity-determining region CDR2, a framework region FR3, a complementarity-determining region CDR3, and a framework region FR4, in this order. The specific sequence information is as follows: The amino acid sequence of the single domain antibody CLL1-VHH-16 is SEQ ID NO: 1. In SEQ ID NO: 1, positions 1 to 25 represent the framework region FR1, positions 26 to 35 represent the complementarity-determining region CDR1, positions 36 to 49 represent the framework region FR2, positions 50 to 59 represent the complementarity-determining region CDR2, positions 60 to 98 represent the framework region FR3, positions 99 to 118 represent the complementarity-determining region CDR3, and positions 119 to 129 represent the framework region FR4. The nucleotide sequence of the nucleic acid molecule encoding the single domain antibody CLL1-VHH-16 (CLL1-VHH-16 gene) is shown in SEQ ID NO: 2.

[0106] Amino acid sequence of single domain antibody CLL1-VHH-16: 5'-DVQLQESGGGLVQPGGSLRLSCAAS GFTFGSYDMT WVRQAPGKGPEWVS GINSGGSSTY YADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAT IDRLSTVVAGTYQPSEEYDY WGQGTQVTVSS-3' (SEQ ID NO: 1). The three underlined regions are CDR1, CDR2, and CDR3, respectively.

[0107] Nucleotide sequence of CLL1-VHH-16 gene: 5'-GATGTGCAGCTGCAGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGGGGTTCTCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCGGAAGCTATGACATGACCTGGGTCCGCCAGGCTCCAGGAAAGGGGCCCGAGTGGGTCTCAGGAATTAATAGTGGTGGTAGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTGTATTACTGTGCAACTATCGACCGCCTTAGTACGGTAGTAGCTGGTACGTACCAGCCGTCCGAAGAATATGACTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCAGC-3' (SEQ ID NO: 2).

[0108] The sequences of the complementarity determining regions are defined according to the Kabat numbering system.

[0109] The single domain antibody is a single domain antibody that specifically binds to the CLL1 protein.

[0110] 5.2 Expression and Purification of Anti-CLL1 Single Domain Antibodies The eukaryotic expression vector pcDNA3.1 was used to express the anti-CLL1 single domain antibody (CLL1-VHH-16).

[0111] 5.2.1 Construction of recombinant vectors To facilitate purification, a human IgG1Fc gene (hFc gene, the nucleotide sequence of which is SEQ ID NO: 3 and the encoded amino acid sequence of which is SEQ ID NO: 4) was added to the 3' end of the gene encoding the single-domain antibody CLL1-VHH-16 (SEQ ID NO: 2) to obtain the CLL1-VHH-16-hFc fusion gene. A BamHI cleavage site was then added before the start codon at the 5' end of the fusion gene and an EcoRI cleavage site was added after the stop codon at the 3' end. The fusion gene was then cloned between the BamHI and EcoRI recognition sites of the eukaryotic expression vector pcDNA3.1 to obtain the recombinant eukaryotic expression vector pcDNA3.1-CLL1-VHH-16-hFc, which expresses the single-domain antibody CLL1-VHH-16 fused to the hFc gene at the C-terminus.

[0112] 5.2.2 Expression of Anti-CLL1 Single Domain Antibodies The eukaryotic expression vector pcDNA3.1-CLL1-VHH-16-hFc obtained in step 5.2.1 was introduced into HEK293 cells by conventional electroporation for expression.

[0113] 5.2.3 Purification of Anti-CLL1 Single Domain Antibodies Because Protein A has the activity of binding to the Fc fragment of IgG, the anti-CLL1 single domain antibody expressed in HEK293 cells was purified using a Protein A column (conventional purification procedure). Finally, a purified anti-CLL1 single domain antibody fused with hFc gene (CLL1-VHH-16-hFc) was obtained.

[0114] Example 2: Functional identification of anti-CLL1 single domain antibodies 1. Measurement of the affinity constant between antigen and antibody Test antibody: anti-CLL1 single domain antibody fused with hFc gene (CLL1-VHH-16-hFc) produced in step 5.2.3.

