Chimeric receptors and methods of use thereof

Abstract

To provide antigen binding molecules targeting CLL-1, chimeric receptors, and engineered immune cells, as well as vectors, compositions, and methods for treatment and / or detection using antigen binding molecules and engineered immune cells.SOLUTION: A chimeric antigen receptor comprises an antigen binding molecule that specifically binds to CLL-1, wherein the antigen binding molecule comprises at least one of variable heavy chains CDR1, CDR2 and CDR3 comprising specific amino acid sequences, and variable light chains CDR1, CDR2 and CDR3 comprising specific amino acid sequences.SELECTED DRAWING: None

Description

[Technical field]

[0001] [CROSS REFERENCE TO RELATED APPLICATIONS] This application claims the benefit of U.S. Provisional Patent Application No. 62 / 317,068, filed April 1, 2016, which is incorporated herein by reference in its entirety.

[0002] [Sequence table] This application contains a Sequence Listing that has been submitted electronically in ASCII format and is incorporated herein by reference in its entirety. The ASCII copy, created on March 31, 2017, is named K-1029_02_SL.txt and is 265829 bytes in size. [Background technology]

[0003] C-type lectin-like-1 (CLL-1; also known as CLEC-1, CLEC12A, MICL, dendritic cell-associated lectin-1 (DCAL-1) and DCAL-2) is a glycoprotein receptor and a member of the C-type lectin-like receptor family involved in the regulation of cell proliferation and immune regulation. CLL-1 is expressed in hematopoietic cells, mainly on innate immune cells including monocytes, granulocytes, dendritic cells and myeloid progenitor cells (Non-Patent Document 1). CLL-1 has been implicated in the regulation of myeloid cell proliferation and differentiation (Non-Patent Document 2, Non-Patent Document 3) and is present on acute myeloid (myeloid) leukemia (AML) cells and leukemia stem cells (Non-Patent Document 4).

[0004] Accordingly, CLL-1 has been associated with a number of diseases, including, but not limited to, acute myeloid (myeloid) leukemia (AML), chronic myeloid (myeloid) leukemia (CML), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia, atypical chronic myeloid leukemia, acute promyelocytic leukemia (APL), acute monocytic leukemia, acute monoblastic leukemia, acute erythroleukemia, acute megakaryoblastic leukemia, myelodysplastic syndromes (MDS), myeloproliferative disorders, myeloid neoplasms, myeloid sarcomas, blastic plasmacytoid dendritic cell neoplasms (BPDCN), or combinations thereof.

[0005] CLL-1 may additionally play a role in inflammatory or autoimmune diseases such as rheumatoid arthritis, psoriasis, allergies, asthma, Crohn's disease, IBD, IBS, fibromyalgia, mastocytosis and celiac disease.

[0006] Human CLL-1 proteins include polypeptides of the following amino acid sequences: MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA (SEQ ID NO: 140).

[0007] Additional sequence information is contained in the CLL-1 Uniprot list (http: / / www.uniprot.org / uniprot / Q5QGZ9) and the NCBI reference sequence NP_612210.4 (http: / / www.ncbi.nlm.nih.gov / protein / NP_612210.4).

[0008] When referring to CLL-1, reference is made to fragments thereof, as well as allelic variants, splice variants, derivative variants, substitution variants, deletion variants, and / or N-terminal methionine variants. It will be understood that the term encompasses related polypeptides, including, but not limited to, insertional mutants, fusion polypeptides, and interspecies homologs, including the addition of a CLL-1 polypeptide. In certain embodiments, the CLL-1 polypeptide includes terminal residues, such as, but not limited to, leader sequence residues, targeting residues, amino terminal methionine residues, lysine residues, tag residues, and / or fusion protein residues.

[0009] Certain antibodies against CLL-1 are described in US Pat. Nos. 5,393,943 and 5,423,336.

[0010] Engineered immune cells have been shown to have desirable qualities in therapeutic treatments, particularly in oncology. Two major types of engineered immune cells are those containing chimeric antigen receptors (referred to as "CAR" or "CAR-T") and T cell receptors ("TCR"). These engineered cells are engineered to confer antigen specificity while retaining or enhancing their ability to recognize and kill target cells. Chimeric antigen receptors can, for example, contain (i) an antigen-specific component ("antigen binding molecule"), (ii) an extracellular domain, (iii) one or more costimulatory domains, and (iv) one or more activation domains. Each domain may be heterologous, i.e., composed of sequences derived from (or corresponding to) different protein chains. Immune cells (such as T cells) expressing chimeric antigen receptors can be used in a variety of therapies, including cancer therapy. Costimulating domains can be used to regulate the activity of CAR-expressing cells against target antigens. It will be appreciated that this can enhance activation of the antibody, thereby increasing the efficacy of adoptive immunotherapy.

[0011] Certain CARs against CLL-1 are described, for example, in US Pat. No. 5,399,633.

[0012] T cells can be engineered to have specificity for one or more desired targets. For example, T cells can be transduced with DNA or other genetic material that encodes an antigen-binding molecule, such as one or more single-chain variable fragments of an antibody ("scFv"), along with one or more signaling molecules, and / or one or more activation domains, such as CD3 zeta.

[0013] In addition to the ability of CAR-T cells to recognize and destroy target cells, successful T cell therapy benefits from the ability of CAR-T cells to persist and maintain their ability to proliferate in response to antigen.

[0014] The T cell receptor (TCR) is a molecule found on the surface of T cells that is responsible for the recognition of antigen fragments as peptides bound to major histocompatibility complex (MHC) molecules. The TCR is composed of two different protein chains. In approximately 95% of human TCRs, the TCR consists of an alpha (α) chain and a beta (β) chain. In approximately 5% of human T cells, the TCR consists of a gamma and delta (γ / δ) chain. Each chain is composed of two extracellular domains of the immunoglobulin superfamily: a variable (V) region and a constant (C) region. As with other immunoglobulins, the variable domains of the TCR α and β chains (or gamma and delta (γ / δ) chains) each have three hypervariable regions, or complementarity determining regions (CDRs). Binding of the TCR to an antigenic peptide and MHC (peptide / MHC) activates the T cell, enabling it to attack and destroy target cells. [Prior art documents] [Patent documents]

[0015] [Patent Document 1] U.S. Patent No. 8,536,310 [Patent Document 2] U.S. Patent No. 9,163,090 [Patent Document 3] U.S. Patent Application Publication No. 20160051651 (International Application No. PCT US2015 / 041337) [Non-patent literature]

[0016] [Non-Patent Document 1] Van Rhenen et al., Blood 2007:110(7) [Non-Patent Document 2] Bakker et al., Cancer Res. 64:8443-8450 (2004) [Non-Patent Document 3] Marshall et al., J. Biol. Chem. 279:14792-14802 (2004) [Non-Patent Document 4] Zhao et al., Haematologica 2010, 95(1):71-78 Summary of the Invention [Problem to be solved by the invention]

[0017] However, current therapies have demonstrated variable levels of efficacy accompanied by undesirable side effects. Thus, there is a need to identify new and improved therapies for treating CLL-1 related diseases and disorders. [Means for solving the problem]

[0018] The present invention relates to engineered immune cells (such as CAR or TCR) with specificity for CLL-1, antigen-binding molecules (including, but not limited to, antibodies, scFvs, the heavy and / or light chains of these antigen-binding molecules, and CDRs).

[0019] The invention further relates to novel CD28 extracellular (hinge) sequences useful as costimulatory domains in these cells.

[0020] The chimeric antigen receptor of the present invention typically comprises (i) a CLL-1 specific antigen binding molecule, (ii) an extracellular domain (which may include a hinge), (iii) one or more costimulatory domains, and (iv) one or more activation domains. It will be understood that each domain may be heterologous and thus composed of sequences derived from (or corresponding to) different protein chains.

[0021] In some embodiments, the present invention relates to a chimeric antigen receptor comprising an antigen binding molecule that specifically binds to CLL-1, the antigen binding molecule comprising at least one of a) a variable heavy chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 17, 51, 73 and 95, b) a variable heavy chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 52, 74 and 96, c) a variable heavy chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 53, 75 and 97, d) a variable light chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22, 56, 78 and 100, e) a variable light chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 23, 57, 79 and 101, and f) a variable light chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 58, 80 and 102. The chimeric antigen receptor may further comprise at least one costimulatory domain. The chimeric antigen receptor of claim 1 further comprises at least one activation domain.

[0022] In certain embodiments, the present invention relates to a chimeric antigen receptor having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to a chimeric antigen receptor defined herein.

[0023] Chimeric antigen receptors with eight or fewer amino acid substitutions are also encompassed by the present invention.

[0024] In certain embodiments, the costimulatory domain is selected from the group consisting of CD28, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD 247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD 4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R delta, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT The signaling domain (or other suitable portion) of AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, a ligand that specifically binds CD83, or any combination thereof.

[0025] In some embodiments, the costimulatory domain can include all or a portion of the 4-1BB nucleic acid sequence set forth in SEQ ID NO: 141 and the corresponding amino acid sequence set forth in SEQ ID NO: 142. In other embodiments, the costimulatory domain can include all or a portion of the amino acid sequence of OX40 set forth in SEQ ID NO: 143. Hombach et al., Oncoimmunology. 2012 Jul. 1; 1(4): 458-466. In yet other embodiments, the costimulatory domain can include all or a portion of the ICOS molecule described in Guedan et al., August 14, 2014; Blood: 124 (7) and Shen et al., Journal of Hematology & Oncology (2013) 6:33. In embodiments, the costimulatory domain can include all or a portion of CD27, as described in Song et al., Oncoimmunology. 2012 Jul. 1;1(4): 547-549.

[0026] Preferred embodiments include the incorporation into a CAR of the invention of one or more of the following sequences: SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8. Additional preferred embodiments include the incorporation into a CAR of the invention of the sequence set forth in SEQ ID NO: 14.

[0027] In a further embodiment, the activation domain comprises CD3, preferably CD3 zeta, more preferably CD3 zeta having the sequence set forth in SEQ ID NO:10.

[0028] In another embodiment, the present invention relates to a chimeric antigen receptor comprising an antigen binding molecule further comprising SEQ ID NO:2 and further comprising SEQ ID NO:10.

[0029] The present invention further relates to isolated polynucleotides encoding chimeric antigen receptors and vectors comprising said polynucleotides. Any vector known in the art may be suitable for the present invention. In some embodiments, the vector is a viral vector. In some embodiments, the vector is a retroviral vector (such as pMSVG1), a DNA vector, a murine leukemia virus vector, a SFG vector, a plasmid, an RNA vector, an adenoviral vector, a baculoviral vector, an Epstein-Barr virus vector, a papovavirus vector, a vaccinia virus vector, a herpes simplex virus vector, an adeno-associated virus vector (AAV), a lentiviral vector (such as pGAR), or any combination thereof. The pGAR sequence is as follows: AGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTC

[0030] The pGAR vector map is shown below: [ka]

[0031] Suitable additional exemplary vectors include, for example, pBABE-puro, pBABE-neo largeTcDNA, pBABE-hygro-hTERT, pMKO.1 GFP, MSCV-IRES-GFP, pMSCV PIG (Puro IRES GFP empty plasmid), pMSCV-loxp-dsRed-loxp-eGFP-Puro-WPRE, MSCV IRES Luciferase, pMIG, MDH1-PGK-GFP_2.0, TtRMPVIR, pMSCV-IRES-mCherry FP, pRetroX GFP T2A Cre, pRXTN, pLncEXP, and pLXIN-Luc.

[0032] Exemplary immune cells include, but are not limited to, T cells, tumor infiltrating lymphocytes (TIL), NK cells, TCR expressing cells, dendritic cells, or NK-T cells. T cells can be autologous, allogeneic, or xenogeneic. In other embodiments, the invention relates to pharmaceutical compositions comprising the immune cells described herein.

[0033] In certain embodiments, the present invention provides a method for producing a cellular membrane comprising: (a) a VH region comprising the amino acid sequence of SEQ ID NO: 16 and a VL region comprising the amino acid sequence of SEQ ID NO: 21; (b) a VH region comprising the amino acid sequence of SEQ ID NO: 50 and a VL region comprising the amino acid sequence of SEQ ID NO: 55; (c) a VH region comprising the amino acid sequence of SEQ ID NO: 72 and a VL region comprising the amino acid sequence of SEQ ID NO: 77; (d) a VH region comprising the amino acid sequence of SEQ ID NO: 94 and a VL region comprising the amino acid sequence of SEQ ID NO: 99; and wherein the VH and VL domain(s) are linked by at least one linker. Chimeric antigen receptors and / or antigen-binding molecules having eight or fewer amino acid substitutions are also encompassed by the present invention.

[0034] The linker can be, for example, GGGGSGGGSGGGGS (SEQ ID NO: 130) or GGGG It may be a polyGly linker such as SGGGGSGGGGSGGGGS (SEQ ID NO: 145).

[0035] In other embodiments, the invention relates to antigen binding molecules (and chimeric antigen receptors comprising these molecules) in which the linker comprises at least one of SEQ ID NO: 130 and SEQ ID NO: 132.

[0036] In certain embodiments, the present invention relates to antigen binding molecules and / or chimeric antigen receptors having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to the antigen binding molecules and / or chimeric antigen receptors defined herein.

[0037] In other embodiments, the present invention relates to an isolated polynucleotide comprising at least one of SEQ ID NO:27, SEQ ID NO:31, SEQ ID NO:35, SEQ ID NO:39, SEQ ID NO:43, SEQ ID NO:47, SEQ ID NO:61, SEQ ID NO:65, SEQ ID NO:69, SEQ ID NO:83, SEQ ID NO:87, SEQ ID NO:91, SEQ ID NO:105, SEQ ID NO:109, SEQ ID NO:113, SEQ ID NO:117, SEQ ID NO:121, and SEQ ID NO:125.

[0038] In certain embodiments, the present invention relates to isolated polynucleotides having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to the polynucleotides defined herein.

[0039] The invention further relates to vectors which include these polynucleotides and to cells transfected with these vectors.

[0040] In other embodiments, the present invention relates to isolated polypeptides comprising an amino acid sequence as set forth in at least one of SEQ ID NO:28, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44, SEQ ID NO:48, SEQ ID NO:62, SEQ ID NO:66, SEQ ID NO:70, SEQ ID NO:84, SEQ ID NO:88, SEQ ID NO:92, SEQ ID NO:106, SEQ ID NO:110, SEQ ID NO:114, SEQ ID NO:118, SEQ ID NO:122, and SEQ ID NO:126. In other embodiments, the present invention relates to vectors encoding these polypeptides, and immune cells comprising these polypeptides. Preferred immune cells include T cells, tumor infiltrating lymphocytes (TIL), NK cells, TCR expressing cells, dendritic cells, or NK-T cells. T cells can be autologous, allogeneic, or xenogeneic. Chimeric antigen receptors with up to eight amino acid substitutions therein are also encompassed by the present invention.

[0041] In another embodiment, the present invention provides an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the antigen binding molecule comprises a variable heavy (VH) domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 53, 75, and 97. H The present invention relates to an isolated polynucleotide comprising a chimeric antigen receptor having up to eight amino acid substitutions therein. The polynucleotide may further comprise an activation domain. In a preferred embodiment, the activation domain is CD3, more preferably CD3 zeta, more preferably the amino acid sequence set forth in SEQ ID NO:9.

[0042] In other embodiments, the present invention provides a method for the treatment of cancer cells comprising administering to the patient a therapeutically effective amount of ... 37, CD154, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1, CD11a / CD18), CD247, CD276 (B7-H3), LIGHT (tumor necrosis factor superfamily member 14; TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF, TNFr, integrin, signaling lymphocyte activation molecule, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LF A-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT The costimulatory domain comprises a signaling domain (or other suitable portion) of AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, CD83 ligand or fragment, or combinations thereof. Preferred costimulatory domains are listed below.

[0043] In a further embodiment, the present invention relates to an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR comprises an antigen binding molecule that specifically binds to CLL-1, and the antigen binding molecule comprises a variable light (VL) domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 58, 80 and 102. L The present invention relates to an isolated polynucleotide comprising the CDR3 of one or more of the 5'-terminal amino acid sequence ...

[0044] In another embodiment, the present invention relates to an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 17), CDR2 (SEQ ID NO: 18) and CDR3 (SEQ ID NO: 19) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 22), CDR2 (SEQ ID NO: 23) and CDR3 (SEQ ID NO: 24).

[0045] In certain embodiments, the present invention relates to isolated polynucleotides having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to the above sequences.

[0046] In another embodiment, the present invention relates to an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 51), CDR2 (SEQ ID NO: 52) and CDR3 (SEQ ID NO: 53) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 56), CDR2 (SEQ ID NO: 57) and CDR3 (SEQ ID NO: 58).

[0047] In certain embodiments, the present invention provides a method for the preparation of a nucleic acid sequence that is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, at least about 15 ... In one embodiment, the invention relates to an isolated polynucleotide having at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to the sequence.

[0048] In another embodiment, the present invention relates to an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 73), CDR2 (SEQ ID NO: 74) and CDR3 (SEQ ID NO: 75) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 78), CDR2 (SEQ ID NO: 79) and CDR3 (SEQ ID NO: 80).

[0049] In certain embodiments, the present invention relates to isolated polynucleotides having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to the above sequences.

[0050] In another embodiment, the present invention relates to an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 95), CDR2 (SEQ ID NO: 96) and CDR3 (SEQ ID NO: 97) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 100), CDR2 (SEQ ID NO: 101) and CDR3 (SEQ ID NO: 102).

[0051] In certain embodiments, the present invention relates to isolated polynucleotides having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identity to the above sequences.

[0052] In a further embodiment, the present invention provides an isolated polynucleotide encoding a chimeric antigen receptor (CAR) or a T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the antigen binding molecule comprises: (a) the amino acid sequence GX2X3X4X5X6X7X8X9 (SEQ ID NO: 134), X2 is G, F or Y; X3 is S or T; X4 is I, F or L; X5 is S or T; X6 is absent or is S; X7 is absent or is G; X8 is absent, E or G; X9 is F, L, or Y), (b) the amino acid sequence X1X2X3X4X5X6 (SEQ ID NO: 135), X1 is D, H, S or Y; X2 is H, P or Y; X3 is D, E or S; X4 is D or G; X5 is G or S; X6 is absent or is D or E), (c) Amino acid sequence X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 DY (SEQ ID NO: 136), X1 is E or L; X2 is R, S or V; X3 is R or Y; X4 is C, G or S; X5 is absent, G or I; X6 is absent or is G; X7 is absent or is D; X8 is absent or is C; X9 is absent, W or Y; X 10 is absent or is P or S, X 11 is absent or is G or Y; X 12 a heavy chain variable region (VH) complementarity determining region (CDR) 3 comprising: (d) Amino acid sequence X1ASQX5X6X7X8X9LX 11 (SEQ ID NO: 137) (wherein X1 is Q or R; X5 is D or S; X6 is I or V; X7 is N or S; X8 is N or S; X9 is F, L or Y; X 11 is N or T), (e) the amino acid sequence X1ASX4X5X6X7 (SEQ ID NO: 138), X1 is D or G; X4 is N, S or T; X5 is L or R; X6 is A, E or K; and / or a light chain variable region (VL) CDR2 comprising: (f) the amino acid sequence QQX3X4X5X6PX8T (SEQ ID NO: 139), X3 is S or Y; X4 is D, G or Y; X5 is N, S or T; X6 is L, T or Y; X8 is F or I), The present invention relates to an isolated polynucleotide comprising:

[0053] The present invention further relates to an antigen binding molecule for CLL-1 comprising at least one variable heavy chain CDR3 or variable light chain CDR3 sequence as defined herein.The present invention further relates to an antigen binding molecule for CLL-1 comprising at least one variable heavy chain CDR1, CDR2 and CDR3 sequence as described herein.The present invention further relates to an antigen binding molecule for CLL-1 comprising at least one variable light chain CDR1, CDR2 and CDR3 sequence as described herein.The present invention further relates to an antigen binding molecule for CLL-1 comprising both the variable heavy chain CDR1, CDR2, CDR3 sequence and the variable light chain CDR1, CDR2 and CDR3 sequence as described herein.