[0115] (1) The test antibody CLL1-VHH-16-hFc was labeled with Pierce™ NHS-Fluorescein Antibody Labeling Kit to obtain the FITC-labeled antibody FITC-CLL1-VHH-16-hFc for flow cytometry measurement.

[0116] (2) CLL1-positive cells K562-CLL1 and U937 cells 2 × 10 6 The cells were resuspended at a density of 100 cells / mL, 100 μL of which was transferred to each 96-well V-bottom plate, centrifuged, the supernatant discarded, and the cells were collected (K562 cells were used as a control for CLL1-negative cells).

[0117] (3) 40 μL of FITC-CLL1-VHH-16-hFc diluted at different gradients (see Table 3 for specific groupings) was mixed with the above cells and incubated at room temperature in the dark for 10 minutes. TIFF2026500340000008.tif26170

[0118] (4) The cells were washed twice with 200 μL of FACS buffer by centrifugation and resuspended in 200 μL of FACS buffer, and the mean fluorescence intensity (MFI) was immediately measured using flow cytometry.

[0119] (5) The equilibrium dissociation constant (KD) of the binding between the CLL1 VHH antibody and the target cells was calculated according to the formula to determine affinity. The smaller the KD value, the stronger the affinity. 1 / (MFI-Con)=1 / Fmax+(KD / Fmax)(1 / [CLL1-scfv IgG Fc]) In the formula, MFI-Con represents the relative mean fluorescence intensity, which is the mean fluorescence intensity of the experimental group minus the mean fluorescence intensity of the background, and CLL1-scfv IgG Fc represents the amount of antibody used (unit: ng).

[0120] A standard curve was plotted with the reciprocal of the antibody amount used on the horizontal axis and the reciprocal of the relative mean fluorescence intensity on the vertical axis, and a linear regression equation was obtained. The intersection of the standard curve and the vertical axis was calculated using the linear regression equation, where 1 / Fmax is the value, and KD is the value obtained by multiplying the slope of the line by Fmax.

[0121] The calculated equilibrium dissociation constants are shown in Table 4. TIFF2026500340000009.tif21170

[0122] 2. Specificity detection of single domain antibody CLL1-VHH-16 FITC-labeled CLL1-VHH-16 antibody (FITC-CLL1-VHH-16-hFc) was used to detect CLL1 expression on various tumor cells.

[0123] (1) CLL1-negative cell lines (control group): K562 cells and MM1.S cells. CLL1-positive cell lines (experimental group): U937 cells and the CLL1-overexpressing cell line K562-CLL1. They were recovered at 37°C, added to cell culture flasks, cultured at 37°C and 5% CO2, and passaged twice for use in detecting the anti-CLL1 single-domain antibody (FITC-CLL1-VHH-16-hFc). (2) The concentration of each cell was increased to 2 × 10 6 The solution was adjusted to cells / mL, added to a 96-well plate at 200 μL / well, and centrifuged at 1500 rpm for 5 minutes. (3) Wash with FACS buffer and then centrifuged. (4) 20 μL of diluted FITC-CLL1-VHH-16-hFc antibody (1:400) was added and mixed well, followed by incubation at room temperature for 10 minutes. (5) FACS buffer was added, and the mixture was centrifuged to remove the antibody. The mixture was then resuspended in buffer and measured using a flow cytometer.

[0124] Flow cytometry results showed that the FITC-CLL1-VHH-16-hFc antibody could specifically bind to the CLL1 antigen molecule expressed on tumor cells (Figure 3).

[0125] 3. Detection of CLL1 expression in bone marrow cells of AML patients FITC-labeled CLL1-VHH-16 antibody (FITC-CLL1-VHH-16-hFc) was used to detect bone marrow cells from three patients with acute myeloid leukemia (AML) and compared with Biolegend's APC-labeled anti-human CLL1 specific antibody (Cat. No. 143405). The flow cytometry analysis procedure was as follows.