[0054] The present invention further relates to a method of treating a disease or disorder in a subject in need thereof, comprising administering to the subject an antigen binding molecule, CAR, TCR, polynucleotide, vector, cell or composition according to the present invention. Diseases suitable for treatment include, but are not limited to, acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia, atypical chronic myeloid leukemia, acute promyelocytic leukemia (APL), acute monoblastic leukemia, acute erythroleukemia, acute megakaryoblastic leukemia, myelodysplastic syndrome (MDS), myeloproliferative disorders, myeloid neoplasms, myeloid sarcoma, blastic plasmacytoid dendritic cell neoplasm (BPDCN), or combinations thereof. Additional diseases include inflammatory and / or autoimmune diseases such as rheumatoid arthritis, psoriasis, allergies, asthma, Crohn's disease, IBD, IBS, fibromyalgia, mastocytosis and celiac disease. Item 1 A chimeric antigen receptor comprising an antigen-binding molecule that specifically binds to CLL-1, the antigen-binding molecule comprising: a) a variable heavy chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 17, 51, 73 and 95; b) a variable heavy chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 52, 74 and 96; c) a variable heavy chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 53, 75 and 97; d) a variable light chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22, 56, 78 and 100; e) a variable light chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 23, 57, 79 and 101; f) a variable light chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 58, 80 and 102; A chimeric antigen receptor comprising at least one of the following: Section 2 The chimeric antigen receptor of item 1, having eight or fewer amino acid substitutions. Section 3 The chimeric antigen receptor of paragraph 1, further comprising at least one costimulatory domain. Section 4 The chimeric antigen receptor of item 1, further comprising at least one activation domain. Section 5 The costimulatory domain is selected from the group consisting of CD28, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAF FR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD 11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITG B7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT 4. The chimeric antigen receptor of claim 3, which is a signaling region (or other suitable portion) of AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, a ligand that specifically binds to CD83, or any combination thereof. Section 6 The chimeric antigen receptor of clause 5, wherein the costimulatory domain comprises CD28. Section 7 The chimeric antigen receptor of paragraph 6, wherein the CD28 costimulatory domain comprises a sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 and SEQ ID NO:8. Section 8 The chimeric antigen receptor of clause 5, wherein the CD8 costimulatory domain comprises SEQ ID NO:14. Section 9 The chimeric antigen receptor of paragraph 4, wherein the activation domain comprises CD3. Item 10 The chimeric antigen receptor of clause 9, wherein the CD3 comprises CD3 zeta. Section 11 The chimeric antigen receptor of clause 10, wherein the CD3 zeta comprises SEQ ID NO:10. Item 12 The chimeric antigen receptor of item 1, further comprising SEQ ID NO: 2 and SEQ ID NO: 10. Item 13 An isolated polynucleotide encoding the chimeric antigen receptor of item 1. Item 14 A vector comprising the polynucleotide according to item 13. Item 15 Item 15. The vector according to item 14, which is a retroviral vector, a DNA vector, a plasmid, an RNA vector, an adenoviral vector, an adeno-associated viral vector, a lentiviral vector, or any combination thereof. Item 16 An immune cell comprising the vector described in item 14. Section 17 The immune cell according to item 16, which is a T cell, a tumor infiltrating lymphocyte (TIL), a NK cell, a TCR-expressing cell, a dendritic cell, or a NK-T cell. Section 18 The immune cell of clause 17, which is an autologous T cell. Section 19 The immune cell of clause 17, which is an allogeneic T cell. Section 20 A chimeric antigen receptor having at least 90% identity to the sequence of the antigen-binding molecule of item 1. Section 21 A chimeric antigen receptor having at least 95% identity to the sequence of the antigen-binding molecule of item 1. Section 22 A pharmaceutical composition comprising the T cell of item 17, 18 or 19. Section 23 A chimeric antigen receptor, (a) a VH region comprising the amino acid sequence of SEQ ID NO: 16 and a VL region comprising the amino acid sequence of SEQ ID NO: 21; (b) a VH region comprising the amino acid sequence of SEQ ID NO: 50 and a VL region comprising the amino acid sequence of SEQ ID NO: 55; (c) a VH region comprising the amino acid sequence of SEQ ID NO: 72 and a VL region comprising the amino acid sequence of SEQ ID NO: 77; (d) a VH region comprising the amino acid sequence of SEQ ID NO: 94 and a VL region comprising the amino acid sequence of SEQ ID NO: 99; wherein the VH region and the VL region are linked by at least one linker. Section 24 The chimeric antigen receptor of clause 23, having eight or fewer amino acid substitutions. Section 25 The chimeric antigen receptor of claim 23, wherein the linker comprises at least one of SEQ ID NO: 130 and SEQ ID NO: 132. Section 26 The chimeric antigen receptor of clause 23, further comprising at least one costimulatory domain. Section 27 The chimeric antigen receptor of clause 23, further comprising at least one activation domain. Section 28 The costimulatory domain is selected from the group consisting of CD28, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAF FR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD 11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITG B7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT 27. The chimeric antigen receptor according to claim 26, which is a signal transduction region of a ligand that specifically binds to AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, CD83, or any combination thereof. Section 29 An immune cell comprising the chimeric antigen receptor according to item 23. Item 30 The immune cell according to item 29, which is a T cell, a tumor infiltrating lymphocyte (TIL), a NK cell, a TCR-expressing cell, a dendritic cell, or a NK-T cell. Section 31 The T cell of clause 30, which is an autologous T cell. Section 32 The T cell of clause 30, which is an allogeneic T cell. Item 33 A pharmaceutical composition comprising the immune cell according to item 29. Section 34 An isolated polynucleotide comprising at least one of SEQ ID NO:27, SEQ ID NO:31, SEQ ID NO:35, SEQ ID NO:39, SEQ ID NO:43, SEQ ID NO:47, SEQ ID NO:61, SEQ ID NO:65, SEQ ID NO:69, SEQ ID NO:83, SEQ ID NO:87, SEQ ID NO:91, SEQ ID NO:105, SEQ ID NO:109, SEQ ID NO:113, SEQ ID NO:117, SEQ ID NO:121 and SEQ ID NO:125. Section 35 A vector comprising the polynucleotide according to item 34. Section 36 An immune cell comprising the vector described in item 33. Section 37 37. The immune cell according to item 36, which is a T cell, a tumor infiltrating lymphocyte (TIL), a NK cell, a TCR-expressing cell, a dendritic cell, or a NK-T cell. Section 38 38. The T cell of clause 37, which is an autologous T cell. Section 39 38. The T cell of clause 37, which is an allogeneic T cell. Section 40 An isolated polypeptide comprising an amino acid sequence set forth in at least one of SEQ ID NO:28, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44, SEQ ID NO:48, SEQ ID NO:62, SEQ ID NO:66, SEQ ID NO:70, SEQ ID NO:84, SEQ ID NO:88, SEQ ID NO:92, SEQ ID NO:106, SEQ ID NO:110, SEQ ID NO:114, SEQ ID NO:118, SEQ ID NO:122 and SEQ ID NO:126. Section 41 41. The isolated polypeptide of paragraph 40, having eight or fewer amino acid substitutions. Section 42 41. A vector encoding the polypeptide according to item 40. Section 43 An immune cell comprising the vector according to item 42. Section 44 The immune cell according to item 43, which is a T cell, a tumor infiltrating lymphocyte (TIL), a NK cell, a TCR-expressing cell, a dendritic cell, or a NK-T cell. Section 45 45. The T cell of clause 44, which is an autologous T cell or an allogeneic T cell. Section 46 An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen binding molecule that specifically binds to CLL-1, wherein the antigen binding molecule comprises a variable heavy chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 53, 75 and 97. Section 47 The polynucleotide of Paragraph 46, further comprising an activation domain. Section 48 48. The polynucleotide of paragraph 47, wherein the activation domain is CD3. Section 49 49. The polynucleotide of paragraph 48, wherein the CD3 is CD3 zeta. Section 50 The polynucleotide of claim 49, wherein the CD3 zeta comprises the amino acid sequence set forth in SEQ ID NO:9. Section 51 The polynucleotide of paragraph 46, further comprising a costimulatory domain. Section 52 The costimulatory domain is selected from the group consisting of CD28, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAF FR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD 11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITG B7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT 52. The polynucleotide of claim 51, which is a signal transduction region of AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, a ligand that specifically binds to CD83, or any combination thereof. Section 53 The polynucleotide of paragraph 52, wherein the CD28 costimulatory domain encodes the amino acid sequence set forth in SEQ ID NO:2. Section 54 47. A vector comprising the polynucleotide according to item 46. Section 55 An immune cell comprising the vector described in item 54. Section 56 The immune cell according to item 50, wherein the immune cell is a T cell, a tumor infiltrating lymphocyte (TIL), a NK cell, a TCR-expressing cell, a dendritic cell, or a NK-T cell. Section 57 52. The T cell of clause 51, which is an autologous T cell or an allogeneic T cell. Section 58 1. An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR comprises an antigen binding molecule that specifically binds to CLL-1, and the antigen binding molecule comprises a variable light chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 58, 80 and 102. Section 59 The polynucleotide of Paragraph 58, further comprising an activation domain. Section 60 The polynucleotide of paragraph 59, wherein the activation domain is CD3. Section 61 The polynucleotide of paragraph 60, wherein the CD3 is CD3 zeta. Section 62 The polynucleotide of claim 61, wherein the CD3 zeta comprises the amino acid sequence set forth in SEQ ID NO:9. Section 63 The polynucleotide of Paragraph 58, further comprising a costimulatory domain. Section 64 The costimulatory domain is selected from the group consisting of CD28, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAF FR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD 11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITG B7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT 64. The polynucleotide of claim 63, which is a signaling region of AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, a ligand that specifically binds to CD83, or any combination thereof. Section 65 The polynucleotide of paragraph 64, wherein the CD28 costimulatory domain comprises the nucleotide sequence set forth in SEQ ID NO:3 or SEQ ID NO:1. Section 66 An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen-binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 17), CDR2 (SEQ ID NO: 18) and CDR3 (SEQ ID NO: 19), and the light chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 22), CDR2 (SEQ ID NO: 23) and CDR3 (SEQ ID NO: 24). Section 67 An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen-binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 51), CDR2 (SEQ ID NO: 52) and CDR3 (SEQ ID NO: 53), and the light chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 56), CDR2 (SEQ ID NO: 57) and CDR3 (SEQ ID NO: 58). Section 68 An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen-binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 73), CDR2 (SEQ ID NO: 74) and CDR3 (SEQ ID NO: 75), and the light chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 78), CDR2 (SEQ ID NO: 79) and CDR3 (SEQ ID NO: 80). Section 69 An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) comprising an antigen-binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 95), CDR2 (SEQ ID NO: 96) and CDR3 (SEQ ID NO: 97), and the light chain of the antigen-binding molecule comprises CDR1 (SEQ ID NO: 100), CDR2 (SEQ ID NO: 101) and CDR3 (SEQ ID NO: 102). Section 70 An isolated polynucleotide encoding a chimeric antigen receptor (CAR) or a T cell receptor (TCR) comprising an antigen-binding molecule that specifically binds to CLL-1, the antigen-binding molecule comprising: (a) Amino acid sequence GX 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 (SEQ ID NO: 134) (wherein X 2 is G, F or Y, X 3 is S or T, X 4 is I, F or L, X 5 is S or T, X 6 is absent or is S, X 7 is absent or is G, X 8 is absent or is E or G, X 9 a heavy chain variable region (VH) complementarity determining region (CDR) 1 comprising: (b) Amino acid sequence X 1 X 2 X 3 X 4 X 5 X 6 (SEQ ID NO: 135) (wherein X 1 is D, H, S or Y; X 2 is H, P or Y; X 3 is D, E or S, X 4 is D or G, X 5 is G or S, X 6 a heavy chain variable region (VH) complementarity determining region (CDR) 2 comprising: (c) Amino acid sequence X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 DY (SEQ ID NO: 136), X 1 is E or L, X 2 is R, S or V; X 3 is R or Y, X 4 is C, G or S, X 5 is absent or is G or I, X 6 is absent or is G, X 7 is absent or is D, X 8 is absent or is C, X 9 is absent or is W or Y; X 10 is absent or is P or S, X 11 is absent or is G or Y; X 12 a heavy chain variable region (VH) complementarity determining region (CDR) 3 comprising: (d) amino acid sequence X 1 ASQX 5 X 6 X 7 X 8 X 9 LX 11 (SEQ ID NO: 137) (wherein X 1 is Q or R, X 5 is D or S, X 6 is I or V, X 7 is N or S, X 8 is N or S, X 9 is F, L or Y; X 11 is N or T), (e) amino acid sequence X 1 ASX 4 X 5 X 6 X 7 (SEQ ID NO: 138) (wherein X 1 is D or G, X 4 is N, S or T, X 5 is L or R, X 6 is A, E or K, X 7 is S or T), and / or (f) Amino acid sequence QQX 3 X 4 X 5 X 6 PX 8 T (SEQ ID NO: 139), X 3 is S or Y, X 4 is D, G or Y; X 5 is N, S or T, X 6 is L, T or Y; X 8 is F or I), 2. An isolated polynucleotide comprising: Section 71 A method of treating a disease or disorder in a subject in need thereof, comprising administering to the subject a polynucleotide according to paragraph 46, 58, 66, 67, 68, 69 or 70. Section 72 A method for treating a disease or disorder in a subject in need thereof, comprising administering to the subject the polypeptide of paragraph 40. Section 73 27. A method for treating a disease or disorder in a subject in need thereof, comprising administering to the subject a chimeric antigen receptor according to any one of items 1, 20, 21 and 23. Section 74 A method for treating a disease or disorder in a subject in need thereof, comprising administering to the subject a cell according to any one of paragraphs 16, 29, 36, 43 and 55. Section 75 A method for treating a disease or disorder in a subject in need thereof, comprising administering to the subject the composition according to paragraph 22 or 33. Section 76 76. The method according to any one of items 71 to 75, wherein the disease or disorder is cancer. Section 77 77. The method of claim 76, wherein the cancer is leukemia, lymphoma or myeloma. Section 78 76. The method according to any one of items 71 to 75, wherein the disease or disorder is at least one of acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia, atypical chronic myeloid leukemia, acute promyelocytic leukemia (APL), acute monoblastic leukemia, acute erythroleukemia, acute megakaryoblastic leukemia, myelodysplastic syndrome (MDS), myeloproliferative disorder, myeloid neoplasm, myeloid sarcoma, blastic plasmacytoid dendritic cell neoplasm (BPDCN) and inflammatory / autoimmune disease. Section 79 79. The method of claim 78, wherein the inflammatory / autoimmune disease is at least one of rheumatoid arthritis, psoriasis, allergies, asthma, Crohn's disease, IBD, IBS, fibromyalgia, mastocytosis, and celiac disease. Section 80 Item 16. The lentiviral vector of item 15, comprising pGAR or a derivative thereof. [Brief description of the drawings]

[0055] [Figure 1] FIG. 1 shows CLL-1 expression in various cancer cell lines. [Diagram 2] FIG. 1 shows CLL-1 CAR expression as determined by Protein L 6 hours after mRNA electroporation. [Diagram 3] FIG. 1 shows the results of a cytokine release assay of different CLL-1 CAR-T cell constructs 24 hours after mRNA electroporation. [Figure 4] FIG. 1 shows the cytolytic activity of different CLL-1 CAR-T cell constructs 24 hours after mRNA electroporation. [Diagram 5] FIG. 1 shows the cytolytic activity of different CLL-1 CAR-T cell constructs 24 hours after mRNA electroporation. [Figure 6] FIG. 13 shows CLL-1 CAR expression as determined by Protein L at day 12 post-transduction. [Figure 7] FIG. 1 shows cytokine release assay of CLL-1 CAR-T cells after 16 hours of co-culture with different target cell lines. [Figure 8] FIG. 1 shows the cytolytic activity of CLL-1 CAR-T cells after 16 and 40 hours of co-culture with different target cell lines. [Figure 9A-9D] FIG. 1 shows a sequence alignment of the CLL-1 antigen-binding molecules of the present invention, with the CDRs boxed. [Figure 10] FIG. 1 shows bioluminescence results of NSG mice treated with a CAR according to the present invention. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0056] It will be understood that chimeric antigen receptors (CAR or CAR-T) and T cell receptors (TCR) are genetically modified receptors. These modified receptors can be easily inserted and expressed in immune cells, including T cells, according to techniques known in the art. Using CAR, a single receptor can be programmed to recognize a specific antigen and activate immune cells to attack and destroy cells bearing that antigen when bound to that antigen. If these antigens are present on tumor cells, immune cells expressing CAR can target and kill the tumor cells.

[0057] CARs can be engineered to bind antigens (such as cell surface antigens) by incorporating an antigen-binding molecule that interacts with the target antigen. Preferably, the antigen-binding molecule is an antibody fragment thereof, more preferably one or more single-chain antibody fragments ("scFv"). An scFv is a single-chain antibody fragment that has the variable regions of the heavy and light chains of an antibody linked together. See U.S. Pat. Nos. 7,741,465 and 6,319,494, and Eshhar et al., Cancer Immunol Immunotherapy (1997) 45: 131-136. An scFv retains the ability of the parent antibody to specifically interact with the target antigen. An scFv is preferred for use in chimeric antigen receptors because it can be engineered to be expressed together with other CAR components as part of a single chain (Id.). Krause et al., J. Exp. Med., Volume 188, No. 4, 1998 (619-626), Finney et al., Journal of Immunology, 1998, 161: See also, 2791-2797. It will be understood that an antigen-binding molecule is typically contained in the extracellular portion of the CAR such that it is capable of recognizing and binding to an antigen of interest. Bispecific and multispecific CARs having specificity for two or more targets of interest are contemplated within the scope of the present invention.

[0058] Costimulatory domain Chimeric antigen receptors can incorporate costimulatory (signaling) domains to increase their potency. See U.S. Patent Nos. 7,741,465 and 6,319,494, as well as Krause et al. and Finney et al., supra; Song et al., Blood 119:696-706. (2012), Kalos et al., Sci Transl. Med. 3:95 (2011), Porter et al., N. Engl. J. Med. 365:725-33 (2011), and Gross et al., Annu. Rev. Pharmacol. Toxicol. 56:59-83 (2016). For example, CD28 is a costimulatory protein naturally found on T cells. Although various costimulatory molecules are defined herein, it will be understood that additional costimulatory molecules are also included within the scope of the present invention.

[0059] The complete native amino acid sequence of CD28 is set forth in NCBI Reference Sequence: NP_006130.1. The complete native CD28 nucleic acid sequence is set forth in NCBI Reference Sequence: NM_006139.1.

[0060] Certain CD28 domains were used in chimeric antigen receptors. In accordance with the present invention, it has now been unexpectedly discovered that a novel CD28 extracellular (hinge) construct, designated "CD28T", offers certain advantages when used in CAR constructs. This construct shows the ability to retain (and sometimes exceed) the properties of CD28-containing CARs despite the truncation (removal) of several amino acids from the extracellular CD28 sequence. These advantages include equivalent or superior cytokine production, equivalent or superior cytolytic activity, and / or equivalent or superior CAR expression levels.

[0061] The nucleotide sequence of the CD28T molecule, including the extracellular domain and the CD28 transmembrane and intracellular domains, is set forth below in SEQ ID NO:1: CTTGATAATGAAAAGTCAAACGGAACAATCATTCACGTGAAGGGCAAGCACCTCTGTCCGTCACCCTTGTTCCCTGGTCCATCCAAGCCATTCTGGGTGTTGGTCGTAGTGGGTGGAGTCCTCGCTTGTTACTCTCTGCTCGTCACC GTGGCTTTTATAATCTTCTGGGTTAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGC

[0062] The corresponding amino acid sequence is set forth below in SEQ ID NO:2: LDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSK RSRLLHSDYM NMTPRRPGPT RKHYQPYAPP RDFAAYRS

[0063] The nucleotide sequence of the extracellular portion of CD28T is set forth in SEQ ID NO:3 below: CTTGATAATGAAAAGTCAAACGGAACAATCATTCACGTGAAGGGCAAGCACCTCTGTCCGTCACCCTTGTTCCCTGGTCCATCCAAGCCA

[0064] The corresponding amino acid sequence of the CD28 T extracellular domain is set forth below in SEQ ID NO: 4: LDNEKSNGTI IHVKGKHLCP SPLFPGPSKP

[0065] The nucleotide sequence of the CD28 transmembrane domain is set forth below in SEQ ID NO:5: TTCTGGGTGTTGGTCGTAGTGGGTGGAGTCCTCGCTTGTTACTCTCTGCTCGTCACCGTGGCTTTTATAATCTTCTGGG TT

[0066] The amino acid sequence of the CD28 transmembrane domain is set forth below in SEQ ID NO:6: FWVLVVVGGV LACYSLLVTV AFIIFWV

[0067] The nucleotide sequence of the CD28 intracellular signaling domain is set forth below in SEQ ID NO:7: AGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGC

[0068] The amino acid sequence of the CD28 intracellular signaling domain is set forth below in SEQ ID NO:8: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

[0069] Additional CD28 sequences suitable for use in the present invention include the CD28 nucleotide sequence set forth in SEQ ID NO:11 below: ATTGAGGTGATGTATCCACCGCCTTACCTGGATAACGAAAAGAGTAACGGTACCATCATTCACGTGAAAGGTAAACACCTGTGTCCTTCTCCCCTCTTCCCGGGCCATCAAAGCCC

[0070] The corresponding amino acid sequence is set forth below in SEQ ID NO:12: IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

[0071] It will be understood that the present invention relates to antigen-binding molecules, CARs, TCRs, etc., comprising at least one isolated nucleic acid sequence of SEQ ID NO: 1 or SEQ ID NO: 3. It will further be understood that the present invention relates to antigen-binding molecules, CARs, TCRs, etc., whose extracellular portion consists of at least one isolated nucleic acid sequence of SEQ ID NO: 1 or SEQ ID NO: 3. Additionally, it will be understood that the present invention relates to antigen-binding molecules, CARs, TCRs, etc., whose extracellular portion consists essentially of at least one isolated nucleic acid sequence of SEQ ID NO: 1 or SEQ ID NO: 3.

[0072] It will be understood that the present invention relates to antigen-binding molecules, CARs, TCRs etc., which comprise at least one amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 4. It will further be understood that the present invention relates to antigen-binding molecules, CARs, TCRs etc., whose extracellular portion consists of at least one amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 4. It will also be understood that the present invention relates to antigen-binding molecules, CARs, TCRs etc., whose extracellular portion consists essentially of at least one amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 4.

[0073] Another suitable source of the extracellular and / or transmembrane domain can be derived from (or correspond to) part or all of CD8. The nucleotide sequence of a suitable CD8 extracellular and transmembrane domain is set forth below in SEQ ID NO: 13: GCTGCAGCATTGAGCAACTCAATAATGTATTTTAGTCACTTTGTACCAGTGTTCTTGCCGGCTAAGCCTACTACCACACCCGCTCCACGGCCACCTACCCCAGCTCCTACCATCGCTTCACAGCCTCTGTCCCTGCGCCCAGAG GCTTGCCGACCGGCCGCAGGGGGCGCTGTTCATACCAGAGGACTGGATTTCGCCTGCGATATCTATATCTGGGCACCCCTGGCCGGAACCTGCGGCGTACTCCTGCTGTCCCTGGTCATCACGCTCTATTGTAATCACAGGAAC

[0074] The corresponding amino acid sequence is set forth below in SEQ ID NO: 14: AAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN

[0075] Suitable costimulatory domains within the scope of the present invention include, for example, CD28, CD28T, OX40, 4-1BB / CD137, CD2, CD3 (alpha, beta, delta, epsilon, gamma, zeta), CD4, CD5, CD7, CD9, CD16, CD22, CD27, CD30, CD33, CD37, CD40, CD45, CD64, CD80, CD86, CD134, CD137, CD154, PD-1, ICOS, lymphoid leukocyte function-associated antigen-1 (LFA-1, CD11a / CD18), CD247, CD276 (B7-H3), LIGHT (tumor necrosis factor superfamily member 14; TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF, TNFr, integrins, signaling lymphocyte activation molecule, BTLA, Toll ligand receptor, ICAM-1, B7- H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD4 9f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA -1, ITGB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT It will be understood that the polypeptide may be derived from (or correspond to) AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, CD83 ligand or fragment, or a combination thereof.It will be understood that additional costimulatory molecules or fragments thereof not listed above are within the scope of the present invention.

[0076] Activation domain CD3 is a component of the T cell receptor on natural T cells and has been shown to be a key intracellular activation component in CARs. In a preferred embodiment, the CD3 is CD3 zeta, the nucleotide sequence of which is set forth in SEQ ID NO:9 below: AGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAG GGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG

[0077] The corresponding amino acid sequence of intracellular CD3 zeta is set forth below in SEQ ID NO:10: RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGE RRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

[0078] Domain orientation relative to cells Structurally, it will be understood that the domains described herein correspond to locations on immune cells or other cells. Thus, these domains may be part of (i) the "hinge" or extracellular (EC) domain, (ii) the transmembrane (TM) domain, and / or (iii) the intracellular / cytoplasmic domain (IC). The intracellular component often partially comprises an activation domain, such as a portion of a CD3 family member, preferably CD3 zeta. This domain is capable of activating T cells when the antigen-binding molecule binds to its target. It will be understood that the intracellular domain typically further comprises one or more costimulatory molecules as described herein.

[0079] "Activation" or "stimulation" as used herein refers to the primary response induced by binding of an activating molecule to its cognate ligand, which mediates a signaling event.

[0080] "Activating molecule" or "stimulatory molecule" refers to a molecule on a T cell, e.g., the TCR / CD3 complex, that specifically binds to a cognate stimulatory ligand present on an antigen presenting cell. Suitable activating molecules are described herein.

[0081] As used herein, a "costimulatory molecule" refers to a molecule that produces a signal that mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, etc. A costimulatory molecule can produce a signal in addition to the primary signal produced by an activation molecule as described herein.

[0082] Suitable costimulatory molecules include CD28, CD28T, OX40, 4-1BB / CD137, CD2, CD3 (alpha, beta, delta, epsilon, gamma, zeta), CD4, CD5, CD7, CD9, CD16, CD22, CD27, CD30, CD33, CD37, CD40, CD45, CD64, CD80, CD86, CD134, CD137, CD154, PD-1, ICOS, lymphocyte function-associated antigen (IL-1), and / or IL-2. hara-1 (LFA-1, CD11a / CD18), CD247, CD276 (B7-H3), LIGHT (tumor necrosis factor superfamily member 14; TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF, TNFr, integrin, signaling lymphocyte activation molecule, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1 , ITGB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT These include, but are not limited to, all or a portion of AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, CD83 ligand or fragment, or a combination thereof.The hinge region may comprise part or all of an immunoglobulin family member such as IgG1, IgG2, IgG3, IgG4, IgA, IgD, IgE, IgM, or fragments thereof. It will be understood that.

[0083] In some embodiments, the extracellular domain is located between the antigen binding molecule and the transmembrane domain.

[0084] Exemplary CAR constructs according to the invention are provided in Table 1.

[0085] [Table 1]

[0086] As discussed above, the modified T cells of the present invention comprise an antigen-binding molecule (such as an scFv), an extracellular domain (which may include a "hinge" domain), a transmembrane domain, and an intracellular domain. The intracellular domain may at least partially comprise an activation domain, and may preferably be composed of a CD3 family member, such as CD3 zeta, CD3 epsilon, CD3 gamma, or a portion thereof.

[0087] It will further be appreciated that the antigen binding molecule (e.g., one or more scFvs) is engineered to be located on the extracellular portion of the molecule / construct such that it is capable of recognizing and binding to its target(s).

[0088] Extracellular domain Extracellular domains of particular use in the present invention include those derived from CD28, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecules, TNF receptor proteins, immunoglobulin proteins, cytokine receptors, integrins, signaling lymphocyte activation molecule (SLAM), and the like. protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD1 1c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, a ligand that specifically binds to CD83, or any combination thereof. The extracellular domain may be derived from either natural or synthetic sources.

[0089] The extracellular domain often includes a hinge portion, which may be referred to as a "spacer" region. A variety of hinges, including portions or derivatives of the molecules described herein, can be used in accordance with the present invention.

[0090] In certain embodiments, the hinge region comprises an amino acid sequence that is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identical to the amino acid sequence of the extracellular domain defined herein.

[0091] In certain embodiments, the hinge region comprises an amino acid sequence that is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% identical to the amino acid sequence of an extracellular nucleotide defined herein.

[0092] Transmembrane domain CARs can be designed with a transmembrane domain fused to the extracellular domain of the CAR. This may also be fused to the intracellular domain of the CAR. In some cases, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domain to the transmembrane domain of the same or different surface membrane protein and to minimize interaction with other members of the receptor complex. The transmembrane domain can be derived from either natural or synthetic sources. If the source is natural, the domain can be derived from any membrane-bound or transmembrane protein. Extracellular domains of particular use in the present invention include CD28, CD28T, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7 -H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D , ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, IT GB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4) , CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, a ligand that specifically binds CD83, or any combination thereof.

[0093] Optionally, a short linker may form the link between any or some of the extracellular, transmembrane and intracellular domains of the CAR.

[0094] In other embodiments, the transmembrane domain in the CAR of the invention is a CD8 transmembrane domain. In one embodiment, the CD8 transmembrane domain comprises the transmembrane portion of the nucleic acid sequence of SEQ ID NO: 13. In another embodiment, the CD8 transmembrane domain comprises a nucleic acid sequence encoding the transmembrane amino acid sequence contained in SEQ ID NO: 14.

[0095] In certain embodiments, the transmembrane domain in the CAR of the present invention is a CD28 transmembrane domain. In one embodiment, the CD28 transmembrane domain comprises the nucleic acid sequence of SEQ ID NO: 5. In one embodiment, the CD28 transmembrane domain comprises a nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 6. In another embodiment, the CD28 transmembrane domain comprises the amino acid sequence of SEQ ID NO: 6.

[0096] Intracellular (cytoplasmic) domain The intracellular (cytoplasmic) domain of the modified T cells of the invention can result in activation of at least one of the normal effector functions of an immune cell, which may refer to cytolytic or helper activity, including, for example, secretion of cytokines.

[0097] Suitable intracellular molecules include CD28, CD28T, OX-40, 4-1BB / CD137, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function associated antigen-1 (LFA-1, CD11a / CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, B AFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, C D11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, IT GB7, NKG2D, TNFR2, TRANCE / RANKL, DNAM1(CD226), SLAMF4(CD244, 2B4), CD84, CD96(Tactile), CEACAM1, CRT A ligand that specifically binds to AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, CD83, or any combination thereof (or corresponding thereto). It will be understood that the term "protein" includes (ie, comprises) but is not limited to signal transduction domains.

[0098] In a preferred embodiment, the intracellular / cytoplasmic domain of the CAR can be designed to include the CD3 zeta domain itself or can be combined with any other desired intracellular domain(s) useful in the context of the CAR of the invention. For example, the intracellular domain of the CAR can include a CD3 zeta chain portion and a portion of a costimulatory signaling molecule. The intracellular signaling sequences of the intracellular signaling portion of the CAR of the invention can be linked together randomly or in a specified order.

[0099] In another preferred embodiment, the intracellular domain is designed to comprise the activation domain of CD3 zeta and the signaling domain of CD28. In another embodiment, the intracellular domain is designed to comprise the activation domain of CD3 zeta and the signaling domain of 4-1BB. In another embodiment, the intracellular domain in the CAR is designed to comprise a portion of CD28 and CD3 zeta, where the intracellular CD28 comprises the nucleic acid sequence set forth in SEQ ID NO: 7 and the amino acid sequence set forth in SEQ ID NO: 8. The CD3 zeta nucleic acid sequence is set forth in SEQ ID NO: 9 and the amino acid sequence is set forth in SEQ ID NO: 8.

[0100] It will be appreciated that one preferred orientation of a CAR according to the present invention comprises an antigen binding molecule (such as an scFv) together with an extracellular and / or hinge domain, a costimulatory domain and an activation domain. It will be further appreciated that multiple domains can be utilized together.

[0101] In some embodiments, an isolated nucleic acid is provided that includes a promoter operably linked to an antigen binding molecule, at least one costimulatory molecule, and a first polynucleotide encoding an activation domain. In some embodiments, the nucleic acid construct is contained in a viral vector. In some embodiments, the viral vector is selected from the group consisting of a retroviral vector, a murine leukemia virus vector, a SFG vector, an adenoviral vector, a lentiviral vector, an adeno-associated virus (AAV) vector, a herpes virus vector, and a vaccinia virus vector. In some embodiments, the nucleic acid is contained in a plasmid.

[0102] In some embodiments, the engineered immune cells are T cells, tumor infiltrating lymphocytes (TIL), NK cells, TCR expressing cells, dendritic cells, or NK-T cells. In some embodiments, the cells are obtained or prepared from peripheral blood. In some embodiments, the cells are obtained or prepared from peripheral blood mononuclear cells (PBMC). In some embodiments, the cells are obtained or prepared from bone marrow. In some embodiments, the cells are obtained or prepared from umbilical cord blood. In some embodiments, the cells are human cells. In some embodiments, the cells are transfected or transduced with a nucleic acid vector using a method selected from the group consisting of electroporation, sonoporation, biolistics (e.g., gene guns), lipid transfection, polymer transfection, nanoparticles, or polyplexes.

[0103] In some embodiments, chimeric antigen receptors are expressed in engineered immune cells comprising the nucleic acids of the present application. These chimeric antigen receptors of the present application may, in some embodiments, comprise (i) an antigen binding molecule (such as an scFv), (ii) a transmembrane domain, and (iii) a T cell activation molecule or domain.

[0104] Whenever embodiments are described herein with the words "comprising," the words "consisting of" and / or "consisting essentially of" may also be used. Other similar embodiments are also provided which are described in terms of "consisting essentially of." It is further understood that.

[0105] Additionally, the terms "about" or "comprising essentially of" are intended to provide an acceptable range for a particular value or composition as determined by one of ordinary skill in the art. Refers to a value or composition that falls within a margin of error, depending in part on how the value or composition is measured or specified, i.e., the limitations of the measurement system. For example, "about" or "essentially comprising" can mean within 1 or more than 1 standard deviation per one practice in the art. Alternatively, "about" or "essentially comprising" can mean a range of up to 10% (i.e., ±10%). For example, about 3 mg can include any value between 2.7 mg and 3.3 mg (at 10%). Moreover, particularly with respect to biological systems or processes, the terms can mean up to an order of magnitude or up to 5 times a value. A particular value or When compositions are provided in this application and claims, unless otherwise indicated, the meaning of "about" or "essentially comprising" should be taken to include an acceptable error range for that particular value or composition.

[0106] antigen binding molecule Antigen binding molecules are within the scope of the present invention. As used herein, "antigen binding molecule" refers to any protein that binds a designated target antigen. In the present application, the designated target antigen is the CLL-1 protein or a fragment thereof. Antigen binding molecules include, but are not limited to, antibodies and binding portions thereof, such as immunologically functional fragments. Peptibodies (i.e., Fc fusion molecules containing a peptide binding domain) are preferred. Another example of an antigen-binding molecule.

[0107] In certain embodiments, the present invention provides a method for producing a composition comprising: (a) the amino acid sequence GX2X3X4X5X6X7X8X9 (SEQ ID NO: 134), where X2 is G, F, or Y; X3 is S or T; X4 is I, F or L; X5 is S or T; X6 is absent or is S; X7 is absent or is G; X8 is absent, E or G; (b) a heavy chain variable region (VH) complementarity determining region (CDR) 1 comprising the amino acid sequence X1X2X3X4X5X6 (SEQ ID NO: 135), wherein X9 is F, L, or Y; X1 is D, H, S or Y; X2 is H, P or Y; X3 is D, E or S; X4 is D or G; X5 is G or S; X6 is absent or is D or E), (c) Amino acid sequence X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 DY (SEQ ID NO: 136), X1 is E or L; X2 is R, S or V; X3 is R or Y; X4 is C, G or S; X5 is absent, G or I; X6 is absent or is G; X7 is absent or is D; X8 is absent or is C; X9 is absent, W or Y; X 10 is absent or is P or S, X 11 is absent or is G or Y; X12 a heavy chain variable region (VH) complementarity determining region (CDR) 3 comprising: (d) Amino acid sequence X1ASQX5X6X7X8X9LX 11 (SEQ ID NO: 137) (wherein X1 is Q or R; X5 is D or S; X6 is I or V; X7 is N or S; X8 is N or S; X9 is F, L or Y; X 11 is N or T), (e) the amino acid sequence X1ASX4X5X6X7 (SEQ ID NO: 138), X1 is D or G; X4 is N, S or T; X5 is L or R; X6 is A, E or K; and / or a light chain variable region (VL) CDR2 comprising: (f) the amino acid sequence QQX3X4X5X6PX8T (SEQ ID NO: 139), X3 is S or Y; X4 is D, G or Y; X5 is N, S or T; X6 is L, T or Y; X8 is F or I), The present invention relates to an antigen-binding molecule comprising:

[0108] In some embodiments, the present invention provides a method for producing a pharmaceutical composition comprising: (a) a variable heavy chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 17, 51, 73, 95, 5 and 97; (b) a variable heavy chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 52, 74, 96; (c) a variable heavy chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 53, 75 and 97; (d) a variable light chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22, 56, 78 and 100; (e) a variable light chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 23, 57, 79 and 101; (f) a variable light chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 58, 80 and 102; The present invention relates to an antigen-binding molecule comprising at least one of the following:

[0109] In another embodiment, the present invention provides (a) a VH region comprising the amino acid sequence of SEQ ID NO: 16 and a VL region comprising the amino acid sequence of SEQ ID NO: 21; (b) a VH region comprising the amino acid sequence of SEQ ID NO: 50 and a VL region comprising the amino acid sequence of SEQ ID NO: 55; (c) a VH region comprising the amino acid sequence of SEQ ID NO: 72 and a VH region comprising the amino acid sequence of SEQ ID NO: 77 The VL region, (d) a VH region comprising the amino acid sequence of SEQ ID NO: 94 and a VL region comprising the amino acid sequence of SEQ ID NO: 99; wherein the VH and VL domain(s) are linked by at least one linker. In another embodiment, the present invention relates to antigen binding molecules (and chimeric antigen receptors comprising these molecules), wherein the linker comprises at least one of SEQ ID NO: 130 and SEQ ID NO: 132.

[0110] In a further embodiment, the present invention provides a variable light (V L ) chain CDR3.

[0111] In another embodiment, the present invention relates to an isolated polynucleotide encoding an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 17), CDR2 (SEQ ID NO: 18) and CDR3 (SEQ ID NO: 19) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 22), CDR2 (SEQ ID NO: 23) and CDR3 (SEQ ID NO: 24).

[0112] In another embodiment, the present invention relates to an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 51), CDR2 (SEQ ID NO: 52) and CDR3 (SEQ ID NO: 53) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 56), CDR2 (SEQ ID NO: 57) and CDR3 (SEQ ID NO: 58).

[0113] In another embodiment, the present invention relates to an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 73), CDR2 (SEQ ID NO: 74) and CDR3 (SEQ ID NO: 75) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 78), CDR2 (SEQ ID NO: 79) and CDR3 (SEQ ID NO: 80).

[0114] In another embodiment, the present invention relates to an isolated polynucleotide encoding an antigen binding molecule that specifically binds to CLL-1, wherein the heavy chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 95), CDR2 (SEQ ID NO: 96) and CDR3 (SEQ ID NO: 97) and the light chain of the antigen binding molecule comprises CDR1 (SEQ ID NO: 100), CDR2 (SEQ ID NO: 101) and CDR3 (SEQ ID NO: 102).

[0115] In certain embodiments, the present invention relates to isolated polynucleotides encoding anti-CLL-1 antigen-binding molecules that cross-compete with one or more of the antibodies or antigen-binding molecules thereof described herein, which are encoded by polynucleotides. In one embodiment, the present invention relates to isolated polynucleotides encoding anti-CLL-1 antigen-binding molecules that bind to the same epitope as one or more of the antigen-binding molecules described herein.

[0116] In some embodiments, the antigen binding molecule binds to an antigen on a tumor cell. In some embodiments, the antigen binding molecule binds to an antigen on a cell involved in a hyperproliferative disease, or to a viral or bacterial antigen. In further embodiments, the antigen binding molecule is an antibody or a fragment thereof comprising one or more of its complementarity determining regions (CDRs). In further embodiments, the antigen binding molecule is a single chain variable fragment (scFv).

[0117] The term "immunofunctional fragment" (or "fragment") of an antigen-binding molecule refers to a portion of an antibody (regardless of how that portion is obtained or synthesized) that lacks at least some of the amino acids present in the full-length chain but is still capable of specifically binding to an antigen. The fragments are antigen-binding molecule species that contain a CDR that is not a CDR of the full-length light or heavy chain, and in some embodiments, a single heavy and / or light chain or a portion thereof. Such fragments are biologically active in that they can bind to a target antigen and compete with other antigen-binding molecules, including intact antibodies, for binding to a given epitope. In some embodiments, the fragments are neutralizing fragments. In some embodiments, the fragments can block or reduce the activity of CLL-1. In one aspect, such fragments retain at least one CDR present in a full-length light or heavy chain, and in some embodiments, contain a single heavy and / or light chain or a portion thereof. These fragments can be produced by recombinant DNA methods or by enzymatic or chemical cleavage of antigen-binding molecules, including intact antibodies.

[0118] Immune function immunoglobulin fragments include scFv fragments, Fab fragments (Fab', F(ab')2, etc.), one or more CDRs, diabodies, etc. Antigen-binding molecules include, but are not limited to, heavy chain variable domains on the same polypeptide (light chain variable domains connected via a short peptide linker that is too short to allow pairing between the two domains on the same chain), domain antibodies, and single chain antibodies. These fragments may be derived from any mammalian source, including, but not limited to, human, mouse, rat, camelid, or rabbit. As will be appreciated by those skilled in the art, antigen-binding molecules may also contain non-proteinaceous components.

[0119] Variants of antigen-binding molecules, such as variable light chains and / or variable heavy chains each having at least 70%-80%, 80%-85%, 85%-90%, 90%-95%, 95%-97%, 97%-99% or more than 99% identity to the amino acid sequence of the sequence described herein, are also within the scope of the present invention. In some cases, such molecules contain at least one heavy chain and one light chain, while in other cases, the variant forms contain two identical light chains and two identical heavy chains (or subparts thereof). Those skilled in the art can determine suitable variants of the antigen-binding molecules defined herein using known techniques. In certain embodiments, those skilled in the art can identify suitable sites of the molecule that can be altered without destroying activity by targeting regions believed not to be important for activity.

[0120] In certain embodiments, the polypeptide structure of the antigen-binding molecule is based on an antibody, including, but not limited to, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates"), and fragments thereof. In some embodiments, the antigen-binding molecule comprises or consists of avimers.

[0121] In some embodiments, the antigen binding molecule against CLL-1 is administered as part of a CAR, TCR or other immune cell. In such immune cells, the antigen binding molecule against CLL-1 may be under the control of the same promoter region or a separate promoter. In certain embodiments, the genes encoding the protein agents and / or the antigen binding molecule against CLL-1 may be in separate vectors.

[0122] The present invention further provides a pharmaceutical composition comprising an antigen binding molecule for CLL-1 together with a pharma- ceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and / or adjuvant. In certain embodiments, the pharmaceutical composition comprises two or more different antigen binding molecules for CLL-1. In certain embodiments, the pharmaceutical composition comprises two or more antigen binding molecules for CLL-1, and the antigen binding molecules for CLL-1 bind two or more epitopes. In some embodiments, the various antigen binding molecules do not compete with each other for binding to CLL-1.

[0123] In other embodiments, the pharmaceutical composition may be selected for parenteral delivery, inhalation, or delivery via the digestive tract, such as orally. Preparation of such pharmaceutically acceptable compositions is within the capabilities of one of ordinary skill in the art. In certain embodiments, a buffer is used to maintain the composition at physiological pH or a slightly lower pH, typically in the pH range of about 5 to about 8. In certain embodiments, when parenteral administration is contemplated, the therapeutic composition may be in the form of a pyrogen-free parenterally acceptable aqueous solution containing the desired antigen-binding molecule against CLL-1, with or without additional therapeutic agents, in a pharmaceutically acceptable vehicle. In certain embodiments, the vehicle for parenteral injection is sterile distilled water, with or without at least one additional therapeutic agent, in which the antigen-binding molecule against CLL-1 is formulated as a sterile, isotonic solution in which it is appropriately preserved. In certain embodiments, preparations include combining the desired molecule with polymeric compounds (such as polylactic acid or polyglycolic acid), beads, or liposomes, which can provide a controlled or sustained release of the product that can then be delivered by depot injection. In certain embodiments, implantable drug delivery devices can be used to introduce the desired molecule.

[0124] In some embodiments, the antigen binding molecules are used as diagnostic or validation tools. The antigen binding molecules can be used to assay the amount of CLL-1 present in a sample and / or a subject. In some embodiments, the diagnostic antigen binding molecules are not neutralizing. In some embodiments, the antigen binding molecules disclosed herein are used or provided in assay kits and / or methods for detecting CLL-1 in mammalian tissues or cells to screen / diagnose diseases or disorders associated with altered CLL-1 levels. The kit may include an antigen binding molecule that binds CLL-1 together with a means for indicating binding of the antigen binding molecule to CLL-1, if present, and optionally CLL-1 protein levels.

[0125] Antigen-binding molecules are further understood in view of the following definitions and explanations.

[0126] The "Fc" region comprises two heavy chain fragments comprising the CH1 and CH2 domains of an antibody, held together by two or more disulfide bonds and hydrophobic interactions of the CH3 domain.

[0127] A "Fab fragment" contains one light chain and one heavy chain CH1 and variable region. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. A "Fab' fragment" contains one light chain and a portion of one heavy chain containing the VH domain and the CH1 domain, as well as the region between the CH1 and CH2 domains, and an interchain disulfide bond can be formed between the two heavy chains of the two Fab' fragments to form a F(ab')2 molecule. A "F(ab')2 fragment" contains two light chains and two heavy chains containing a portion of the constant region between the CH1 and CH2 domains, and an interchain disulfide bond is formed between the two heavy chains. Thus, a F(ab')2 fragment is composed of two Fab' fragments linked by disulfide bonds between the two heavy chains.

[0128] The "Fv region" comprises the variable regions from both the heavy and light chains, but lacks the constant regions.

[0129] "Single-chain variable fragment" ("scFv"; also referred to as "single-chain antibody") refers to an Fv molecule in which heavy and light chain variable regions are connected by a flexible linker to form a single polypeptide chain, forming an antigen-binding region. See PCT Application WO 88 / 01649, and U.S. Pat. Nos. 4,946,778 and 5,260,203, the disclosures of which are incorporated herein by reference in their entireties.

[0130] A "bivalent antigen-binding molecule" comprises two antigen-binding sites. The sites have the same antigen specificity. A bivalent antigen-binding molecule may be bispecific. A "multispecific antigen-binding molecule" is one that targets more than one antigen or epitope. "Bispecific," "dual-specific," or "bifunctional" antigen-binding molecules are hybrid antigen-binding molecules or antibodies that each have two different antigen-binding sites. The two binding sites of a bispecific antigen-binding molecule bind to two different epitopes that may be present on the same or different protein targets.

[0131] Antigen-binding molecules have a dissociation constant (K d ) is about 1×10 -7 An antigen-binding molecule is said to "specifically bind" to its target antigen when the d is 1×10 -9 M~5×10 -9 "High affinity" when M, "High affinity" when K d is 1×10 -10 M~5×10 -10 In one embodiment, the antigen-binding molecule specifically binds an antigen with "very high affinity" when M is 10 -9 K of M d In one embodiment, the off-rate is 1×10 -5 In other embodiments, the antigen-binding molecule is less than about 10 -7 M ~ about 10 -13 K of M d and in yet another embodiment, the antigen binding molecule binds to human CLL-1 at 1.0×10 -10 ~5×10 -10 K d Combine with.

[0132] In some embodiments, an antibody or antigen binding molecule of the invention specifically binds CLL-1 (e.g., hCLL-1). In certain embodiments, an anti-CLL-1 antibody or antigen binding molecule of the invention specifically binds human CLL-1 at a concentration of 1×10 -6 Less than M, 1×10 -7 Less than M, 1×10 -8 Less than M or 1×10 -9 K less than MD In one specific embodiment, the anti-CLL-1 antibody or antigen binding molecule binds human CLL-1 at 1×10 -7 K less than M D In another embodiment, the anti-CLL-1 antibody or antigen binding molecule binds human CLL-1 at 1×10 -8 K less than M D In some embodiments, the anti-CLL-1 antibody or antigen binding molecule binds human CLL-1 at about 1×10 -7 M, approx. 2 x 10 -7 M, about 3 x 10 -7 M, approx. 4 x 10 -7 M, about 5 x 10 -7 M, about 6 x 10 -7 M, about 7 x 10 -7 M, about 8 x 10 -7 M, about 9 x 10 -7 M, about 1 x 10 -8 M, approx. 2 x 10 -8 M, about 3 x 10 -8 M, approx. 4 x 10 -8 M, about 5 x 10 -8 M, about 6 x 10 -8 M, about 7 x 10 -8 M, about 8 x 10 -8 M, about 9 x 10 -8 M, about 1 x 10 -9 M, approx. 2 x 10 -9 M, about 3 x 10 -9 M, approx. 4 x 10 -9 M, about 5 x 10 -9 M, about 6 x 10 -9 M, about 7 x 10 -9 M, about 8 x 10 -9 M, about 9 x 10 -9 M, about 1 x 10 -10 M or approx. 5 x 10 -10 K of M D In certain embodiments, K D k off / k on It is calculated from the quotient of k on and k off is determined using a monovalent antibody, such as a Fab fragment, as measured, for example, by BIAcore™ surface plasmon resonance technology. D koff / k on It is calculated from the quotient of k on and k off is identified using bivalent antibodies, such as Fab fragments, as measured, for example, by BIAcore™ surface plasmon resonance technology.

[0133] In another embodiment, the anti-CLL-1 antibody or antigen binding molecule comprises 1×10 -9 Less than M, 3 x 10 -9 Less than M, 5×10 -9 Less than M, 1×10 -10 Less than M, 3 x 10 -10 Less than M or 5 x 10 -10 K less than M D In another embodiment, the anti-CLL-1 antibody or antigen binding molecule binds cyno CLL-1-Fc at 1×10 -5 Less than M, 1×10 -6 Less than M, 1×10 -7 Less than M, 1×10 -8 Less than M, 1×10 -9 Less than M or 1×10 -10 K less than M D Combine with.

[0134] In some embodiments, the anti-CLL-1 antibody or antigen binding molecule comprises 1×10 human CLL-1 -4 M -1 s -1 Less than 2×10 -4 M -1 s -1 Less than 3×10 -4 M -1 s -1 Less than 4×10 -4 M -1 s -1 Less than 5×10 -4 M -1 s -1 Less than 6×10 -4 M -1 s -1 Less than 7×10 -4 M -1 s -1 Less than 8×10 -4 M -1 s -1Less than 9×10 -4 M -1 s -1 Less than 1×10 -5 M -1 s -1 Less than 2×10 -5 M -1 s -1 Less than 3×10 -5 M -1 s -1 Less than 4×10 -5 M -1 s -1 Less than 5×10 -5 M -1 s -1 Less than 6×10 -5 M -1 s -1 Less than 7×10 -5 M -1 s -1 Less than 8×10 -5 M -1 s -1 Less than 9×10 -5 M -1 s -1 Less than 1×10 -6 M -1 s -1 Less than 2×10 -6 M -1 s -1 Less than 3×10 -6 M -1 s -1 Less than 4×10 -6 M -1 s -1 Less than 5×10 -6 M -1 s -1 Less than 6×10 -6 M -1 s -1 Less than 7×10 -6 M -1 s -1 Less than 8×10 -6 M -1 s -1 Less than 9×10 -6 M -1 s -1 Less than or 1 x 10 -7 M -1 s -1 Association rate (k onIn certain embodiments, k on is determined using a monovalent antibody, such as a Fab fragment, as measured, for example, by BIAcore™ surface plasmon resonance technology. on is identified using bivalent antibodies, as measured, for example, by BIAcore™ surface plasmon resonance technology.