[0126] (1) Cryopreserved bone marrow cells from three AML patients were recovered at 37°C. (2) Cell density is increased to 2 × 10 6 The solution was adjusted to cells / ml, added to a 96-well plate at 200 μL / well, and centrifuged at 1500 rpm for 5 minutes. (3) Wash with FACS buffer and then centrifuged. (4) 20 μL of diluted FITC-CLL1-VHH-16-hFc antibody (1:400) was added, mixed well, and incubated at room temperature for 10 minutes. (5) FACS buffer was added, and the mixture was centrifuged to remove the antibody. The mixture was then resuspended in buffer and measured using a flow cytometer. (6) For comparison, Biolegend's APC-labeled anti-human CLL1 specific antibody (CLL1-APC) was used, and the procedure was the same as above.

[0127] The results showed that the FITC-CLL1-VHH-16-hFc antibody of the present invention and Biolegend's APC-labeled anti-human CLL1 specific antibody showed similar expression profiles (Figure 4), indicating that the single domain antibody CLL1-VHH-16 of the present invention can specifically recognize CLL1 expressed by AML tumor cells.

[0128] The present invention has been described in detail above. Those skilled in the art can practice the present invention to a broader extent under equivalent parameters, concentrations, and conditions without departing from the spirit and scope of the present invention and without undue experimentation. Although the present invention has been described with specific examples, it is understood that the present invention can be further improved. In short, based on the principles of the present invention, the present application is intended to cover any changes, uses, or improvements to the present invention that depart from the scope disclosed herein, including improvements made using conventional techniques known in the art. Some basic features may be applied within the scope of the following appended claims. [Industrial Applicability]

[0129] The anti-CLL1 single domain antibody (CLL1-VHH-16) of the present invention has high affinity and can specifically target CLL1-positive cells (cells expressing CLL1 protein) and can be used to detect CLL1 expression in bone marrow cells of AML patients. The single domain antibody of the present invention can be used to produce specific antibody drugs clinically used for the prevention and treatment of CLL1-targeted diseases (acute myeloid leukemia, myelodysplastic syndrome, or chronic myeloid leukemia), as well as to produce CLL1-targeting CAR cells and CLL1 protein detection kits. The single domain antibody drug of the present invention has a stable structure, small molecule, is easily recombinantly expressed, and is inexpensive to produce. It can be used alone or as a drug delivery system for delivering related drugs, and has very broad prospects and important significance in fields such as pharmaceutical applications and clinical diagnosis.

Claims

1. A single domain antibody, characterized in that the single domain antibody is composed of a heavy chain variable region, and the heavy chain variable region comprises a complementarity determining region (CDR1) having the amino acid sequence of positions 26 to 35 of SEQ ID NO: 1, a complementarity determining region (CDR2) having the amino acid sequence of positions 50 to 59 of SEQ ID NO: 1, and a complementarity determining region (CDR3) having the amino acid sequence of positions 99 to 118 of SEQ ID NO:

1.

2. The single domain antibody of claim 1, wherein the amino acid sequence of the heavy chain variable region is SEQ ID NO: 1 or an amino acid sequence having at least 80% identity to SEQ ID NO: 1 and having the same function.

3. A biomaterial related to a single domain antibody according to claim 1 or 2, characterized in that the biomaterial is any one of the following C1) to C4): C1) A nucleic acid molecule encoding the heavy chain variable region of the single domain antibody of claim 1 or 2; C2) an expression cassette comprising the nucleic acid molecule according to C1); C3) A recombinant vector comprising the nucleic acid molecule according to C1), or a recombinant vector comprising the expression cassette according to C2); C4) A recombinant host cell comprising a nucleic acid molecule according to C1), or a recombinant host cell comprising an expression cassette according to C2), or a recombinant host cell comprising a recombinant vector according to C3).

4. 4. The biomaterial of claim 3, wherein the nucleic acid molecule is one of the following: D1) a DNA molecule whose nucleotide sequence or coding sequence is SEQ ID NO: 2; D2) A DNA molecule having 75% or more identity with the nucleotide sequence defined in D1) and having the same function.