[0135] In some embodiments, the anti-CLL-1 antibody or antigen binding molecule comprises 1×10 human CLL-1 -2 s -1 Less than 2×10 -2 s -1 Less than 3×10 -2 s -1 Less than 4×10 -2 s -1 Less than 5×10 -2 s -1 Less than 6×10 -2 s -1 Less than 7×10 -2 s -1 Less than 8×10 -2 s -1 Less than 9×10 -2 s -1 Less than 1×10 -3 s -1 Less than 2×10 -3 s -1 Less than 3×10 -3 s -1 Less than 4×10 -3 s -1 Less than 5×10 -3 s -1 Less than 6×10 -3 s -1 Less than 7×10 -3 s -1 Less than 8×10 -3 s -1 Less than 9×10 -3 s -1 Less than 1×10 -4 s -1 Less than 2×10 -4 s -1 Less than 3×10 -4 s -1 Less than 4×10 -4 s -1 Less than 5×10-4 s -1 Less than 6×10 -4 s -1 Less than 7×10 -4 s -1 Less than 8×10 -4 s -1 Less than 9×10 -4 s -1 Less than 1×10 -4 s -1 Less than or 5 x 10 -4 s -1 Dissociation rate (k off In certain embodiments, k off is determined using a monovalent antibody, such as a Fab fragment, as measured, for example, by BIAcore™ surface plasmon resonance technology. off is identified using bivalent antibodies, as measured, for example, by BIAcore™ surface plasmon resonance technology.

[0136] An antigen-binding molecule is said to be "selective" if it binds to one target more tightly than it binds to a second target.

[0137] The term "antibody" refers to an intact immunoglobulin of any isotype, or a fragment thereof that can compete with the intact antibody for specific binding to a target antigen, including, for example, chimeric, humanized, fully human, and bispecific antibodies. An "antibody" is an antigen-binding molecule species as defined herein. An intact antibody generally comprises at least two full-length heavy chains and two full-length light chains, but in some cases may comprise fewer chains, such as antibodies naturally occurring in camelids, which may comprise only heavy chains. An antibody may be derived from only a single source, or may be chimeric, i.e., different portions of the antibody may be derived from two different antibodies, as further described below. Antigen-binding molecules, antibodies, or binding fragments may be produced in hybridomas, by recombinant DNA methods, or by enzymatic or chemical cleavage of intact antibodies. Unless otherwise specified, the term "antibody" includes antibodies comprising two full-length heavy chains and two full-length light chains, as well as derivatives, variants, fragments, and muteins thereof, examples of which are described below. Additionally, unless expressly excluded, antibodies include monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates"), and each of the fragments thereof.

[0138] Variable regions typically exhibit the same overall structure of relatively conserved framework regions (FRs) joined by three hypervariable regions (i.e., "CDRs"). The CDRs from the two chains of each pair are typically aligned by the framework regions, enabling binding to a specific epitope. From the N-terminus to the C-terminus, both the light and heavy chain variable regions typically have a domain The CDR regions of the heavy chain include CDR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. By convention, the CDR regions of the heavy chain are commonly referred to as HC CDR1, CDR2 and CDR3. The CDR regions of the light chain are commonly referred to as LC CDR1, CDR2 and CDR3. The assignment of amino acids to each domain commonly follows the Kabat, Chothia or AbM definitions.

[0139] The term "Kabat numbering" and similar terms are recognized in the art and refer to a system for numbering amino acid residues in the variable regions of the heavy and light chains of an antibody, or antigen-binding portions thereof. In certain embodiments, the CDRs of an antibody can be identified according to the Kabat numbering system (see, e.g., Kabat EA & Wu TT (1971) Ann NY Acad Sci 190: 382-391 and Kabat EA et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, US Department of Health and Human Services, NIH Publication No. 91-3242). Using the Kabat numbering system Using the Kabat numbering system, the CDRs in an antibody heavy chain molecule typically occur at amino acids 31-35 (CDR1), 50-65 (CDR2), and 95-102 (CDR3), which may optionally include one or two additional amino acids following 35 (referred to as 35A and 35B in the Kabat numbering scheme). Using the Kabat numbering system, the CDRs in an antibody light chain molecule typically occur at amino acids 24-34 (CDR1), 50-56 (CDR2), and 89-97 (CDR3). In certain embodiments, the CDRs of the antibodies described herein have been determined according to the Kabat numbering scheme.

[0140] In certain embodiments, the CDRs of an antibody may be identified according to the Chothia numbering scheme, which refers to the location of the structural loops of an immunoglobulin (see, e.g., Chothia C & Lesk AM, (1987), J Mol Biol 196: 901-917; Al-Lazikani B et al., (1997) J Mol Biol 273: 927-948; Chothia C et al., (1992) J Mol Biol 227: 799-817; Tramontano A et al., (1990) J Mol Biol 215(1): 175-82; and U.S. Pat. No. 7,709,226. Typically, using the Kabat numbering convention, the CDR-H1 loop of Chothia is located at amino acids 26-32, 33 or 34 of the heavy chain, the CDR-H2 loop of Chothia is located at amino acids 52-56 of the heavy chain, and the CDR-H3 loop of Chothia is located at amino acids 95-102 of the heavy chain, whereas the CDR-L1 loop of Chothia is located at amino acids 24-34 of the light chain, the CDR-L2 loop of Chothia is located at amino acids 50-56 of the light chain, and the CDR-L3 loop of Chothia is located at amino acids 89-97 of the light chain. The end of the Chothia CDR-HI loop, when numbered using the Kabat numbering convention, varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places insertions at H35A and H35B, i.e., if neither 35A nor 35B are present the loop ends at 32, if only 35A is present the loop ends at 33, and if both 35A and 35B are present the loop ends at 34).

[0141] In certain embodiments, the CDRs of the antibodies described herein are identified according to the Chothia numbering scheme.

[0142] Several definitions of CDRs are in common use: Kabat numbering, Chothia numbering, AbM numbering or contact numbering. The bM definition is a compromise between the two used by Oxford Molecular's AbM antibody modeling software. The contact definition is based on the analysis of available complex crystal structures.

[0143] [Table 2]

[0144] As used herein, the term "heavy chain", when used in reference to an antibody, may refer to any of the different types, e.g., alpha (α), delta (δ), epsilon (ε), gamma (γ) and mu (μ), which give rise to antibodies of the IgA, IgD, IgE, IgG and IgM classes, respectively, including subclasses of IgG, e.g., IgG1, IgG2, IgG3 and IgG4, based on the amino acid sequence of the constant domain.

[0145] As used herein, the term "light chain" when used in reference to an antibody can refer to any of the different types, e.g., kappa (κ) or lambda (λ), based on the amino acid sequence of the constant domain. Light chain amino acid sequences are known in the art. In certain embodiments, the light chain is a human light chain.

[0146] The term "variable region" or "variable domain" typically refers to a portion of an antibody's light and / or heavy chains that comprises approximately the amino-terminal 120-130 amino acids in heavy chains and about 100-110 amino-terminal amino acids in light chains. The variable regions of an antibody typically determine the specificity of a particular antibody for its target.

[0147] The variability is not evenly distributed throughout the variable domains of antibodies or antigen-binding molecules, but is concentrated in sub-domains of each of the heavy and light chain variable regions. These sub-domains are , as further described herein, are called "hypervariable regions" or "complementarity determining regions" (CDRs). The more conserved (i.e., non-hypervariable) portions of the variable domains are called "framework" regions (FRMs or FRs), which provide a scaffold for the six CDRs in three-dimensional space and form the antigen-binding surface. Naturally occurring heavy and light chain variable domains each contain four FRM regions (FR1, FR2, FR3, and FR4) that primarily adopt a β-sheet configuration, connected by three hypervariable regions that form loops that connect, and in some cases form part of, the β-sheet structure. The hypervariable regions of each chain are linked in close proximity by the FRMs to the hypervariable regions of the other chains, contributing to the formation of the antigen-binding site (see Kabat et al., as further described herein).

[0148] Typically, CDRs form loop structures that can be classified into canonical structures. The term "canonical structure" refers to the main-chain conformation adopted by the antigen-binding (CDR) loop. Comparative structural studies have found that five of the six antigen-binding loops have only a limited repertoire of available conformations. Each canonical structure is a polypeptide backbone. The loops can be characterized by the torsion angles of the corresponding antibodies. Thus, loops between corresponding antibodies can have very similar three-dimensional structures, despite the high amino acid sequence variability of most of the loops (Chothia and Lesk, J. MoI. Biol., 1987, 196: 901; Chothia et al., Nature, 1989, 342: 877; Martin and Thornton, J. MoI. Biol, 1996, 263: 800). Moreover, a correlation is observed between the loop structure adopted and the amino acid sequence surrounding it. The conformation of a particular canonical class is determined by the length of the loop and the amino acid residues present at key positions within the loop and within the conserved framework (i.e., outside the loop). Thus, assignment to a particular canonical class can be made based on the presence of these key amino acid residues.

[0149] The term "canonical structure" may also include considerations regarding the linear sequence of an antibody, e.g., as cataloged by Kabat (Kabat et al., herein). The Kabat numbering scheme is a widely adopted standard for numbering the amino acid residues of antibody variable domains in a consistent manner, and is the preferred scheme applied to the present invention, as mentioned elsewhere herein. Additional structural considerations may also be used in determining the canonical structure of an antibody. For example, differences not fully reflected in the Kabat numbering may be accounted for by the numbering system of Chothia et al. and / or revealed by other techniques, e.g., crystallography and two- or three-dimensional computational modeling. Thus, a given antibody sequence may be classified into canonical classes (e.g., 100 to 2000) that allow for the identification of particularly suitable chassis sequences (e.g., 100 to 2000). (e.g., based on a desire to include a variety of canonical structures in the library). The Kabat numbering of antibody amino acid sequences and the structural considerations described by Chothia et al. (herein) and their impact on the interpretation of canonical aspects of antibody structure are described in the literature. The subunit structures and three-dimensional configurations of various classes of immunoglobulins are known in the art. For a general overview of antibody structure, see Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, eds. Harlow et al., 1988.

[0150] The CDR3 of the light chain and especially the CDR3 of the heavy chain may be the most important determinant of antigen binding in the light and heavy chain variable regions. In some antibody constructs, the heavy chain CDR3 appears to constitute the main contact site between antigen and antibody. In vitro selection schemes that vary CDR3 alone can be used to vary the binding properties of the antibody or to determine which residues contribute to antigen binding. Thus, CDR3 is usually the largest source of molecular diversity in the antibody binding site. For example, H3 can be as short as two amino acid residues or larger than 26 amino acids.

[0151] As used herein, the terms "constant region" and "constant domain" are synonymous and have their common meaning in the art. The constant region is the antibody portion, e.g., the carboxyl-terminal portion, of the light and / or heavy chain that is not directly involved in binding the antibody to the antigen but can exhibit various effector functions, such as interaction with Fc receptors. The constant region of an immunoglobulin molecule generally has a more conserved amino acid sequence than the immunoglobulin variable domain.

[0152] "Binding affinity" generally refers to the strength of the total non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless otherwise specified, "binding affinity" as used herein refers to the intrinsic binding affinity that reflects a 1:1 interaction between members of a binding pair (e.g., an antibody and an antigen). The affinity of a molecule X for a partner Y is generally determined by the dissociation constant (K D Affinity can be expressed as the equilibrium dissociation constant (K D ) and the equilibrium association constant (K A ) can be measured and / or expressed in a number of ways known in the art, including, but not limited to, K D k off / k on It is calculated from the quotient of K A k on / k off It is calculated from the quotient of k on For example, The association rate constant of the antibody, koff For example, k refers to the dissociation of an antibody against an antigen. on and k off can be determined by techniques known to those skilled in the art, such as BIAcore™ or KinExA.

[0153] The term "neutralizing" refers to an antigen-binding molecule, scFv, or antibody, respectively, that binds to a ligand and prevents or reduces the biological effect of the ligand. This can be done, for example, by directly blocking a binding site on the ligand, or by binding to the ligand and altering the binding ability of the ligand by indirect means (such as a structural or energetic change in the ligand). In some embodiments, the term can also mean preventing a protein to which the antigen-binding molecule binds from performing a biological function.

[0154] The term "target" or "antigen" refers to a molecule or a portion of a molecule to which an antigen-binding molecule can bind. In certain embodiments, a target may have one or more epitopes.

[0155] The term "compete", when used in the context of competing antigen-binding molecules for the same epitope, refers to competition between the antigen-binding molecules as determined by an assay in which the antigen-binding molecule being tested (e.g., an antibody or an immunologically functional fragment thereof) blocks or inhibits (e.g., reduces) specific binding of the reference antigen-binding molecule to an antigen. Numerous types of competitive binding assays are available, such as solid-phase direct or indirect radioimmunoassays (RIA), solid-phase direct or indirect enzyme immunoassays (EIA), sandwich competition assays (Stahli et al., 1983, Methods in Enzymology 9:242-253); solid-phase direct biotin-avidin EIA (Kirkland et al., 1986, J. Immunol. 137:3614-3619), solid-phase direct label assays, solid-phase direct label sandwich assays (Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid-phase direct label RIA using I-125 label (Morel et al., 1988, Molec. Immunol. 25:7-15); solid-phase direct biotin-avidin EIA (Cheung, et al., 1990, Virology 176:546-552); and direct labeling RIA (Moldenhauer et al., 1990, Scand. J. Immunol. 32:77-82) can be used to determine whether one antigen-binding molecule competes with another antigen-binding molecule.

[0156] As used herein, the term "epitope" refers to a localized region of an antigen to which an antibody can specifically bind. An epitope may be, for example, contiguous amino acids of a polypeptide (linear or contiguous epitope), or an epitope may be, for example, derived from two or more non-contiguous regions of a polypeptide(s) together (conformational, non-linear, discontinuous, or non-contiguous epitope). In certain embodiments, the epitope to which an antibody binds may be identified by, for example, NMR spectroscopy, X-ray diffraction crystallography studies, ELISA assays, hydrogen / deuterium exchange coupled with mass spectrometry (e.g., liquid chromatography electrospray mass spectrometry), array-based oligopeptide scanning assays, and / or mutagenesis mapping (e.g., site-directed mutagenesis mapping). For X-ray crystallography studies, crystallization may be performed using methods known in the art (e.g., Giege R. et al., (1994) Acta Crystallogr D Biol Crystallogr 50(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen NE (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251: 6300-6303). Antibody: Antigen The crystals can be studied using well-known X-ray diffraction techniques, such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see, e.g., Meth Enzymol (1985) volumes 114 & 115, eds Wyckoff HW et al., U.S. Patent Application Publication No. The sequences may be refined using computer software such as RT-PCR (Publication No. 2004 / 0014194), and BUSTER (Bricogne G (1993) Acta Crystallogr D Biol Crystallogr 49(Pt 1): 37-60, Bricogne G (1997) Meth Enzymol 276A: 361-423, ed Carter CW, Roversi P et al., (2000) Acta Crystallogr D Biol Crystallogr 56(Pt 10): 1316-1323). Mutagenesis mapping studies may be performed using any method known to those skilled in the art. For example, see Champe M et al., (1995) J Biol Chem 270: 1388-1394, and Cunningham, J. Biol. Chem. 270: 1388-1394, for a description of mutagenesis techniques, including alanine scanning mutagenesis techniques. See BC & Wells JA (1989) Science 244: 1081-1085.

[0157] As used herein, the term "label" or "labeled" refers to the incorporation of a detectable marker, for example, by incorporation of a radiolabeled amino acid or by the addition of a biotin moiety to a polypeptide that can be detected by marked avidin (e.g., streptavidin having a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). In certain embodiments, the label or marker can also be therapeutic. A variety of methods of labeling polypeptides and glycoproteins are known in the art and can be used.

[0158] Treatment method Using adoptive immunotherapy, natural T cells can be (i) removed from a patient, (ii) genetically modified to express a chimeric antigen receptor (CAR) that binds at least one tumor antigen, (iii) expanded ex vivo into a larger population of modified T cells, and (iv) reintroduced into the patient. See, e.g., U.S. Pat. Nos. 7,741,465 and 6,319,494; Eshhar et al. (Cancer Immunol, supra); Krause et al. (supra); Finney et al. (supra). After reintroduction of the modified T cells into the patient, the modified T cells can be transformed into a tumor-specific T cell population. The cells mediate an immune response against cells expressing tumor antigens. See, e.g., Krause et al., J. Exp. Med., Volume 188, No. 4, 1998 (619-626). This immune response includes secretion of IL-2 and other cytokines by T cells, clonal expansion of T cells that recognize tumor antigens, and specific killing of target positive cells mediated by T cells. See, Hombach et al., Journal of Immun. 167: 6123-6131 (2001).

[0159] The term "lymphocytes" as used herein includes natural killer (NK) cells, T cells, or B cells. NK cells are a type of cytotoxic (cell-toxic) lymphocyte that constitutes the main component of the innate immune system. NK cells reject tumor and virus-infected cells. NK cells act by the process of apoptosis or programmed cell death. NK cells are named "natural killers" because they do not require activation to kill cells. T cells play a major role in cell-mediated immunity (not involving antibodies). Their T cell receptor (TCR) differentiates them from other types of lymphocytes. The thymus, a specialized organ of the immune system, is primarily responsible for the maturation of T cells. There are six types of T cells: helper T cells (e.g., CD4+ cells), cytotoxic T cells (TCs, also known as cytotoxic T lymphocytes, CTLs, T-killer cells, cytolytic T cells, CD8+ T cells or killer T cells), memory T cells ((i) stem memory T cells such as naive cells, SCM Cell(stem memory T SCM (ii) central memory T cells) are CD45RO-, CCR7+, CD45RA+, CD62L+ (L-selectin), CD27+, CD28+ and IL-7Rα+, but they express high amounts of CD95, IL-2Rβ, CXCR3 and LFA-1 and display many functional attributes characteristic of memory cells; CM The cells express L-selectin and CCR7 and secrete IL-2 but not IFNγ or IL-4; and (iii) effector memory T EM There are several types of T cells: T cells (which do not express L-selectin or CCR7, but produce effector cytokines such as IFNγ and IL-4), regulatory T cells (Treg, suppressor T cells or CD4+CD25+ regulatory T cells), natural killer T cells (NKT) and gamma delta T cells. On the other hand, B cells play the most important role in humoral immunity (involving antibodies). They make antibodies and antigens, act as antigen-presenting cells (APCs) and become memory B cells after activation by antigen interaction. In mammals, immature B cells are formed in the bone marrow, from which they take their name.

[0160] The term "genetically modified" or "modified" refers to a method of modifying the genome of a cell, including, but not limited to, the deletion of a coding or non-coding region, or a portion thereof, or the insertion of a coding region, or a portion thereof. In some embodiments, the modified cell is a lymphocyte, e.g., a T cell, which can be obtained from either a patient or a donor. The cell can be modified to express a foreign construct, such as, for example, a chimeric antigen receptor (CAR) or a T cell receptor (TCR), which is integrated into the genome of the cell.

[0161] "Immune response" refers to the actions of cells of the immune system (e.g., T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells, and neutrophils) and soluble macromolecules (including Abs, cytokines, and complement) produced by any of these cells or the liver that result in the selective targeting, binding to, damaging, destroying, and / or elimination from the vertebrate body of invading pathogens, pathogen-infected cells or tissues, cancerous or other abnormal cells, or, in the case of autoimmune or pathological inflammation, normal human cells or tissues.

[0162] The term "immunotherapy" refers to the treatment of a subject afflicted with a disease or at risk of contracting a disease or suffering a recurrence of a disease by methods that involve inducing, enhancing, suppressing, or otherwise modulating an immune response. Examples of immunotherapy include, but are not limited to, T cell therapy. T cell therapy includes adoptive T cell therapy, These may include tumor infiltrating lymphocyte (TIL) immunotherapy, autologous cell therapy, engineered autologous cell therapy (eACT), and allogeneic T cell transplantation. However, those skilled in the art will recognize that the conditioning methods disclosed herein may enhance the efficacy of any transplanted T cell therapy. Examples of T cell therapy are described in US Patent Application Publication Nos. 2014 / 0154228 and 2002 / 0006409, US Patent No. 5,728,388, and WO 2008 / 081035.

[0163] T cells for immunotherapy may be derived from any source known in the art. For example, T cells may be differentiated in vitro from a hematopoietic stem cell population, or T cells may be obtained from a subject. T cells may be obtained, for example, from peripheral blood mononuclear cells (PBMCs), bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, splenic tissue, and tumors. In addition, T cells may be derived from one or more T cell lines available in the art. T cells may also be derived from blood mononuclear cells collected from a subject using various techniques known to those skilled in the art, such as FICOLL™ separation and / or apheresis. Additional methods for isolating T cells for T cell therapy are disclosed in U.S. Patent Application Publication No. 2013 / 0287748, which is incorporated herein by reference in its entirety.

[0164] The term "engineered autologous cell therapy", also known as adoptive cell transfer and which can be abbreviated as "eACT™", is a process in which a patient's own T cells are collected and subsequently engineered to recognize and target one or more antigens expressed on the cell surface of one or more specific tumor cells or malignancies. The T cells can be engineered to express, for example, a chimeric antigen receptor (CAR) or a T cell receptor (TCR). CAR-positive (+) T cells are engineered to express an extracellular single-chain variable fragment (scFv) with specificity for a specific tumor antigen linked to an intracellular signaling moiety that includes at least one costimulatory domain and at least one activation domain. The costimulatory domain can be derived from (or corresponds to) CD28, for example, and the activation domain can be derived from (or corresponds to) CD3-zeta, for example. In certain embodiments, the CAR is designed to have two, three, four or more costimulatory domains.

[0165] The term "autologous" refers to any material derived from the same individual that is later reintroduced. For example, the engineered autologous cell therapy (eACT™) method described herein involves collecting lymphocytes from a patient, which are then modified, for example, to express a CAR construct, and then administered back to the same patient.

[0166] The term "allogeneic" refers to any material derived from one individual that is subsequently introduced into another individual of the same species (eg, allogeneic T cell transplantation).

[0167] Thus, in some aspects, the present invention includes a method of treating or preventing a condition associated with undesirable and / or elevated CLL-1 levels in a patient, comprising administering to a patient in need thereof an effective amount of at least one isolated antigen binding molecule, CAR or TCR disclosed herein.

[0168] Methods of treating diseases or disorders, including cancer, are provided. In some embodiments, the invention relates to generating a T cell-mediated immune response in a subject, comprising administering to the subject an effective amount of the modified immune cells of the present application. In some embodiments, the T cell-mediated immune response is against a target cell(s). In some embodiments, the modified immune cells comprise a chimeric antigen receptor (CAR) or a T cell receptor (TCR). In some embodiments, the target cell is a tumor cell. In some aspects, the invention includes a method of treating or preventing a malignant tumor, comprising administering to a subject in need thereof an effective amount of at least one isolated antigen binding molecule described herein. In some aspects, the invention includes a method of treating or preventing a malignant tumor, comprising administering to a subject in need thereof an effective amount of at least one immune cell, wherein the immune cell comprises at least one chimeric antigen receptor, T cell receptor and / or isolated antigen binding molecule described herein.

[0169] In some aspects, the invention includes pharmaceutical compositions comprising at least one antigen binding molecule described herein and a pharma- ceutical acceptable excipient. In some embodiments, the pharmaceutical composition further comprises an additional active agent.

[0170] The antigen binding molecules, CARs, TCRs, immune cells, etc. of the present invention can be used to treat bone marrow diseases, including, but not limited to, acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia, atypical chronic myeloid leukemia, acute promyelocytic leukemia (APL), acute monoblastic leukemia, acute erythroleukemia, acute megakaryoblastic leukemia, myelodysplastic syndromes (MDS), myeloproliferative disorders, myeloid neoplasms, myeloid sarcomas, blastic plasmacytoid dendritic cell neoplasms (BPDCN), or combinations thereof. Additional diseases include inflammatory and / or autoimmune diseases such as rheumatoid arthritis, psoriasis, allergies, asthma, Crohn's disease, IBD, IBS, fibromyalgia, mastocytosis, and celiac disease.

[0171] CAR + / CAR-T+ / TCR + The target dose of cells is preferably 1×10 6 cells / kg~2×10 10 in the range of cells / kg, more preferably 2×10 6 It will be understood that the dose may be in the range of 100-150 mg / kg of cells / kg. It will be understood that doses above and below this range may be appropriate for a particular subject, and appropriate dose levels may be determined as necessary by a medical provider. Additionally, multiple doses of cells may be provided in accordance with the present invention.

[0172] Also provided are methods of reducing the size of a tumor in a subject, comprising administering to the subject modified cells of the invention, wherein the cells comprise a chimeric antigen receptor, a T cell receptor, or a T cell receptor-based chimeric antigen receptor comprising an antigen binding molecule that binds to an antigen on the tumor. In some embodiments, the subject has a solid tumor or a hematological malignancy, such as lymphoma or leukemia. In some embodiments, the modified cells are delivered to the tumor bed. In some embodiments, In some embodiments, the cancer is present in the bone marrow of the subject. In some embodiments, the modified cells are autologous T cells. In some embodiments, the modified cells are allogeneic T cells. In some embodiments, the modified cells are xenogeneic T cells. In some embodiments, the modified cells of the present application are transfected or transduced in vivo. In other embodiments, the modified cells are transfected or transduced ex vivo. As used herein, the term "in vitro cells" refers to any cells that are cultured ex vivo. In particular, in vitro cells can include T cells.

[0173] The method may further comprise administering one or more chemotherapeutic agents. In certain embodiments, the chemotherapeutic agent is lymphodepleting (preconditioning) chemotherapy. Beneficial preconditioning treatment regimens, along with correlative beneficial biomarkers, are described in U.S. Provisional Patent Applications 62 / 262,143 and 62 / 167,750, which are incorporated herein by reference in their entireties. These include, for example, the indicated beneficial doses of cyclophosphamide (200 mg / m 2 / day~2000mg / m 2 / day) and the specified dose of fludarabine (20 mg / m 2 / day~900mg / m 2 A method of conditioning a patient in need of T cell therapy is described that includes administering to the patient about 500 mg / m2 of modified T cells per day. A preferred dosing regimen is to administer about 500 mg / m2 of modified T cells per day to the patient prior to administering a therapeutically effective amount of the modified T cells to the patient. 2 / day cyclophosphamide and approximately 60 mg / m 2 Treatment of patients includes administering 100 mg / day of fludarabine daily for three days.

[0174] In other embodiments, the antigen binding molecule, the transduced (or otherwise modified) cell (such as a CAR or TCR), and the chemotherapeutic agent are each administered in an amount effective to treat a disease or condition in the subject.

[0175] In certain embodiments, compositions comprising immune effector cells expressing a CAR disclosed herein can be administered with a variety of chemotherapeutic agents, including alkylating agents such as thiotepa and cyclophosphamide (CYTOXAN™); alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylmelamines, including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide, and trimethylolmelamine resume; chlorambucil, Nitrogen mustards such as chlornaphazine, chlorophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, nobuenbikin, phenesterine, prednimustine, trofosfamide, and uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimustine; aclacinomycin, actinomycin, anthramycin, azaserine, bleomycin, cactinomycin, calicheamicin, carabicin, and carmisulfamethoxazole; nomycin, carzinophilin, chromomycin, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcelomycin, mitomycin, mycophenolic acid, nogalamycin, olivomycin, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinosta Antibiotics such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; fludarabine, 6-mercaptopurine, thiamine, etc. Purine analogues such as amiprine and thioguanine; pyrimidine analogues such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine, and 5-FU; calsterone, propionic acid Androgens such as dromostanolone, epithiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; Folic acid replenishers such as folinic acid; aceglatone; aldophosphamide glycosides Cid;Aminolevulinic acid;Amsacrine;Bestravcil;Bisantrene;Edatrexate;Defofamine;Demecolcine;Diaziquone;Elformithine;Elliptinium acetate;Etoglucide;Gallium nitrate;Hydroxyurea;Lentinan;Lonidamine;Mitoguazone;Mitoxantrone;Mopidamol;Nitracrine;Pentostatin;Fenamet;Pirarubicin;Podophyllic acid;2-Ethylhydrazide ;Procarbazine;PSK(trademark);Razoxane;Sizofiran;Spirogermanium;Tenuazonic acid;Triaziquone;2,2',2''-Trichlorotriethylamine;Urethane;Vindesine;Dacarbazine;Mannomustine;Mitobronitol;Mitolactol;Pipobroman;Gacytosine;Arabinoside ("Ara-C");Cyclophosphamide;Thiotepa;Taxoids such as paclitaxel (TAXOL(trademark), Bristol-Myers Squibb) and docetaxel (TAXOTERE(trademark), Rhone-Poulenc Rorer);Chlorambucil;Gemcitabine;6-Thioguanine;Mercaptopuri carbamazepine; methotrexate; platinum analogues such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS2000; difluoromethylornithine (DMFO); retinoic acid derivatives such as Targretin™ (bexarotene) and Panretin™ (alitretinoin); ONTAK™ (denileukin diftitox); esperamicin; Capecitabine; and pharmacologic acceptable salts, acids, or derivatives of any of the above. Antihormonal agents that act to regulate or inhibit hormone action on tumors, such as antiestrogens including tamoxifen, raloxifene, aromatase-inhibiting 4(5)-imidazole, 4-hydroxytamoxifen, trioxyphene, keoxyphene, LY117018, onapristone, and toremifene (Fareston); and antiandrogens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmacologic acceptable salts, acids, or derivatives of any of the above. In appropriate cases, combinations of chemotherapy agents are also administered, including, but not limited to, CHOP, i.e., cyclophosphamide (Cytoxan™), doxorubicin (hydroxydoxorubicin), vincristine (Oncovin™), and prednisone.

[0176] In some embodiments, the chemotherapeutic agent is administered simultaneously with or within one week of administration of the modified cells, polypeptide, or nucleic acid. In other embodiments, the chemotherapeutic agent is administered 1 week to 4 weeks, i.e., 1 week to 1 month, 1 week to 2 months, 1 week to 3 months, 1 week to 6 months, 1 week to 9 months, or 1 week to 12 months after administration of the modified cells, polypeptide, or nucleic acid. In other embodiments, the chemotherapeutic agent is administered at least one month prior to administration of the cells, polypeptide, or nucleic acid. In some embodiments, the method further comprises administering two or more chemotherapeutic agents.

[0177] A variety of additional therapeutic agents may be used in conjunction with the compositions described herein. For example, potentially useful additional therapeutic agents include PD-1 inhibitors such as nivolumab (Opdivo™), pembrolizumab (Keytruda™), pembrolizumab, pidilizumab, and atezolizumab.

[0178] Additional therapeutic agents suitable for use in combination with the present invention include ibrutinib (Imbruvica™), ofatumumab (Arzerra™), rituximab (Rituxan™), bevacizumab (Avastin™), trastuzumab (Herceptin™), trastuzumab emtansine (KADCYLA™), ibrutinib (Imbruvica™), ofatumumab (Arzerra™), rituximab (Rituxan™), bevacizumab (Avastin™), trastuzumab (Herceptin™), trastuzumab emtansine (KADCYLA™), ibrutinib (Imbruvica™), ofatumumab (Arzerra™), ofatumumab (Rituxan™), bevacizumab (Avastin™), trastuzumab emtansine (KADCYLA™), ibrutinib (Imbruvica™), ofatumumab (Arzerra™), ofatumumab (Rituxan ... Matinib (Gleevec™), Cetuximab (Erbitux™), Panitumumab (Vectibix™), Catumaxomab, Ibritumomab, Ofatumumab, Tositumomab, Brentuximab, Alemtuzumab, Gemtuzumab, Erlotinib, Gefitinib, Vandetanib, Afatinib, Lapatinib, Neratinib, Axitinib, Masitinib, Pazopanib, Sunitinib, Soraf cecitinib, toceranib, lestaurtinib, axitinib, cediranib, lenvatinib, nintedanib, pazopanib, regorafenib, semaxanib, sorafenib, sunitinib, tivozanib, toceranib, vandetanib, entrectinib, cabozantinib, imatinib, dasatinib, nilotinib, ponatinib, radotinib, bosutinib, lestaurtinib, ruxolitinib, pak These include, but are not limited to, mTOR inhibitors such as ritinib, cobimetinib, selumetinib, trametinib, binimetinib, alectinib, ceritinib, crizotinib, aflibercept, adipotide, denileukin diftitox, everolimus and temsirolimus, hedgehog inhibitors such as sonidegib and vismodegib, and CDK inhibitors such as the CDK inhibitor (palbociclib).

[0179] In additional embodiments, the immune-containing composition comprising a CAR can be administered with an anti-inflammatory agent or anti-inflammatory drugs, including steroids and glucocorticoids (including betamethasone, budesonide, dexamethasone, hydrocortisone acetate, hydrocortisone, hydrocortisone, methylprednisolone, prednisolone, prednisone, triamcinolone), nonsteroidal anti-inflammatory drugs (NSAIDs), including aspirin, ibuprofen, naproxen, methotrexate, sulfasalazine, leflunomide, anti-TNF drugs, cyclophosphamide, and mycophenolate. Exemplary NSAIDs include, but are not limited to, ibuprofen, naproxen, naproxen sodium, Cox-2 inhibitors and sialylates. Exemplary analgesics include acetaminophen, oxycodone, tramadol, propoxyphene hydrochloride. Exemplary glucocorticoids include cortisone, dexamethasone, hydrocortisone, methylprednisolone, prednisolone or prednisone. Exemplary biological response modifiers include molecules directed against cell surface markers (e.g., CD4, CD5, etc.), cytokine inhibitors (e.g., TNF antagonists (e.g., etanercept (ENBREL™), adalimumab (HUMIRA™), and infliximab (REMICADE™)), ​​chemokine inhibitors, and adhesion molecule inhibitors. Biological response modifiers also include monoclonal antibodies, as well as recombinant forms of molecules. Exemplary DMARDs include azathioprine, cyclophosphamide, cyclosporine, methotrexate, penicillamine, leflunomide, sulfasalazine, hydroxychloroquine, gold (oral (auranofin) and intramuscular), and minocycline.

[0180] In certain embodiments, the compositions described herein are administered in conjunction with cytokines. As used herein, "cytokine" is meant to refer to a protein released by one cell population that acts on another cell as an intercellular mediator. Examples of cytokines are lymphokines, monokines, and traditional polypeptide hormones. Among the cytokines, growth hormones such as human growth hormone, N-methionyl human growth hormone and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle-stimulating hormone (FSH), thyroid-stimulating hormone (TSH) and luteinizing hormone (LH); hepatic growth factor (HGF); fibroblast growth factor (FGF); prolactin; placental lactogen; Mullerian inhibitory substance; mouse gonadotropin-related peptide; inhibin; activin; vascular endothelial growth factor; integrins; thrombopoietin (TPO); nerve growth factor (NGF) such as NGF-beta; platelet growth factor; transforming growth factors (TGF) such as TGF-alpha and TGF-beta; insulin-like growth factors I and II; erythropoietin; Examples of cytokines include ethinyl esterase (EPO); bone morphogenetic factor; interferons such as interferon-alpha, beta and gamma; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); IL-1, IL-1 alpha, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; interleukins (ILs) such as IL-15, tumor necrosis factors such as TNF-alpha or TNF-beta; and other polypeptide factors including LIF and kit ligand (KL). As used herein, the term cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.

[0181] In some embodiments, the present invention provides a K of less than 100 pM. dIn some embodiments, the antigen binding molecule has a K of less than 10 pM. d In other embodiments, the antigen-binding molecule binds with a K of less than 5 pM. d Combine with.

[0182] Method of preparation A variety of known techniques can be used to produce polynucleotides, polypeptides, vectors, antigen-binding molecules, immune cells, compositions, and the like, according to the invention.

[0183] Prior to the in vitro manipulation or genetic modification of immune cells as described herein, the cells can be obtained from a subject. In some embodiments, the immune cells include T cells. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells (PBMCs), bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, splenic tissue, and tumors. In certain embodiments, T cells can be obtained from a unit of blood collected from a subject using a variety of techniques known to those skilled in the art, such as FICOLL™ separation. Cells can be obtained from the circulating blood of an individual, preferably by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In certain embodiments, cells collected by apheresis can be washed to remove the plasma fraction and placed in a buffer or medium appropriate for further processing. Cells can be washed with PBS. As will be appreciated, a washing step may be used, for example, by using a semi-automated flow-through centrifuge such as the Cobe™ 2991 cell processing device, Baxter CytoMate™, etc. After washing, the cells may be resuspended in a variety of biocompatible buffers or other saline solutions with or without buffers. In certain embodiments, undesirable components of the apheresis sample may be removed.

[0184] In certain embodiments, T cells are isolated from PBMCs by lysis of red blood cells and depletion of monocytes, for example, by using centrifugation through a PERCOLL™ gradient. + , CD4 + , CD8 + , CD45RA + and CD45RO + Specific subpopulations of T cells, such as T cells from the negative selection group, can be further isolated by positive or negative selection techniques known in the art. For example, enrichment of a T cell population by negative selection can be accomplished by a combination of antibodies against surface markers unique to the cells to be negatively selected. One method used herein is negative magnetic immunoadherence or flow cytometry, which uses a cocktail of monoclonal antibodies against cell surface markers present on the cells to be negatively selected. Sorting and / or selection of cells by cytometry. For example, negative selection can be used to isolate CD4 + To enrich for cells, the monoclonal antibody cocktail typically includes antibodies against CD14, CD20, CD11b, CD16, HLA-DR and CD8. Flow cytometry and cell sorting can also be used to isolate cell populations of interest for use in the present invention.

[0185] PBMCs can be cultured using the methods described herein to identify immune cells (such as CAR or TCR). In certain embodiments, after isolating PBMCs, T lymphocytes can be further isolated and sorted into naive, memory, and effector T cell subpopulations, either before or after genetic modification and / or expansion, for both cytotoxic and helper T lymphocytes.

[0186] In some embodiments, CD8 + The cells are +By identifying cell surface antigens associated with the cells, they are further sorted into naive cells, central memory cells, and effector cells. In some embodiments, expression of phenotypic markers of central memory T cells includes CD45RO, CD62L, CCR7, CD28, CD3, and CD127, and are negative for granzyme B. In some embodiments, central memory T cells express CD45RO, CD62L, CCR7, CD28, CD3, and CD127, and are negative for granzyme B. + , CD62L + , CD8 + In some embodiments, effector T cells are negative for CD62L, CCR7, CD28, and CD127, and positive for granzyme B and perforin. In certain embodiments, effector T cells are negative for CD4 + T cells can be further sorted into subpopulations. For example, CD4 + Helper T cells can be sorted into naive cells, central memory cells, and effector cells by identifying cell populations that have cell surface antigens.

[0187] Following isolation, immune cells, e.g., T cells, can be genetically modified using known methods, or immune cells can be activated and expanded (i.e., in the case of progenitor cells, differentiated) in vitro prior to genetic modification. In another embodiment, immune cells, e.g., T cells, are genetically modified with a chimeric antigen receptor as described herein (e.g., transduced with a viral vector comprising one or more nucleotide sequences encoding a CAR) and then activated and / or expanded in vitro. Methods for activating and expanding T cells are known in the art and are described, for example, in U.S. Pat. No. 6,905,874, U.S. Pat. No. 6,867,041, U.S. Pat. No. 6,797,514, and WO 2012 / 079000, the contents of which are incorporated herein by reference in their entirety. In general, such methods include contacting PBMCs or isolated T cells with stimulatory and costimulatory molecules, such as anti-CD3 and anti-CD28 antibodies, typically attached to beads or other surfaces, in a culture medium containing appropriate cytokines, such as IL-2. Anti-CD3 and anti-CD28 antibodies attached to the same bead serve as "surrogate" antigen presenting cells (APCs). One example is the Dynabeads™ system, a CD3 / CD28 activator / stimulator system for physiological activation of human T cells. In other embodiments, T cells can be activated and stimulated to expand with feeder cells and appropriate antibodies and cytokines using methods such as those described in U.S. Pat. No. 6,040,177, U.S. Pat. No. 5,827,642 and WO 2012 / 129514, the contents of which are incorporated herein by reference in their entirety.

[0188] Certain methods of making the constructs and modified immune cells of the invention are described in International Application No. PCT / US15 / 14520, the contents of which are incorporated herein by reference in their entirety. Additional methods of making the constructs and cells can be found in U.S. Provisional Patent Application No. 62 / 244,036, the contents of which are incorporated herein by reference in their entirety.

[0189] It will be understood that the PBMCs may further comprise other cytotoxic lymphocytes, such as NK cells or NKT cells. An expression vector carrying the coding sequence for the chimeric receptor disclosed herein can be introduced into a population of human donor T cells, NK cells or NKT cells. Successfully transduced T cells carrying the expression vector can be sorted using flow cytometry to isolate CD3 positive T cells, followed by cell activation using anti-CD3 antibodies and IL-2, or other methods known in the art as described elsewhere herein. These CAR-expressing T cells can then be expanded further to increase their numbers. Standard procedures are used for cryopreservation of CAR-expressing T cells for storage and / or preparation for use in human subjects. In one embodiment, in vitro transduction, culture and / or expansion of T cells is performed using non-human serum, such as fetal calf serum and fetal bovine serum. The test is carried out in the absence of any animal products.

[0190] For cloning of polynucleotides, a vector is introduced into a host cell (isolated host cell) and the vector itself is allowed to replicate, thereby amplifying copies of the polynucleotides contained therein. Cloning vectors generally contain sequence components including, but not limited to, an origin of replication, a promoter sequence, a transcription initiation sequence, an enhancer sequence, and a selectable marker. These elements can be selected as needed by those skilled in the art. For example, an origin of replication can be selected to promote autonomous replication of the vector in the host cell.

[0191] In certain embodiments, the present disclosure provides an isolated host cell containing the vector presented herein. The host cell containing the vector can be useful for expressing or cloning the polynucleotide contained in the vector. Suitable host cells can include, but are not limited to, prokaryotic cells, fungal cells, yeast cells, or higher eukaryotic cells such as mammalian cells. Suitable prokaryotic cells for this purpose include, but are not limited to, eubacteria such as gram-negative or gram-positive organisms, for example, Enterobacter (Enterobacteriaceae), for example, Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, for example, Salmonella typhimurium, Serratia, for example, Serratia marcescans and Shigella, B. subtilis. ), Bacilli such as B. licheniformis, Pseudomonas such as P. aeruginosa, and Streptomyces. .

[0192] The vectors can be introduced into the host cells using any suitable method known in the art, including, but not limited to, DEAE-dextran mediated delivery, calcium phosphate precipitation, cationic lipid mediated delivery, liposome mediated transfection, electroporation, microprojectile bombardment, receptor mediated gene delivery, polylysine, histone, chitosan and peptide mediated delivery. Standard methods of transfection and transformation of cells for expression of the vector of interest are known in the art. In further embodiments, a mixture of different expression vectors can be used in the genetic modification of the donor population of immune effector cells, each vector encoding a different CAR as disclosed herein. The resulting transduced immune effector cells form a mixed population of modified cells, some of which express two or more different CARs.

[0193] In one embodiment, the present invention provides a method for storing genetically modified cells expressing a CAR or TCR targeting a CLL-1 protein. This includes cryopreserving the immune cells so that the cells remain viable upon thawing. A fraction of the immune cells expressing the CAR can be cryopreserved by methods known in the art to provide a permanent source of such cells for future treatment of patients affected by malignant tumors. If necessary, the cryopreserved transformed immune cells can be thawed, grown, and expanded into more such cells.

[0194] As used herein, "cryopreserving" refers to the preservation of cells by cooling to subzero temperatures, e.g., (usually) 77 Kelvin, or -196°C (the boiling point of liquid nitrogen). Cryoprotectants are often used at subzero temperatures to prevent damage to the cells being stored due to freezing at low temperatures or warming to room temperature. Cryopreservative agents and optimal The rate of cooling can prevent cell damage. Cryoprotectants that can be used in accordance with the present invention include dimethylsulfoxide (DMSO) (Lovelock & Bishop, Nature (1959); 183: 1394-1395; Ashwood-Smith, Nature (1961); 190: 1204-1205), glycerol, polyvinylpyrrolidine (Rinfret, Ann. NY Acad. Sci. (1960); 85: 576), and polyvinylpyrrolidine (Rinfret, Ann. NY Acad. Sci. (1960); 85: 576). Ethylene glycol (Sloviter & Ravdin, Nature (1962); 196: 48), The cooling rate is not limited thereto, but is preferably 1° C. / min to 3° C. / min.

[0195] The term "substantially pure" is used to indicate that a given component is present at a high level. The component is desirably the major component present in the composition. Preferably, the component is present at a level of more than 30%, more than 50%, more than 75%, more than 90% or even more than 95%, the level being determined on a dry weight / dry weight basis relative to the total composition under consideration. At very high levels (e.g., levels of more than 90%, more than 95% or more than 99%), the component can be considered to be in "pure form". The bioactive substances (CAR, TCR, isolated polypeptides, isolated nucleic acid molecules, antigen-binding molecules, moieties) of the present invention can be provided in a form that is substantially free of one or more contaminants that may otherwise be associated with the substance. When a composition is substantially free of a given contaminant, the contaminant is at a low level (e.g., levels of less than 10%, less than 5% or less than 1% on a dry weight / dry weight basis as described above).

[0196] In some embodiments, the cells are formulated by first harvesting them from the culture medium, followed by washing the cells and concentrating them in a therapeutically effective amount in a medium and container system suitable for administration (a "pharmaceutical acceptable" carrier). A suitable infusion medium can be any isotonic medium formulation, typically normal saline solution, Normosol™ R (Abbott), or Plasma-Lyte™ A (Baxter), although 5% dextrose in water or lactated Ringer's solution can also be utilized. Human serum albumin may be added to the infusion medium.

[0197] A desired therapeutic amount of cells in a composition generally comprises at least two cells (e.g., at least one CD8 + Central memory T cells and at least one CD4 + helper T cell subset), or more commonly, 10 2 More than 10 and up to 10 6 Cells, 10 8 Pieces or 10 9 Up to 10 cells 10 The number of cells will vary depending on the desired use for which the composition is intended and the type of cells contained therein. Desired cell densities are typically between 10 6 >10 cells / ml, typically 7 Cells / ml, typically 10 8 A clinically relevant immune cell count is ≥10 cumulative cells / ml. 5 pieces, 10 6 pieces, 10 7 pieces, 10 8 pieces, 10 9 pieces, 10 10 pieces, 10 11 Pieces or 10 12 In some embodiments of the invention, the total number of cells infused may be equal to or greater than 10 cells, particularly since all of the cells infused are redirected to a specific target antigen (CLL-1). 6 Pieces / kilogram (10 per patient) 6 ~10 pieces 11Smaller numbers of cells can be administered, ranging from 10 to 15 cells (10 to 15 cells). CAR therapy can be administered multiple times at dosages within these ranges. Cells can be autologous, allogeneic, or xenogeneic to the patient receiving the therapy.

[0198] The cell population expressing the CAR of the invention can be administered alone or as a pharmaceutical composition in combination with other components such as diluents and / or IL-2 or other cytokines or cell populations. The pharmaceutical compositions of the invention can include a cell population such as T cells expressing a CAR or TCR as described herein in combination with one or more pharma- ceutical or physiologically acceptable carriers, diluents or excipients. Such compositions can include buffers such as neutral buffered saline, phosphate buffered saline; carbohydrates such as glucose, mannose, sucrose or dextran, mannitol; proteins; amino acids such as polypeptides or glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. The compositions of the invention are formulated for intravenous administration. It is preferable to do so.

[0199] Pharmaceutical compositions (solutions, suspensions, etc.) may contain one or more of the following: sterile diluents, such as water for injection, saline, preferably saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono- or diglycerides that can act as solvents or suspending media, polyethylene glycol, glycerin, propylene glycol, or other solvents; antibacterial agents such as benzyl alcohol or methylparabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates, or phosphates, and isotonicity agents such as sodium chloride or dextrose. Parenteral preparations can be enclosed in glass or plastic ampoules, disposable syringes, or multiple dose vials. Pharmaceutical compositions for injection are preferably sterile.