5. A pharmaceutical composition comprising a single domain antibody according to claim 1 or 2.

6. A reagent or kit comprising a single domain antibody according to claim 1 or 2 and having one of the following uses: F1) Use in detecting CLL1 protein; F2) Use in screening, diagnosing or aiding in diagnosis of CLL1 target-related diseases; F3) Use in in vivo imaging of CLL1 protein.

7. 10. Any one of the following uses of a single domain antibody according to claim 1 or 2 and / or a biomaterial according to claim 3 or 4: E1) Use in the manufacture of a medicament for the prevention or treatment of tumors, or use in the prevention or treatment of tumors; E2) Use in the manufacture of a medicament for the prevention or treatment of a CLL1 target-related disease, or use in the prevention or treatment of a CLL1 target-related disease; E3) Use in the manufacture of a product for screening, diagnosing or aiding in diagnosis of a CLL1 target-related disease, or use in screening, diagnosing or aiding in diagnosis of a CLL1 target-related disease; E4) Use in the detection of CLL1 protein or in the manufacture of a product for the detection of CLL1 protein; E5) Use in the manufacture of a product for binding to CLL1 protein; E6) Use in the drug-mediated specific recognition of tumors expressing the CLL1 antigen or in the manufacture of a product for the drug-mediated specific recognition of tumors expressing the CLL1 antigen; E7) Use in in vivo imaging of CLL1 protein or in the manufacture of a product for in vivo imaging of CLL1 protein; E8) Use in the production of CAR cells targeting CLL1.

8. The use according to claim 7, characterized in that the CLL1 target-related disease is a CLL1-positive cancer.

9. The use according to claim 8, characterized in that the CLL1-positive cancer is acute myeloid leukemia, myelodysplastic syndrome or chronic myeloid leukemia.

10. 10. A method for producing the single domain antibody of claim 1 or 2, comprising: constructing a recombinant expression vector containing the nucleic acid molecule of claim 3 or 4; introducing the recombinant expression vector into a host cell to obtain a recombinant cell that expresses the single domain antibody; culturing the recombinant cell; and obtaining the single domain antibody by separation and purification.

11. A method for diagnosing or assisting in the diagnosis of a CLL1 target-related disease, comprising: collecting a sample from a subject; detecting the content of CLL1 protein in the sample using a single domain antibody described in claim 1 or 2; and diagnosing or assisting in the diagnosis of a CLL1 target-related disease based on the content of the CLL1 protein.

12. A method for screening for a CLL1 target-related disease, comprising: collecting a sample from a subject; detecting the content of CLL1 protein in the sample using a single domain antibody described in claim 1 or 2; and screening for a CLL1 target-related disease based on the content of the CLL1 protein.

13. A method for preventing or treating a CLL1 target-related disease, comprising administering a single domain antibody described in claim 1 or 2 or a pharmaceutical composition described in claim 5 to a subject suffering from a CLL1 target-related disease.

14. 14. The method according to any one of claims 11 to 13, characterized in that the CLL1 target-associated disease is a CLL1 target-associated tumor.

15. 15. The method of claim 14, wherein the CLL1 target-associated tumor is a CLL1-positive cancer.

16. 16. The method of claim 15, wherein the CLL1-positive cancer is acute myeloid leukemia, myelodysplastic syndrome, or chronic myeloid leukemia.

17. A method for detecting CLL1 protein in vitro, characterized in that it comprises detecting CLL1 protein using a single domain antibody described in claim 1 or 2 or a kit described in claim 6.

18. An antibody-drug conjugate comprising an antibody portion and a binding portion, wherein the antibody portion comprises the single domain antibody of claim 1 or 2.

19. 19. The antibody-drug conjugate of claim 18, wherein the binding moiety comprises a detectable label, a chemical drug, or a cytotoxin.

Citation Information

Patent Citations

  • Single domain antibodies against CLL-1

    JP2022511799A