[0200] It will be appreciated that adverse events may be minimized by transducing immune cells (including one or more CARs or TCRs) with suicide genes. Also, where it may be desirable to incorporate an inducible "on" or "accelerator" switch into the immune cells. Suitable techniques include the use of inducible caspase-9 (US Patent Application Publication No. 2011 / 0286980) or thymidine kinase before, after, or simultaneously with the cells being transduced with the CAR construct of the invention. Additional methods of introducing suicide genes and / or "on" switches include TALENS, zinc fingers, RNAi, siRNA, shRNA, antisense technology, and other techniques known in the art.

[0201] According to the present invention, additional on-off or other types of control switch technologies can be incorporated into the present invention. These technologies can utilize the use of dimerization domains and any activators of such domain dimerization. These technologies include, for example, those described by Wu et al., Science 2014 350 (6258), which uses the FKBP / Rapalog dimerization system in certain cells, the contents of which are incorporated herein by reference in their entirety. Additional dimerization technologies are described, for example, in U.S. Patent Nos. 5,830,462, 5,834,266, 5,869,337, and 6,165,787, the contents of which are incorporated herein by reference in their entirety, as well as Fegan et al. Chem. Rev. 2010, 110, 3315-3336. Additional dimerization pairs may include cyclosporine-A / cyclophilin receptor, estrogen / estrogen receptor (optionally with tamoxifen), glucocorticoid / glucocorticoid receptor, tetracycline / tetracycline receptor, vitamin D / vitamin D receptor. Further examples of dimerization techniques can be found, for example, in WO 2014 / 127261, WO 2015 / 090229, U.S. Patent Application Publication No. 2014 / 0286987, U.S. Patent Application Publication No. 2015 / 0266973, U.S. Patent Application Publication No. 2016 / 0046700, U.S. Patent No. 8,486,693, U.S. Patent Application Publication No. 2014 / 0171649, and U.S. Patent Application Publication No. 2012 / 0130076, the contents of which are further incorporated herein by reference in their entireties.

[0202] It is understood that the descriptions herein are exemplary and explanatory only and are not intended to be limiting of the invention as claimed. In this application, the use of the singular includes the plural unless specifically stated otherwise.

[0203] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents or portions of documents cited in this application, including but not limited to patents, patent applications, articles, books, and papers, are expressly incorporated herein by reference in their entirety for any purpose. As used in accordance with this disclosure, the following terms shall be understood to have the following meanings, unless otherwise specified:

[0204] In this application, the use of "or" means "and / or" unless otherwise specified. Furthermore, the use of the term "including" and other forms such as "includes" and "included" is not limiting. Also, the use of "element" or "component" is not intended to be limiting. Terms such as include both elements and components that contain a single unit, and elements and components that contain two or more subunits, unless specifically stated otherwise.

[0205] The term "CLL-1 activity" includes any biological effect of CLL-1. In certain embodiments, CLL-1 activity includes the ability of CLL-1 to interact with or bind to a substrate or receptor.

[0206] The terms "polynucleotide", "nucleotide" or "nucleic acid" include both single-stranded and double-stranded nucleotide polymers. This includes isolated polynucleotides, nucleotides or nucleic acids, preferably as defined herein. The nucleotides comprising the polynucleotide may be ribonucleotides or deoxyribonucleotides, or modified forms of either type of nucleotide. The modifications include base modifications such as bromouridine and inosine derivatives, ribose modifications such as 2',3'-dideoxyribose, and internucleotide linkage modifications such as phosphorothioates, phosphorodithioates, phosphoroselenoates, phosphorodiselenoates, phosphoro-anilothioates, phosphoraniladates and phosphoramidates.

[0207] The term "oligonucleotide" refers to a polynucleotide containing 200 or less nucleotides. Oligonucleotides can be single-stranded or double-stranded, for example, used in the construction of mutant genes. Oligonucleotides can be sense or antisense oligonucleotides. Oligonucleotides can contain labels, including radiolabels, fluorescent labels, hapten or antigen labels for detection assays. Oligonucleotides can be used, for example, as PCR primers, cloning primers or hybridization probes.

[0208] The term "control sequence" refers to a polynucleotide sequence capable of influencing the expression and processing of coding sequences to which it is ligated. The nature of such control sequences may vary depending on the host organism. In certain embodiments, control sequences for prokaryotes may include a promoter, a ribosomal binding site, and a transcription termination sequence. For example, control sequences for eukaryotes may include a promoter containing one or more recognition sites for transcription factors, a transcription enhancer sequence, and a transcription termination sequence. "Control sequences" may also include a leader sequence (signal peptide) and / or a fusion partner sequence.

[0209] In some embodiments, the polynucleotides of the invention encoding a CAR or TCR may further comprise a leader sequence or peptide (also referred to herein as a "signal peptide"). In certain embodiments, the leader peptide comprises an amino acid sequence that is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO: 144). In some embodiments, the leader peptide comprises the amino acid sequence of SEQ ID NO: 144.

[0210] As used herein, "operably linked" means that the components to which the term is applied are in a relationship enabling them to carry out their inherent functions under suitable conditions.

[0211] The term "vector" is used to transfer protein coding information to a host cell. The term "expression vector" or "expression construct" refers to any molecule or entity (e.g., a nucleic acid, a plasmid, a bacteriophage, or a virus) suitable for transformation of a host cell and directing the expression of one or more heterologous coding regions operatively linked thereto. "Expression construct" refers to a vector that contains nucleic acid sequences that direct and / or control (with a host cell). Expression constructs can include, but are not limited to, sequences that affect or control the transcription, translation, and, if introns are present, RNA splicing of the coding region operably linked thereto.

[0212] The term "host cell" refers to a cell that has been transformed or transformed with a nucleic acid sequence and is thereby capable of expressing a gene of interest. The term includes the progeny of a parent cell, regardless of whether the morphology or genetic make-up of the progeny is identical to that of the original parent cell, so long as the gene of interest is present.

[0213] The term "transformation" refers to a change in the genetic characteristics of a cell; a cell is transformed when it has been modified to contain new DNA or RNA. For example, a cell is transformed when it is genetically modified from its native state by introducing new genetic material by transfection, transduction, or other techniques. After transfection or transduction, the transforming DNA can recombine with the cell's DNA by physically integrating into the cell's chromosomes, or it can be maintained transiently as an episomal element without replication, or it can replicate independently as a plasmid. A cell is considered to be "stably transformed" when the transforming DNA is replicated by cell division.

[0214] The term "transfection" refers to the uptake of foreign or exogenous DNA by a cell. Numerous transfection methods are known in the art and are disclosed herein. See, for example, Graham et al., 1973, Virology 52:456; Sambrook et al., 2001, Molecular Cloning: A Laboratory Manual (supra); Davis et al., 1986, Basic Methods in Molecular Biology, Elsevier; Chu et al., 1981, Gene 13:197.

[0215] The term "transduction" refers to the process by which foreign DNA is introduced into cells by viral vectors. Jones et al., (1998). Genetics: principles and analysis. Boston: See Jones & Bartlett Publ.

[0216] The term "polypeptide" or "protein" refers to a macromolecule having the amino acid sequence of a protein, including one or more amino acid deletions, additions, and / or substitutions of the native sequence, preferably having eight or fewer amino acid substitutions therein. The polypeptide or protein is preferably isolated as defined herein. The terms "polypeptide" and "protein" specifically encompass CLL-1 antigen-binding molecules, antibodies, or sequences having one or more amino acid deletions, additions, and / or substitutions of the antigen-binding protein, preferably having eight or fewer amino acid substitutions therein. The term "polypeptide fragment" refers to an isolated polypeptide having an amino-terminal deletion, a carboxyl-terminal deletion, and / or an internal deletion compared to the full-length native protein. Such fragments may contain modified amino acids compared to the native protein. Useful polypeptide fragments include immune functional fragments of antigen-binding molecules. Useful fragments include, but are not limited to, one or more CDR regions, heavy and / or light chain variable domains, portions of other portions of antibody chains, and the like.

[0217] The term "isolated" means (i) free from at least some other proteins with which it is normally associated; (ii) essentially free from other proteins from the same source, e.g., the same species; (iii) separated from at least about 50 percent of the polynucleotides, lipids, carbohydrates, or other materials with which it is naturally associated; and (iv) free from the natural products of the subject. "Non-naturally occurring" means (i) operatively associated (by covalent or non-covalent interactions) with a polypeptide not naturally associated therewith; or (v) not naturally occurring.

[0218] A "variant" of a polypeptide (e.g., an antigen-binding molecule or antibody) includes an amino acid sequence in which one or more amino acid residues have been inserted, deleted, and / or substituted into the amino acid sequence relative to another polypeptide sequence. Variants include fusion proteins.

[0219] The term "identity" refers to the relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity" means the percent of identical residues among the amino acids or nucleotides in the compared molecules, and is calculated based on the size of the smallest molecule being compared. For these calculations, gaps in the alignment, if any, are preferably addressed by a specific mathematical model or computer program (i.e., an "algorithm").

[0220] To calculate percent identity, the sequences being compared are typically aligned in a way that gives the greatest correspondence between the sequences. One example of a computer program that can be used to determine percent identity is GAP (Devereux et al., 1984, Nucl. Acid Res. 12:387, The Genetics Computer Group at the University of Wisconsin, Madison, Wisconsin The CG program package. The computer algorithm GAP is used to align two polypeptides or polynucleotides for which percent sequence identity is specified. The sequences are aligned for the best match of their respective amino acids or nucleotides (the "matched span", as specified by the algorithm). In certain embodiments, the algorithm uses a standard comparison matrix (Dayhoff et al., 1978, Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al., 1992, Proc. Natl. Acad. Sci. USA 89:10915-10919; for the BLOSUM 62 comparison matrix) are also used.

[0221] As used herein, the twenty common (e.g., naturally occurring) amino acids and their abbreviations follow conventional usage. See Immunology - A Synthesis (2nd Edition, Golub and Gren, Eds., Sinauer Assoc., Sunderland, Mass. (1991)), which is incorporated by reference for any purpose. Stereoisomers of the twenty common amino acids (e.g., D-amino acids), unnatural amino acids such as alpha,alpha-disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids may also be suitable components of the polypeptides of the invention. Examples of non-standard amino acids include 4-hydroxyproline, gamma-carboxyglutamic acid, epsilon-N,N,N-trimethyllysine, eN-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, sigma-N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline). In the representation of polypeptides used herein, the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy-terminal direction, in accordance with standard usage and convention.

[0222] Conservative amino acid substitutions may include non-naturally occurring amino acid residues that are typically incorporated by chemical peptide synthesis rather than synthesis in a biological system. These include peptidomimetics and other reversed or inverted amino acid moieties. Naturally occurring residues can be divided into the following classes based on common side chain properties: a) Hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile, b) Neutral hydrophilic: Cys, Ser, Thr, Asn, Gln , c) Acidic: Asp, Glu, d) Basic: His, Lys, Arg, e) Residues that influence chain orientation: Gly, Pro, and f) Aromatics: Trp, Tyr, Phe.

[0223] For example, non-conservative substitutions may involve exchanging a member of one of these classes for a member of another class. Such substituted residues may be introduced, for example, into regions of the human antibody that are homologous with the non-human antibody, or into the non-homologous regions of the molecule. Exemplary amino acid substitutions are shown in Table 3.

[0224] [Table 3]

[0225] The term "derivative" refers to a molecule that includes a chemical modification other than an amino acid (or nucleic acid) insertion, deletion, or substitution. In certain embodiments, a derivative includes a covalent modification, including, but not limited to, chemical conjugation with a polymer, lipid, or other organic or inorganic moiety. In certain embodiments, a chemically modified antigen-binding molecule may have a longer circulating half-life than an antigen-binding molecule that is not chemically modified. In some embodiments, a derivative antigen-binding molecule is covalently modified to include the attachment of one or more water-soluble polymers, including, but not limited to, polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol. do.

[0226] Peptide analogues are commonly used in the pharmaceutical industry as non-peptide drugs with properties similar to those of the template peptide. These types of non-peptide compounds are called "peptide mimetics" or "peptidomimetics." Fauchere, J., Adv. Drug Res., 15:29 (1986), Veber & Freidinger, TINS, p. 392 (1985), and Evans et al., J. Med. Chem., 30:1229 (1987), which are incorporated by reference for any purpose.

[0227] A "therapeutically effective amount," "effective dose," "effective amount," or "therapeutically effective dosage" of a therapeutic agent, e.g., an engineered CAR T cell, is any amount that, when used alone or in combination with another therapeutic agent, protects a subject from developing a disease or promotes regression of the disease as manifested by a decrease in the severity of disease symptoms, an increase in the frequency and duration of disease symptom-free periods, or prevention of functional impairment or disability due to disease affliction. The ability of a therapeutic agent to promote regression of a disease can be assessed using a variety of methods known to the skilled physician, for example, by assaying the activity of the agent in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or in in vitro assays.

[0228] The terms "patient" and "subject" are used interchangeably and include human and non-human animal subjects, as well as subjects with a formally diagnosed disorder, subjects without a formally recognized disorder, subjects undergoing treatment, subjects at risk for developing a disorder, and the like.

[0229] The terms "treat" and "treatment" include therapeutic procedures, prophylactic treatments and applications in which a subject's risk of developing a disorder or other risk factors is reduced. Treatment does not require a complete cure of a disorder, but includes embodiments in which symptoms or underlying risk factors are reduced. The term "prevent" does not require 100% elimination of the likelihood of an event. Rather, it means that the likelihood of an event occurring is reduced in the presence of a compound or method.

[0230] Standard techniques can be used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection). Enzymatic reactions and purification techniques can be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The techniques and procedures described above can generally be performed according to conventional methods known in the art and as described in the various general and more specific references cited and discussed throughout the specification. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, 1999). Harbor Laboratory Press, Cold Spring Harbor, NY (1989), incorporated herein by reference for any purpose.

[0231] Citation by reference All publications, patents, and patent applications mentioned in this specification are incorporated herein by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated herein by reference. However, the citation of a reference herein should not be construed as an admission that such reference is prior art to the present invention. In the event that any definitions or terms provided in a reference incorporated herein by reference differ from the terms and discussion provided herein, the terms and definitions of the present invention shall control.

[0232] The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the invention. The foregoing description and examples detail certain preferred embodiments of the invention and provide the inventors with It will be understood, however, that no matter how detailed the above description, the invention can be practiced in many ways and that the invention should be construed in accordance with the appended claims and any equivalents thereof.

[0233] The following examples, including the experiments performed and results achieved, are offered for illustrative purposes only and are not to be construed as limiting the invention. EXAMPLES

[0234] Example 1 Determination of CLL-1 CAR activity by mRNA electroporation in human PBMCs. Plasmids encoding the T7 promoter, CAR construct and beta globin stabilizing sequence were prepared by digesting 10 μg of DNA with EcoRI and BamHI (NEB) overnight. The DNA was then linearized by cleavage with Proteinase K (Thermo Fisher™). The DNA was digested with 100 mM EDTA (600 U / ml) for 2 hours at 50°C, purified with phenol / chloroform, and precipitated by adding sodium acetate and 2 volumes of ethanol. The pellet was then dried, resuspended in RNase / DNase free water, and quantified. 1 μg of linear DNA was then used for in vitro PCR amplification using the mMESSAGE mMACHINE T7 Ultra (Thermo Fisher™) according to the manufacturer's instructions. o Transcription was allowed to occur. RNA was purified using the MEGAClear kit (Thermo Fisher™). The mRNA was further purified using a NanoDrop™ according to the manufacturer's instructions and quantified. The integrity of the mRNA was assessed by agarose gel running.

[0235] Various cancer cell lines were evaluated for CLL-1 expression. Namalwa (ATCC), U937 (ATCC), HL-60 (ATCC), EoL-1 (Sigma), KG1a (ATCC), and ATCC were used. MV4;11 (ATCC) and MV4;11 (ATCC) cells were stained with staining buffer (BD Pharmingen™ 4) with anti-CLL-1 antibody conjugated to PE (BD Pharmingen™) in The cells were then stained at 4°C for 30 min. before data acquisition. The samples were then resuspended in staining buffer containing Pharmingen™. Data was acquired by cytometry, analyzed, and plotted into histograms using FlowJo™. The results of CLL-1 expression can be seen in Figure 1.

[0236] PBMCs were isolated from leukopaks (Hemacare™) of healthy donors using ficoll-paque density centrifugation according to the manufacturer's instructions. PBMCs were stimulated with OKT3 (50 ng / ml, Miltenyi Biotec™) in R10 medium supplemented with IL-2 (300 IU / ml, Proleukin™, Prometheus™ Therapeutics and Diagnostics). On day 7 of stimulation Afterwards, T cells were washed twice with Opti-MEM™ (Thermo Fisher Scientific™) and cultured at 2.5 × 10 7 Cells were resuspended in Opti-MEM at a final concentration of cells / ml. 10 μg of mRNA was used per electroporation. Cells were electroporated in a 2 mm cuvette (Harvard Apparatus BTX™) at a single The experiment was performed using a Gemini X2 system (Harvard Apparatus BTX™) set to deliver a 0.5 ms pulse. Cells were immediately transferred to R10+IL-2 medium and then cultured. The cells were diluted to 0.5 × 10 before use in the activity assay. 6 cells / ml~2.0×10 6 cells / ml.

[0237] Six hours after mRNA electroporation, T cells were stained with biotinylated Protein L (Thermo Scientific™) in staining buffer (BD Pharmingen™) for 30 minutes at 4°C. Cells were then washed and stained with PE-streptavidin (BD Pharmingen™) in staining buffer for 30 minutes at 4°C. Cells were then washed and stained with PE-streptavidin (BD Pharmingen™) in staining buffer for 30 minutes at 4°C. Cells were then washed and stained with PE-streptavidin (BD Pharmingen™) in staining buffer for 30 minutes at 4°C before data acquisition. The cells were washed and resuspended in staining buffer containing propidium iodide (BD Pharmingen™). The results of CAR detection are shown in Figure 2.

[0238] Effector cells were cultured in R10 medium with target cells at an E:T ratio of 1:1 6 hours after mRNA electroporation. Cell lines tested included Namalwa, U937, HL-60, EoL-1, KG1a and MV4;11. After 16 hours of co-culture, cells were cultured at 1:1 E:T ratio with target cells at 1:1 E:T ratio ... were cultured at 1:1 E:T ratio with target cells at 1:1 E:T ratio 6 hours after mRNA electroporation. Cell lines were cultured at 1:1 E:T ratio with target cells at 1:1 Supernatants were analyzed and target cell viability was assessed by flow cytometric analysis of propidium iodide (PI) uptake. Results corresponding to the cytokine release assay can be seen in Figure 3. Results of the cytolytic activity assay can be seen in Figures 4 and 5.

[0239] Example 2 Determination of CLL-1 CAR activity by lentiviral transduction of human PBMCs. ViraPower™ Lentiviral Packaging Mix (Life Technologies, Inc.) Lentiviral supernatants were generated using third generation lentiviral transfer vectors containing various CLL-1 CAR constructs along with the target gene (TNF-α, 10 ... 6 Three days after transfection, the supernatant was collected, filtered through a 0.45 μm filter, and stored at −80° C. until use.

[0240] PBMCs were isolated from leukopaques (Hemacare™) of healthy donors using ficoll-paque density centrifugation according to the manufacturer's instructions. PBMCs were stimulated with OKT3 (50 ng / ml, Miltenyi Biotec™) in R10 medium supplemented with IL-2 (300 IU / ml, Proleukin™, Prometheus™ Therapeutics and Diagnostics). 48 hours after stimulation, lenalidomide was added to the PBMCs. The cells were transduced with 0.5 × 10 HIV-1 viruses at an MOI of 10 before being used in the activity assay. 6 cells / ml~2.0×10 6 cells / ml.

[0241] Twelve days after stimulation, T cells were stained with biotin in staining buffer (BD Pharmingen™). The cells were then stained with methylated Protein L (Thermo Scientific™) for 30 minutes at 4°C. The cells were then washed and stained with PE-streptavidin (BD Pharmingen™) in staining buffer. ) for 30 minutes at 4°C. The cells were then washed and resuspended in staining buffer containing propidium iodide (BD Pharmingen™) before data acquisition. The results are shown in Figure 6.

[0242] Effector cells were cultured in R10 medium with target cells at an E:T ratio of 1:1 12 days after T cell stimulation. Cell lines tested included Namalwa, U937, HL-60, EoL-1, KG1a and MV4;11. After 16 hours of co-culture, supernatants were analyzed by Luminex (EMD Millipore™) according to the manufacturer's instructions. The viability of target cells was assessed by flow cytometric analysis of propidium iodide (PI) uptake. The corresponding results for the cytokine release assay can be seen in Figure 7. The results for the cytolytic activity assay can be seen in Figure 8.

[0243] Example 3 Five- to six-week-old female Jackson NSG mice (NOD.Cg-Prkdc scid Il2rg tm1Wjl Mice were fed irradiated Harlan 2918.15 Rodent Diet and water ad libitum. The facility is equipped with a bubble environment with HEPA-filtered air at 100 full air changes per hour. Mice were housed in Innovive™ disposable ventilated cages with corn cob bedding in a Biobubble™ Clean Room that provided a bubble environment. All procedures, weight determinations, and tumor measurements were performed in the bubble environment. The environment was controlled at a temperature range of 70°±2°F and a humidity range of 30% to 70%. All procedures were performed in compliance with all National Institutes of Health (NIH) laws, regulations, and guidelines and were maintained by Molecular Imaging, Inc. The experiment was conducted with the approval of the experimental committee.

[0244] Tumor cell preparation U937-luc cells were obtained in Lifor™ Preservation Solution. Cells were centrifuged at 200rcf for 8 minutes at 4°C, the supernatant was aspirated, and the pellet was resuspended in cold Dulbecco's Phosphate Buffered Saline (DPBS) by pipetting. An aliquot of the homogenous cell suspension was diluted in trypan blue solution and counted using a Luna™ automated cell counter. The cell suspension was centrifuged at 200rcf for 8 minutes at 4°C. The supernatant was aspirated, and the cell pellet was resuspended in cold serum-free medium to yield a final concentration of trypan-excluding cells / ml. The cell suspension was kept on wet ice during implantation. On day 0, test animals were inoculated with 0.2ml of PBS using a 27-gauge needle and syringe. Medium 1.00E+06 cells were implanted intravenously via the lateral tail vein.

[0245] CAR T cell preparation The T cells according to the invention were obtained, frozen on dry ice and stored in liquid nitrogen. On the day of treatment, the prepared cryovials were removed from cryostorage and Thawed in a 37°C water bath. For each group, prepared T cells were combined into a single 50 ml conical tube containing warm RPMI 1640 supplemented with 10% FBS. Cryovial tubes were rinsed with warm RPMI 1640 with 10% FBS to minimize cell loss achieving a total volume of 50 ml in each conical tube. Each 50 ml conical tube was centrifuged at 200 rcf for 8 minutes at 4°C. The supernatant was aspirated and the cell pellet was resuspended in 10 ml of room temperature DPBS. An aliquot of the homogenous cell suspension was diluted in trypan blue solution and manually counted using a hemocytometer. The cell suspension was centrifuged again at 200 rcf for 8 minutes at 4°C. The supernatant was aspirated and the cell pellet was resuspended in room temperature DPBS to produce the required final concentration. The cell suspension was kept on wet ice during treatment administration.

[0246] Bioluminescence imaging In vivo bioluminescence imaging (BLI) was performed using an IVIS Spectrum (Perkin Elmer, Hopkinton, MA). Animals were imaged up to five times at a time under approximately 1%-2% isoflurane gas anesthesia. Each mouse was injected IP with 150 mg / kg (15 mg / ml) D-luciferin and imaged 10 minutes after injection in the prone position followed by the supine position. Binning of large and small CCD chips was used and exposure times were adjusted (2 seconds to 2 minutes) to obtain at least several hundred counts per image while avoiding saturation of the CCD chip. BLI images were collected on days 3, 11, 18, and 25. Images were analyzed using Living Image version 4.5 (Perkin Elmer, Hopkinton, MA) software. Whole-body constant volume ROIs were placed on the prone and supine images for each individual animal and labeled based on the animal's identity. Total intensity, expressed in photons / second (p / s), was calculated and exported for all ROIs to facilitate analysis between groups. Total tumor burden was estimated by summing the prone and supine ROIs.

[0247] treatment All mice were selected into study groups based on BLI estimation of total body tumor burden, and were distributed such that the mean tumor burden in all groups was within 10% of the mean tumor burden in the entire study population. Treatment with CAR T cells began on day 3. All mice received a fixed volume of 0.2 mL. The results are shown in Figure 10.

[0248] Evaluation of side effects All animals were observed for clinical signs at least once daily. Animals were weighed on each treatment day. Individual body weights were recorded three times weekly.

[0249] The invention is further illustrated by the following sequences.

[0250] CD28T DNA extracellular, transmembrane, intracellular CTTGATAATGAAAAGTCAAACGGAACAATCATTCACGTGAAGGGCAAGCACCTCTGTCCGTCACCCTTGTTCCCTGGTCCATCCAAGCCATTCTGGGTGTTGGTCGTAGTGGGTGGAGTCCTCGCTTGTTACTCTCTGCTCGTCACCGTG GCTTTTATAATCTTCTGGGTTAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGC (SEQ ID NO: 1)

[0251] CD28T extracellular, transmembrane, intracellular AA LDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 2)

[0252] CD28T DNA-extracellular CTTGATAATGAAAAGTCAAACGGAACAATCATTCACGTGAAGGGCAAGCACCTCTGTCCGTCACCCTTGTTCCCTGGTCCATCCAAGCCA (SEQ ID NO: 3)

[0253] CD28T AA-Extracellular LDNEKSNGTI IHVKGKHLCP SPLFPGPSKP (SEQ ID NO: 4)

[0254] CD28 DNA transmembrane domain TTCTGGGTGTTGGTCGTAGTGGGTGGAGTCCTCGCTTGTTACTCTCTGCTCGTCACCGTGGCTTTTATAATCTTCTGGGTT (SEQ ID NO: 5)

[0255] CD28 AA transmembrane domain FWVLVVVGGV LACYSLLVTV AFIIFWV (SEQ ID NO: 6)

[0256] CD28 DNA intracellular domain AGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGC (SEQ ID NO: 7)

[0257] CD28 AA intracellular domain RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 8)

[0258] CD3 zeta DNA AGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCAGGAGGGT CTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG (SEQ ID NO: 9)

[0259] CD3 Zeta AA RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 10)

[0260] CD3 zeta variant AA RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 146)

[0261] CD28 DNA ATTGAGGTGATGTATCCACCGCCTTACCTGGATAACGAAAAGAGTAACGGTACCATCATTCACGTGAAAGGTAAACACCTGTGTCCTTCTCCCCTCTTCCCGGGCCATCAAAGCCC (SEQ ID NO: 11)

[0262] CD28 AA IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 12)

[0263] CD8 DNA extracellular & transmembrane domains GCTGCAGCATTGAGCAACTCAATAATGTATTTTAGTCACTTTGTACCAGTGTTCTTGCCGGCTAAGCCTACTACCACACCCGCTCCACGGCCACCTACCCCAGCTCCTACCATCGCTTCACAGCCTCTGTCCCTGCGCCCAGAGGCTT GCCGACCGGCCGCAGGGGGCGCTGTTCATACCAGAGGACTGGATTTCGCCTGCGATATCTATATCTGGGCACCCCTGGCCGGAACCTGCGGCGTACTCCTGCTGTCCCTGGTCATCACGCTCTATTGTAATCACAGGAAC (SEQ ID NO: 13)

[0264] CD8 AA extracellular & transmembrane domains AAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 14)

[0265] Clone 24C1 HC DNA CAGGTGCAGCTGCAGGAATCCGGACCGGGGCTGGTGAAGCCCAGCGAGACTCTGAGTCTCACGTGTACAGTTTCTGGAGGTAGCATTAGCTCCTACTATTGGTCATGGATAAGGCAGCCCCCCGGGAAGGGATTGGAATGGATCGGCTATATTTACTACAGTGGGAGCACCAATTACAACCCCTCAC TGAAGTCTAGAGTTACAATCAGCGTTGACACCTCAAAGAATCAGTTCAGTTTGAAATTGTCTAGCGTCACAGCAGCTGATACAGCCGTCTATTATTGTGTTTCTCTGGTCTATTGCGGTGGGGATTGTTACAGTGGCTTTGACTATTGGGGGCAGGGTACTCTGGTTACAGTTTCTTCC (SEQ ID NO: 15)

[0266] Clone 24C1 HC AA (CDRs are underlined) QVQLQESGPGLVKPSETLSLTCTVS GGSISSY YWSWIRQPPGKGLEWIGY I YYSGS TNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCVS LVYCGGDCYSGFDY WGQGTLVTVSS (SEQ ID NO: 16)

[0267] Clone 24C1 HC AA CDR1: GGSISSY (SEQ ID NO: 17)

[0268] Clone 24C1 HC AA CDR2: YYSGS (SEQ ID NO: 18)

[0269] Clone 24C1 HC AA CDR3: LVYCGGDCYS GFDY (SEQ ID NO: 19)

[0270] Clone 24C1 LC DNA GACATCCAGTTGACACAGAGCCCGAGTTCCTTGTCCGCCTCCGTCGGGGATAGAGTGTCATTTACCTGTCAGGCCTCTCAGGATATTAATAACTTTCTGAATTGGTATCAGCAAAAGCCCGGAAAGGCACCCAAGCTGTTGATTTACGACGCCAGTAACCTGGAGA CAGGCGTGCCCTCCCGGTTTAGTGGTAGCGGAAGCGGTACGGATTTTACCTTTACTATCAGCTCTCTCCAACCCGAAGACATTGCAACCTACTATTGTCAACAATATGGAAACCTGCCTTTTACATTTGGCGGCGGCACCAAGGTGGAGATTAAGCGG (SEQ ID NO: 20)

[0271] Clone 24C1 LC AA (CDRs are underlined) DIQLTQSPSSLSASVGDRVSFTC QASQDINNFLN WYQQKPGKAPKLLIY DASNLET GVPSRFSGSGSGTTDFTFTISSLQPEDIATYYC QQYGNLPFT FGGGTKVEIKR (SEQ ID NO:21)

[0272] Clone 24C1 LC CDR1 AA: QASQDINNFLN (SEQ ID NO: 22)

[0273] Clone 24C1 LC CDR2 AA:DASNLET (SEQ ID NO:23)

[0274] Clone 24C1 LC CDR3 AA:QQYGNLPFT (SEQ ID NO:24)

[0275] Clone 24C1 CD28T CD3 Zeta CAR DNA heavy and light chains

[0276] TIFF0007673272000005.tif47170

[0277] Clone 24C1 CD28T CD3 Zeta CAR DNA heavy and light chains CAGGTCCAACTGCAAGAAAGCGGACCCGGACTGGTGAAGCCTTCTGAGACACTTAGTCTGACGTGCACGGTCAGTGGCGGCTCCATCTCCTCCTATTATTGGTCATGGATACGACAACCCCCAGGTAAGGGCCTGGAATGGATTGGCTATATCTACTATTCAGGAAGCACGAACTACAATCCCAGCCTGAAGTCCCGAGTGACAATTTCAGTAGATACCAGTAAAAACCAGTTCAGTCTTAAACTGTCAAGCGTGACAGCTGCCGACACCGCTGTGTATTACTGCGTCTCACTGGTGTATTGTGGAGGGGATTGTTATAGCGGGTTCGATTATTGGGGACAGGGAACCCTGGTGACTGTATCTTCCGGCGGCGGCGGCTCAGGGGGTGGCGGTAGTGGCGGTGGGGGTTCCGATATTCAACTGACACAATCCCCCAGCTCACTCAGCGCCAGCGTGGGGGACAGGGTTAGCTTTACCTGTCAAGCCTCTCAGGATATAAATAACTTTCTGAACTGGTATCAACAGAAGCCTGGGAAGGCGCCCAAACTCCTGATCTATGATGCGTCCAACCTGGAAACTGGCGTGCCTTCACGCTTTAGCGGCTCTGGCAGTGGTACAGACTTCACTTTTACCATCTCTTCACTTCAGCCGGAGGACATCGCCACATATTACTGTCAACAGTACGGAAACTTGCCCTTTACTTTTGGAGGCGGCACCAAAGTTGAAATCAAAAGGGCCGCTGCCCTGGATAACGAAAAGAGCAATGGGACTATAATACATGTTAAAGGAAAACACCTGTGTCCATCTCCCCTGTTCCCTGGACCGTCAAAGCCATTTTGGGTGCTCGTGGTTGTCGGTGGCGTTCTCGCCTGTTATAGCTTGCTGGTGACAGTAGCCTTCATTATCTTTTGGGTGAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATG ACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGA TGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG (SEQ ID NO: 27)

[0278] Clone 24C1 CD28T CD3 Zeta CAR AA heavy and light chains QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCVSLVYCGGDCYSGFDYWGQGT LVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPF TFGGGTKVEIKRAAALDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 28)

[0279] Clone 24C1 CD28 CD3 Zeta CAR DNA heavy and light chains

[0280] TIFF0007673272000006.tif47169

[0281] Clone 24C1 CD28 CD3 Zeta CAR DNA heavy and light chains CAGGTGCAGCTGCAGGAATCCGGACCGGGGCTGGTGAAGCCCAGCGAGACTCTGAGTCTCACGTGTACAGTTTCTGGAGGTAGCATTAGCTCCTACTATTGGTCATGGATAAGGCAGCCCCCCGGGAAGGGATTGGAATGGATCGGCTATATTTACTACAGTGGGAGCACCAATTACAACCCCTCACTGAAGTCTAGAGTTACAATCAGCGTTGACACCTCAAAGAATCAGTTCAGTTTG

[0282] Clone 24C1 CD28 CD3 Zeta CAR AA heavy and light chains QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCVSLVYCGGDCYSGFDYW GQGTLVTVSSGGGGSGGGGGSGGGGSDIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYC QQYGNLPFTFGGGTKVEIKRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST ATKDTYDALHMQALPPR (SEQ ID NO: 32)

[0283] Clone 24C1 CD8 CD3 Zeta CAR DNA heavy and light chains

[0284] TIFF0007673272000007.tif47169

[0285] Clone 24C1 CD8 CD3 Zeta CAR DNA heavy and light chains

[0286] Clone 24C1 CD8 CD3 Zeta CAR AA heavy and light chains QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCVSLVYCGGDCYSGFDYWGQGTLVTV SSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPFTFGGGGTK VEIKRAAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRR PGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR (SEQ ID NO:36)

[0287] Clone 24C1 CD28T CD3 Zeta CAR DNA heavy and light chains ATGGCACTCCCCGTAACTGCTCTGCTGCTGCCGTTGGCATTGCTCCTGCACGCCGCACGCCCGGATATCCAGCTCACGCAATCCCCCTCAAGCTTGAGTGCCTCCGTGGGCGACCGGGTGTCCTTCACATGTCAGGCAAGCCAAGACATAAATAATTTCCTGAATTGGTACCAACAAAAACCCGGCAAGGCTCCCAAACTCCTGATTTATGATGCCTCCAATCTGGAGACCGGGGTCCCTTCTAGATTCAGCGGAAGTGGCAGCGGCACAGACTTTACATTTACTATCTCTTCTCTGCAACCAGAGGACATCGCCACATACTATTGCCAGCAATACGGCAATCTGCCCTTCACCTTCGGAGGCGGAACCAAGGTAGAAATTAAAAGGGGCGGTGGAGGCTCCGGAGGGGGGGGCTCTGGCGGAGGGGGCTCCCAAGTACAATTGCAGGAGTCAGGGCCTGGACTCGTGAAGCCTTCAGAAACTTTGTCACTGACATGTACAGTGTCCGGCGGAAGCATTTCCAGTTACTATTGGTCCTGGATTAGACAGCCACCCGGCAAAGGACTGGAATGGATTGGATATATCTACTACTCTGGATCTACAAACTATAATCCCAGCCTCAAATCCAGGGTCACTATTA GTGTGGATACATCAAAGAATCAGTTCTCCTTGAAGCTGAGCTCAGTCACTGCTGCCGACACCGCAGTGTACTATTGTGTGAGCCTGGTCTACTGCGGCGGAGATTGCTACAGCGGTTTCGATTACTGGGGCCAGGGCACCCTGGTTACCGTTAGTTCCGCGGCTGCTCTTGATAACGAGAAGTCCAACGGTACGATTATCCACGTTAAGGGTAAGCACCTTTGCCCTAGCCCGCTGTTCCCAGGCCCCAGTAAGCCCTTTTGGGTCCTCGTTGTGGTAGGTGGGGTACTCGCCTGCTACTCCCTGCTCGTCACTGTCGCATTCATCATCTTCTGGGTCAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGGTAA(SEQ ID NO: 37)

[0288] TIFF0007673272000008.tif47169

[0289] Clone 24C1 CD28T CD3 zeta CAR DNA heavy chain & light chain

[0290] Clone 24C1 CD28T CD3 Zeta CAR AA heavy and light chains DIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPFTFGGGGTKVEIKRGGGGSGG GSGGGGSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCVSLVYCGGDCYSGFD YWGQGTLVTVSSAAALDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 40)

[0291] Clone 24C1 CD28 CD3 Zeta CAR DNA AA heavy and light chains

[0292] TIFF0007673272000009.tif47169

[0293] Clone 24C1 CD28 CD3 Zeta CAR DNA heavy and light chains

[0294] Clone 24C1 CD28 CD3 Zeta CAR AA heavy and light chains DIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPFTFGGGGTKVEIKRGGGGSGGGS GGGGSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCVSLVYCGGDCYSGFDYWG QGTLVTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 4) 4)

[0295] Clone 24C1 CD8 CD3 Zeta CAR DNA heavy and light chains

[0296] TIFF0007673272000010.tif47169

[0297] Clone 24C1 CD8 CD3 zeta CAR DNA heavy chain & light chain GACATTCAATTGACCCAGTCCCCTAGCAGTCTCTCAGCAAGTGTGGGAGATAGGGTGTCATTCACCTGTCAGGCTTCACAGGACATCAACAACTTCCTCAATTGGTATCAGCAGAAGCCAGGGAAGGCACCAAAGCTGCTCATATATGACGCTTCAAACCTTGAAACCGGAGTACCTAGCCGCTTCAGCGGAAGCGGATCAGGGACTGACTTCACTTTTACCATCTCTTCACTGCAGCCCGAAGACATCGCCACATACTACTGCCAGCAGTACGGAAACTTGCCTTTTACATTTGGGGGCGGCACCAAAGTGGAGATTAAGCGAGGGGGAGGCGGCTCAGGAGGCGGTGGCTCCGGAGGCGGGGGTTCCCAGGTCCAGCTCCAGGAATCCGGCCCAGGTCTGGTTAAGCCCAGTGAAACTTTGTCCCTCACGTGTACTGTGAGCGGTGGTTCAATCTCCTCATACTATTGGTCTTGGATACGGCAACCTCCTGGAAAGGGCCTCGAGTGGATCGGCTATATCTACTATAGTGGCTCCACTAATTACAACCCTTCCCTCAA GTCCAGAGTCACCATTTCCGTGGACACATCTAAGAACCAGTTCAGTCTGAAGTTGTCCAGCGTTACAGCCGCAGACACAGCCGTTTATTACTGTGTGTCTCTTGTTTACTGCGGGGGAGACTGTTATAGCGGCTTCGATTACTGGGGCCAGGGCACCTTGGTCACAGTCTCTTCCGCGGCCGCCCTCTCTAACAGTATTATGTACTTTTCTCATTTTGTACCCGTGTTCCTTCCCGCTAAGCCAACTACTACCCCGGCCCCACGGCCGCCTACCCCTGCACCCACAATAGCCAGTCAGCCTTTGAGCCTGAGACCTGAGGCTTGTCGGCCGGCTGCTGGGGGTGCAGTGCACACACGAGGTCTTGATTTTGCTTGCGACATATACATCTGGGCCCCTCTGGCCGGGACCTGTGGGGTGCTGCTTCTGAGCTTGGTCATCACGCTCTATTGCAACCATCGCAACAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG (SEQ ID NO: 47)

[0298] Clone 24C1 CD8 CD3 zeta CAR AA Heavy Chain & Light Chain DIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPFTFGGGTKVEIKRGGGGSGGGGSG GGGSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTADTAVYYCVSLVYCGGDCYSGFDYWGQGTL VTVSSAAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQA LPPR (SEQ ID NO: 48)

[0299] Clone 24C8 heavy chain (HC) DNA CAGGTACAGCTGCAGGAATCTGGGCCCGGACTTGTCAAGCCAAGTCAGACACTTTCTCTTACATGTACCGTGAGCGGCGGAAGTATAAGCAGTGGAGGCTTTTACTGGTCTTGGATACGGCAGCACCCAGGCAAAGGCTTGGAGTGGATTGGATACATTCATCATTCAGGATCTACACACTATAATCCAT CCCTTAAGTCCCGGGTCACCATTAGCATTGATACGTCTAAGAATCTGTTCAGTCTCAGGCTGTCCTCCGTCACTGCTGCCGACACAGCCGTGTACTACTGCGCCTCCTTGGTTTACTGCGGAGGCGACTGTTATAGCGGCTTTGATTATTGGGGGCAGGGGACCCTCGTAACCGTGAGCTCT (SEQ ID NO: 48)

[0300] Clone 24C8 AA HC (CDRs are underlined) QVQLQESGPGLVKPSQTLSLTCTVS GGSISSGGF YWSWIRQHPGKGLEWIGYI HHSGS THYNPSLKSRVTISIDTSKNLFSLRLSSVTAADTAVYYCAS LVYCGGDCYSGFDY WGQGTLVTVSS (SEQ ID NO:50)

[0301] Clone 24C8 HC CDR1 AA:GGSISSGGF (SEQ ID NO:51)

[0302] Clone 24C8 HC CDR2 AA:HHSGS (SEQ ID NO:52)

[0303] Clone 24C8 HC CDR3 AA:LVYCGGDCYS GFDY (SEQ ID NO:53)

[0304] Clone 24C8 light chain (LC) DNA GATATCCAGCTCACTCAAAGCCCCTCTAGTCTCTCTGCCTCAGTGGGGGATCGGGTCAGTTTTACTTGTCAAGCTTCACAGGATATCAACAACTTCCTTAATTGGTATCAGCAGAAGCCAGGAAAAGCACCCAAGCTGCTCATCTATGATGCCTCAAATTTGGAGA CGGGTGTTCCCAGTCGATTCTCTGGGTCAGGGTCCGGGACCGACTTTACGTTTACGATCTCCTCTCTGCAGCCCGAAGACATCGCCACATACTATTGTCAACAGTACGGCAACTTGCCTTTCACATTTGGGGGCGGGACTAAGGTTGAAATCAAGAGG (SEQ ID NO: 54)

[0305] Clone 24C8 LC AA (CDRs are underlined) DIQLTQSPSSLSASVGDRVSFTC QASQDINNFLN WYQQKPGKAPKLLIY DASNLET GVPSRFSGSGSGTTDFTFTISSLQPEDIATYYC QQYGNLPFTFGGGTKVEIKR (SEQ ID NO:55)

[0306] Clone 24C8 LC CDR1 AA: QASQDINNFLN (SEQ ID NO: 56)

[0307] Clone 24C8 LC CDR2 AA:DASNLET (SEQ ID NO:57)

[0308] Clone 24C8 LC CDR3 AA:QQYGNLPFT (SEQ ID NO:58)

[0309] Clone 24C8 CD28T CD3 Zeta CAR DNA heavy and light chains

[0310] TIFF0007673272000011.tif47169

[0311] Clone 24C8 CD28T CD3 Zeta CAR DNA heavy and light chains CAGGTACAGCTGCAGGAATCTGGGCCCGGACTTGTCAAGCCAAGTCAGACACTTTCTCTTACATGTACCGTGAGCGGCGGAAGTATAAGCAGTGGAGGCTTTTACTGGTCTTGGATACGGCAGCACCCAGGCAAAGGCTTGGAGTGGATTGGATACATTCATCATTCAGGATCTACACACTATAATCCATCCCTTAAGTCCCGGGTCACCATTAGCATTGATACGTCTAAGAATCTGTTCAGTCTCAGGCTGTCCTCCGTCACTGCTGCCGACACAGCCGTGTACTACTGCGCCTCCTTGGTTTACTGCGGAGGCGACTGTTATAGCGGCTTTGATTATTGGGGGCAGGGGACCCTCGTAACCGTGAGCTCTGGAGGGGGTGGGAGCGGGGGAGGAGGTTCAGGGGGGGGCGGCTCCGATATCCAGCTCACTCAAAGCCCCTCTAGTCTCTCTGCCTCAGTGGGGGATCGGGTCAGTTTTACTTGTCAAGCTTCACAGGATATCAACAACTTCCTTAATTGGTATCAGCAGAAGCCAGGAAAAGCACCCAAGCTGCTCATCTATGATGCCTCAAATTTGGAGACGGGTGTTCCCAGTCGATTCTCTGGGTCAGGGTCCGGGACCGACTTTACGTTTACGATCTCCTCTCTGCAGCCCGAAGACATCGCCACATACTATTGTCAACAGTACGGCAACTTGCCTTTCACATTTGGGGGCGGGACTAAGGTTGAAATCAAGAGGGCCGCTGCACTGGACAATGAGAAGTCCAACGGCACCATCATCCACGTGAAGGGCAAGCACCTGTGCCCTAGTCCTCTGTTCCCAGGCCCATCCAAACCTTTTTGGGTTCTTGTTGTGGTCGGGGGGGTGCTGGCCTGCTATTCTCTGCTGGTCACGGTGGCCTTCATAATTTTCTGGGTTAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATG AATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTG AGATGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG (SEQ ID NO: 61)

[0312] Clone 24C8 CD28T CD3 Zeta CAR AA heavy and light chains QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGFYWSWIRQHPGKGLEWIGYIHHSGSTHYNPSLKSRVTISIDTSKNLFSLRLSSVTAADTAVYYCASLVYCGGDCYSGFDYWGQG TLVTVSSGGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTFTFTISSLQPEDIATYYCQQYGNLP FTFGGGTKVEIKRAAALDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 62)

[0313] Clone 24C8 CD28 CD3 Zeta CAR DNA heavy and light chains

[0314] TIFF0007673272000012.tif46169

[0315] Clone 24C8 CD28 CD3 Zeta CAR DNA heavy and light chains CAGGTGCAGCTGCAGGAAAGCGGTCCGGGACTTGTCAAGCCGTCCCAAACGCTGAGTCTGACGTGTACTGTCTCTGGTGGCTCTATTTCTTCCGGGGGCTTTTATTGGTCTTGGATCAGACAACACCCTGGCAAAGGGCTGGAGTGGATAGGGTATATTCACCACTCTGGGTCCACTCACTACAACCCATCATTGAAATCCAGAGTGACTATCTCAATCGACACATCCAAGAACCTTTTTC

[0316] Clone 24C8 CD28 CD3 Zeta CAR AA heavy and light chains QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGFYWSWIRQHPGKGLEWIGYIHHSGSTHYNPSLKSRVTISIDTSKNLFSLRLSSVTAADTAVYYCASLVYCGGDCYSGFDYWGQGT LVTVSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPFTF GGGTKVEIKRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (sequence number 66)

[0317] Clone 24C8 CD8 CD3 Zeta CAR DNA heavy and light chains

[0318] TIFF0007673272000013.tif47169

[0319] Clone 24C8 CD8 CD3 Zeta CAR DNA heavy and light chains

[0320] Clone 24C8 CD8 CD3 Zeta CAR AA heavy and light chains QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGFYWSWIRQHPGKGLEWIGYIHHSGSTHYNPSLKSRVTISIDTSKNLFSLRLSSVTAADTAVYYCASLVYCGGDCYSGFDYWGQGTLV TVSSGGGGSGGGSGGGGSDIQLTQSPSSLSASVGDRVSFTCQASQDINNFLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPFTFGGG TKVEIKRAAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTP RRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA TKDTYDALHM QALPPR (SEQ ID NO: 70)

[0321] Clone 20C5.1 HC DNA CAGGTCCAACTGGTGCAGTCCGGAGCCGAAGTCAAGAAACCAGGTGCCTCCGTTAAAGTGAGTTGCAAAGTCTCTGGATACACTCTGACCGAGCTCTCTATGCACTGGGTCCGGCAGGCCCCCGGCAAGGGATTGGAATGGATGGGCGGGTTCGATCCTGAGGACGGAGAGACTATCTACGCTCA AAAATTCCAGGGACGAGTGACTGTGACCGAAGACACTAGTACCGACACTGCCTACATGGAACTTTCCTCTCTGCGATCAGAAGATACCGCAGTGTACTACTGTGCTACTGAATCTAGGGGCATTGGATGGCCCTACTTCGATTACTGGGGTCAGGGAACTCTGGTGACTGTCTCCAGC (SEQ ID NO: 71)

[0322] Clone 20C5.1 AA HC (CDRs are underlined) QVQLVQSGAEVKKPGASVKVSCKVS GYTLTEL SMHWVRQAPGKGLEWMGGF DPEDGE TIYAQKFQGRVTVTEDTSTDTAY MELSSLRSEDTAVYYCAT ESRGIGWPYFDY WGQGTLVTVSS (SEQ ID NO:72)

[0323] Clone 20C5.1 HC AA CDR1: GYTLTEL (SEQ ID NO: 73)

[0324] Clone 20C5.1 HC AA CDR2: DPEDGE (SEQ ID NO: 74)

[0325] Clone 20C5.1 HC AA CDR3: ESRGIGWPYFDY (SEQ ID NO: 75)

[0326] Clone 20C5.1 LC DNA GATATTCAGATGACTCAATCTCCTTCTTCTCTGTCGCTTCCGTGGGCGATAGAGTGACCATTACTTGTAGGGCGTCCCAGTCAATCTCCAGTTATTTGAATTGGTATCAGCAGAAGCCCGGGAAAGCACCTAAGCTGTTGATCAGCGGGGCTTCTAGCCTGAAGA GTGGGGTACCTTCACGGTTCAGCGGAAGCGGAAGCGGAACCGATTTCACCCTGACTATCAGCAGCCTGCCACCTGAGGACTTTGCAACTTACTACTGCCAACAGTCATACAGCACTCCGATCACTTTCGGCCAGGGCACCCGGCTCGAAATCAAGCGC (SEQ ID NO: 76)

[0327] Clone 20C5.1 AA LC (CDRs are underlined) DIQMTQSPSSLSASVGDRVTITC RASQSISSYLN WYQQKPGKAPKLLIS GASSLKS GVPSRFSGSGSGTDFLTISSLPPEDFATYYC QQSYSTPIT FGQGTRLEIKR (SEQ ID NO:77)

[0328] Clone 20C5.1 AA LC CDR1: RASQSISSYLN (SEQ ID NO: 78)

[0329] Clone 20C5.1 AA LC CDR2: GASSLKS (SEQ ID NO: 79)

[0330] Clone 20C5.1 AA LC CDR3: QQSYSTPIT (SEQ ID NO: 80)

[0331] Clone 20C5.1 CD28T CD3 Zeta CAR DNA heavy and light chains SEQ ID NO:81)

[0332] TIFF0007673272000014.tif46169

[0333] Clone 20C5.1 CD28T CD3 Zeta CAR DNA heavy and light chains

[0334] Clone 20C5.1 CD28T CD3 Zeta CAR AA heavy and light chains QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTVTEDTSTDTAYMELSSLRSEDTAVYYCATESRGIGWPYFDYWGQGTL VTVSSGGGGSGGGGSGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLISGASSLKSGVPSRFSGSGSGTDFTLTISSLPPEDFATYYCQQSYSTPI TFGQGTRLEIKRAAALDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 84)

[0335] Clone 20C5.1 CD28 CD3 Zeta CAR DNA heavy and light chains ATGGCACTCCCCGTAACTGCTCTGCTGCTGCCGTTGGCATTGCTCCTGCACGCCGCACGCCCGCAGGTGCAGCTTGTGCAGAGCGGGGCCGAGGTGAAGAAGCCCGGGGCCAGCGTCAAAGTGTCCTGTAAGGTCAGCGGTTACACCCTCACCGAGCTGAGCATGCACTGGGTACGGCAGGCTCCCGGCAAAGGTCTTGAGTGGATGGGTGGATTTGATCCAGAAGATGGAGAGACTATCTACGCCCAGAAGTTCCAGGGCCGGGTCACCGTAACAGAAGACACCTCAACTGACACCGCTTACATGGAGCTGAGTTCACTGCGGTCCGAGGACACGGCCGTGTATTATTGTGCCACCGAGAGCCGCGGAATCGGATGGCCTTACTTCGACTACTGGGGACAGGGTACACTTGTTACAGTATCATCCGGGGGTGGCGGCTCTGGTGGGGGCGGCTCCGGAGGGGGTGGATCAGATATCCAAATGACTCAAAGTCCAAGTTCCCTGTCTGCCTCAGTCGGAGATAGAGTCACCATAACCTGCAGGGCAAGTCAGTCCATCTCCTCCTATCTGAACTGGTACCAACAGAAACCTGGAAAGGCGCCTAAGCTCCTGATCTCCGGAGCCTCATCTTTGAAATCCGGTGTCCCATCTCGCTTCAGTGGCTCTGGAAGCGGTACAGATTTTACTTTGACCATTAGCAGCCTCCCACCGGAAGACTTTGCTACATATTACTGCCAGCAGTCTTACTCAACCCCAATCACCTTCGGGCAAGGCACCAGACTCGAAATAAAAAGAGCAGC TGCTATCGAGGTTATGTACCCACCGCCGTACTTGGATAACGAAAAAAGCAATGGGACCATCATTCATGTGAAGGGTAAGCACCTTTGCCCTAGCCCACTGTTTCCTGGCCCGAGTAAACCCTTTTGGGTACTTGTGGTCGTCGGCGGCGTGCTGGCCTGCTACTCACTCCTGGTTACCGTCGCATTCATCATCTTTTGGGTGAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGGTAA (SEQ ID NO: 85)

[0336] TIFF0007673272000015.tif48169

[0337] Clone 20C5.1 CD28 CD3 zeta CAR DNA heavy chain & light chain

[0338] Clone 20C5.1 CD28 CD3 Zeta CAR AA heavy and light chains QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTVTEDTSTDTAYMELSSLRSEDTAVYYCATESRGIGWPYFDYWGQGT LVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLISGASSLKSGVPSRFSGSGSGTDFTLTISSLPPEDFATYYCQQSYST PITFGQGTRLEIKRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM QALPPR (SEQ ID NO: 8 8)

[0339] Clone 20C5.1 CD8 CD3 Zeta CAR DNA heavy and light chains

[0340] TIFF0007673272000016.tif48169

[0341] Clone 20C5.1 CD8 CD3 Zeta CAR DNA heavy and light chains TGGCAAACCAAGACGAAAAAACCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG (SEQ ID NO: 91)

[0342] Clone 20C5.1 CD8 CD3 Zeta CAR AA heavy and light chains QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTVTEDTSTDTAYMELSSLRSEDTAVYYCATESRGIGWPYFDYWGQGTLVTVSSGGGG SGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLISGASSLKSGVPSRFSGSGSGTDFTLTISSLPPEDFATYYCQQSYSTPITFGQGTRLEIKRAAALSN SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 92)

[0343] Clone 20C5.2 HC DNA CAGGTCCAGTTGGTCGAAAGTGGCGGTGGTGTAGTGCAGCCGGGCCGCAGTTTGAGGCTTTCCTGTGCGGCTTCAGGCTTTACTTTTTCCAGCTATGGAATGCACTGGGTGCGGCAGGCCCCCGGCAAAGGACTTGAGTGGGTGGCCGTCATTTCTTATGACGGATCAGATAAGTACTA CGTGGACAGCGTCAAGGGCAGATTCACCATCTCTAGGGACAACAGTAAAAATAGACTCTACCTCCAGATGAATAGCCTCAGAGCTGAAGACACGGCCGTCTACTATTGTGCTCGGGAGCGGTATAGTGGCAGAGACTACTGGGGGCAGGGCACACTCGTTACAGTGAGTAGC (SEQ ID NO: 93)

[0344] Clone 20C5.2 AA HC (CDRs are underlined) QVQLVESGGGVVQPGRSLRLSCAAS GFTFSSY GMHWVRQAPGKGLEWVAVI SYDGSD KYYVDSVKGRFTISRDNSKNRLYLQMNSLRAEDTAVYYCAR ERYSGRDY WGQGTLVTVSS (SEQ ID NO: 94)

[0345] Clone 20C5.2 HC AA CDR1: GFTFSSY (SEQ ID NO: 95)

[0346] Clone 20C5.2 HC AA CDR2: SYDGSD (SEQ ID NO: 96)

[0347] Clone 20C5.2 HC AA CDR3: ERYSGRDY (SEQ ID NO: 97)

[0348] Clone 20C5.2 LC DNA GAGATTGTTATGACCCAGAGTCCTGCGACCCTCTCAGTCAGCCCCGGGGAGCGCGCAACTTTGTCTTGCAGAGCTAGTCAGTCCGTGTCCTCTCTTCTGACATGGTACCAGCAAAAGCCCGGGCAGGCTCCGCGCCTTTTGATCTTTGGGGCTTCAACAAGAGCCA CTGGGATTCCCGCACGATTCTCTGGCTCCGGGAGCGGTACTGGTTTCACCCTGACGATTAGCAGTCTCCAGAGCGAGGACTTCGCCGTATACTACTGCCAGCAGTACGATACGTGGCCATTCACTTTTGGACCAGGGACTAAAGTGGATTTTAAGCGC (SEQ ID NO: 98)

[0349] Clone 20C5.2 AA LC (CDRs are underlined) EIVMTQSPATLSVSPGERATLSC RASQSVSSLLT WYQQKPGQAPRLLIF GASTRAT GIPARFSGSGSGTGFTLTISSLQSEDFAVYYC QQYDTWPFT FGPGTKVDFKR (SEQ ID NO: 99)

[0350] Clone 20C5.2 AA LC CDR1: RASQSVSSLLT (SEQ ID NO: 100)

[0351] Clone 20C5.2 AA LC CDR2: GASTRAT (SEQ ID NO: 101)

[0352] Clone 20C5.2 AA LC CDR3: QQYDTWPFT (SEQ ID NO: 102)

[0353] Clone 20C5.2 CD28T CD3 Zeta CAR DNA heavy and light chains ATGGCACTCCCCGTAACTGCTCTGCTGCTGCCGTTGGCATTGCTCCTGCACGCCGCACGCCCGCAGGTCCAGTTGGTCGAAAGTGGCGGTGGTGTAGTGCAGCCGGGCCGCAGTTTGAGGCTTTCCTGTGCGGCTTCAGGCTTTACTTTTTCCAGCTATG 3)

[0354] TIFF0007673272000017.tif47169

[0355] Clone 20C5.2 CD28T CD3 Zeta CAR DNA heavy and light chains (SEQ ID NO:105)

[0356] Clone 20C5.2 CD28T CD3 Zeta CAR AA heavy and light chains QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSDKYYVDSVKGRFTISRDNSKNRLY LQMNSLRAEDTAVYYCARERYSGRDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPATLSVSPGERATLSCRASQSVSSLLTWYQQKPGQAPRLLIFGASTRATGIPARFSGSGSGTGFTLTISSLQSEDFAVYYCQQYDTWPFTFGPGTKVDFKRAAALDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 106)

[0357] Clone 20C5.2 CD28 CD3 Zeta CAR DNA heavy and light chains

[0358] TIFF0007673272000018.tif47169

[0359] Clone 20C5.2 CD28 CD3 Zeta CAR DNA heavy and light chains CAGGTGCAGCTCGTGGAGTCTGGCGGCGGCGTGGTCCAGCCCGGCCGGTCCCTGCGCCTGTCCTGCGCCGCCAGCGGGTTTACTTTTTCCTCCTACGGCATGCACTGGGTGCGCCAGGCTCCCGGCAAGGGCCTCGAGTGGGTCGCCGTGATCTCATACGATGGGTCAGACAAATACTATGTCGATTCTGTTAAAGGGCGGTTTACCATTTCAAGAGATAACTCTAAGAATAGGCTGTATTTGCAGATGAACAGCCTGAGGGCTGAAGATACCGCAGTGTACTATTGCGCTAGGGAGCGGTATAGTGGCCGCGATTACTGGGGACAGGGTACACTGGTGACCGTGAGCTCTGGGGGTGGCGGAAGCGGGGGTGGCGGAAGCGGCGGAGGGGGTAGTGAAATTGTGATGACCCAGTCTCCGGCTACACTTTCAGTCTCCCCTGGGGAGAGAGCTACACTGTCATGCAGAGCGTCCCAGTCCGTCTCTTCTCTCCTTACCTGGTATCAGCAGAAGCCCGGCCAGGCTCCTCGACTGCTGATCTTCGGTGCCTCCACAAGGGCGACCGGGATTCCAGCCCGCTTCTCAGGTTCTGGGAGCGGAACTGGTTTCACTTTGACAATCAGTTCACTGCAGTCAGAGGATTTCGCCGTGTACTACTGCCAGCAATACGACACATGGCCATTCACTTTCGGACCCGGTACCAAAGTCGATTTCAAGAGAGCCGCGGCCATCGAGGTTATGTACCCACCACCATATCTGGACAATGAAAAAAGCAATGGAACCATTATCCATGTGAAGGGTAAACACCTCTGCCCTAGCCCACTTTTCCCTGGCCCATCAAAGCCCTTCTGGGTCTTGGTGGTCGTGGGGGGTGTGCTGGCCTGTTACAGCCTTCTGGTGACGGTTGCTTTCATTATCTTCTGGGTTAGATCCAAAAGAAGCCGCCTGCTCCATAGCGAT TACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACC CTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGG (SEQ ID NO: 109)

[0360] Clone 20C5.2 CD28 CD3 Zeta CAR AA heavy and light chains QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSDKYYVDSVKGRFTISRDNSKNRLYLQMNSLRAEDTAVYYCARERYSGRDYWGQGTLVTVSS GGGGSGGGGSGGGGSEIVMTQSPATLSVSPGERATLSCRASQSVSSLLTWYQQKPGQAPRLLIFGASTRATGIPARFSGSGSGTGFTLTISSLQSEDFAVYYCQQYDTWPFTFGPGTK VDFKRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 110)

[0361] Clone 20C5.2 CD8 CD3 Zeta CAR DNA heavy and light chains

[0362] TIFF0007673272000019.tif48169

[0363] Clone 20C5.2 CD8 CD3 Zeta CAR DNA heavy and light chains CAGGTGCAGTTGGTTGAATCAGGAGGGGGTGTGGTGCAACCCGGTCGGTCACTGCGCTCAGTTGTGCTGCTTCCGGGTT

[0364] Clone 20C5.2 CD8 CD3 Zeta CAR AA heavy and light chains QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSDKYYVDSVKGRFTISRDNSKNRLYLQMNSLRAEDTAVYYCARERYSGRDYWGQGTLVTVSSGGGGGSGG GGSGGGGSEIVMTQSPATLSVSPGERATLSCRASQSVSSLLTWYQQKPGQAPRLLIFGASTRATGIPARFSGSGSGTGFTLTISSLQSEDFAVYYCQQYDTWPTFGPGTKVDFKRAAALSNSIM YFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 114)

[0365] Clone 20C5.2 CD28T CD3 Zeta CAR DNA heavy and light chains 5)

[0366] TIFF0007673272000020.tif47169

[0367] Clone 20C5.2 CD28T CD3 Zeta CAR DNA heavy and light chains (SEQ ID NO:117)

[0368] Clone 20C5.2 CD28T CD3 Zeta CAR AA heavy and light chains EIVMTQSPATLSVSPGERATLSCRASQSVSSLLTWYQQKPGQAPRLLIFGASTRATGIPARFSGSGSGTGFTLTISSLQSEDFAVYYCQQYDTWPTFFGGPGTKVDFKRGGGGSGG GGSGGGGSQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSDKYYVDSVKGRFTISRDNSKNRLYLQMNSLRAEDTAVYYCARERYSGRDYWG QGTLVTVSSAAALDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 118)

[0369] Clone 20C5.2 CD28 CD3 Zeta CAR DNA heavy and light chains ATGGCACTCCCCGTAACTGCTCTGCTGCTGCCGTTGGCATTGCTCCTGCACGCCGCACGCCCGGAGATCGTCATGACACAGAGTCCAGCTACCCTGAGCGTGTCCCCTGGAGAGAGAGCCACCCTGTCCTGTAGGGCTAGTCAGAGTGTGTCCAGCCTCCTCACCTGGTATCAACAGAAGCCTGGTCAAGCTCCCCGGCTGCTTATCTTCGGGGCCAGCACGCGAGCCACAGGCATCCCGGCCAGATTCTCTGGCTCTGGCAGTGGCACCGGGTTCACTCTCACGATCTCATCCCTGCAGTCAGAGGATTTCGCTGTGTATTACTGTCAGCAGTACGATACATGGCCCTTCACCTTCGGCCCGGGCACAAAAGTAGATTTCAAGCGCGGCGGCGGGGGTAGTGGGGGCGGGGGATCAGGAGGAGGGGGCTCCCAAGTACAGCTGGTTGAGAGCGGCGGCGGGGTGGTTCAGCCCGGGCGCAGCCTCAGGCTGAGTTGCGCAGCATCAGGATTCACATTCAGTTCTTATGGAATGCATTGGGTCAGACAGGCTCCCGGGAAGGGCCTTGAATGGGTGGCAGTCATTAGCTACGACGGAAGCGATAAGTACTATGTGGACTCAGTTAAAGGGAGATTTACTATCAGCCGCGACAATTCCAAAAACAGATTGTATTTGCAGATGAACTCCCTCAGGGCGGAGGACACTGCTGTATATTACTGCGCACGAGAGAGATACTCCGGCCGAGACTATTGGGGCCAAGGAACATTGGTAACTGTGAGCTCCGCCGCAGCTATTGAGGT CATGTACCCCCCACCTTATCTCGATAATGAGAAGAGTAATGGGACTATAATTCACGTAAAGGGCAAACACCTGTGCCCTTCCCCGCTGTTTCCAGGTCCAAGTAAGCCGTTCTGGGTCCTGGTTGTGGTGGGAGGGGTGCTGGCCTGCTATTCTCTGTTGGTTACCGTGGCCTTTATCATTTTCTGGGTGAGATCCAAAAGAAGCCGCCTGCTCCATAGCGATTACATGAATATGACTCCACGCCGCCCTGGCCCCACAAGGAAACACTACCAGCCTTACGCACCACCTAGAGATTTCGCTGCCTATCGGAGCAGGGTGAAGTTTTCCAGATCTGCAGATGCACCAGCGTATCAGCAGGGCCAGAACCAACTGTATAACGAGCTCAACCTGGGACGCAGGGAAGAGTATGACGTTTTGGACAAGCGCAGAGGACGGGACCCTGAGATGGGTGGCAAACCAAGACGAAAAAACCCCCAGGAGGGTCTCTATAATGAGCTGCAGAAGGATAAGATGGCTGAAGCCTATTCTGAAATAGGCATGAAAGGAGAGCGGAGAAGGGGAAAAGGGCACGACGGTTTGTACCAGGGACTCAGCACTGCTACGAAGGATACTTATGACGCTCTCCACATGCAAGCCCTGCCACCTAGGTAA(SEQ ID NO: 119)

[0370] TIFF0007673272000021.tif47169

[0371] Clone 20C5.2 CD28 CD3 zeta CAR DNA heavy chain & light chain

[0372] Clone 20C5.2 CD28 CD3 Zeta CAR AA heavy and light chains EIVMTQSPATLSVSPGERATLSCRASQSVSSLLTWYQQKPGQAPRLLIFGASTRATGIPARFSGSGSGTGFTLTISSLQSEDFAVYYCQQYDTWPTFFGGPGTKVDFKRGGGGSGGGG SGGGGSQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSDKYYVDSVKGRFTISRDNSKNRLYLQMNSLRAEDTAVYYCARERYSGRDYWGQGTL VTVSSAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 122)

[0373] Clone 20C5.2 CD8 CD3 Zeta CAR DNA heavy and light chains ATGGCACTCCCCGTAACTGCTCTGCTGCTGCCGTTGGCATTGCTCCTGCACGCCGCACGCCCGGAATAGTGATGACTCA

[0374] TIFF0007673272000022.tif47169

[0375] Clone 20C5.2 CD8 CD3 Zeta CAR DNA heavy and light chains

[0376] Clone 20C5.2 CD8 CD3 Zeta CAR AA heavy and light chains EIVMTQSPATLSVSPGERATLSCRASQSVSSLLTWYQQKPGQAPRLLIFGASTRATGIPARFSGSGSGTGFTLTISSLQSEDFAVYYCQQYDTWPFTFGPGTKVDFKRGGGGSGGGGSGGGGSQ VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSDKYYVDSVKGRFTISRDNSKNRLYLQMNSLRAEDTAVYYCARERYSGRDYWGQGTLVTVSSAAALSNSIM YFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 126)

[0377] CAR signal peptide DNA ATGGCACTCCCCGTAACTGCTCTGCTGCTGCCGTTGGCATTGCTCCTGCACGCCGCACGCCCG (SEQ ID NO: 127 )

[0378] CAR signal peptide: MALPVTALLLPLALLLHAARP (SEQ ID NO: 128)

[0379] scFv G4S linker DNA GGCGGTGGAGGCTCCGGAGGGGGGGGCTCTGGCGGAGGGGGCTCC (SEQ ID NO: 129)

[0380] scFv G4S linker: GGGGSGGGSGGGGS (SEQ ID NO: 130)

[0381] Additional G4S linker: GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 145)

[0382] scFv Whitlow linker DNA GGGTCTACATCCGGCTCCGGGAAGCCCGGAAGTGGCGAAGGTAGTACAAAGGGG (SEQ ID NO: 131)

[0383] scFv Whitlow linker: GSTSGSGKPGSGEGSTKG (SEQ ID NO: 132)

[0384] CD28 AA extracellular domain MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 133)

[0385] GX2X3X4X5X6X7X8X9 (sequence number 134)

[0386] X1X2X3X4X5X6 (sequence number 135)

[0387] X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 DY (SEQ ID NO: 136)

[0388] X1ASQX5X6X7X8X9LX 11 (SEQ ID NO:137)

[0389] X1ASX4X5X6X7 (sequence number 138)

[0390] QQX3X4X5X6PX8T (sequence number 139)

[0391] CLL-1 AA (also known as CLEC12A) MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA (SEQ ID NO: 140)

[0392] 4-1BB nucleic acid sequence (intracellular domain) AAGCGCGGCAGGAAGAAGCTCCTCTACATTTTTAAGCAGCCTTTTATGAGGCCCGTACAGACAACACAGGAGGAAGATGGCTGTAGCTGCAGATTTCCCGAGGAGGAGGAAGGTGGGTGCGAGCTG (SEQ ID NO: 141)

[0393] 4-1BB AA (intracellular domain) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 142)

[0394] OX40AA RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI (SEQ ID NO: 143)

[0395] Leader sequence AA MALPVTALLLPLALLLHAARP (SEQ ID NO: 144)

Claims

1. A CD8+ or CD4+ T cell comprising an antigen-binding molecule that specifically binds to CLL-1, and a polynucleotide encoding a chimeric antigen receptor (CAR) comprising a transmembrane domain and an intracellular activation domain comprising a CD3 zeta signaling domain, wherein the antigen-binding molecule comprises a heavy chain variable region (VH) comprising VH complementarity determining regions ("CDRs") 1, 2, and 3, and a light chain variable region (VL) comprising VL complementarity determining regions ("CDRs") 1, 2, and 3, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are each a) SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, or b) SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:56, SEQ ID NO:57 and SEQ ID NO:58, A T cell comprising the amino acid sequence of (a) the VH comprises the amino acid sequence of SEQ ID NO: 16 and the VL comprises the amino acid sequence of SEQ ID NO: 21; or (b) the VH comprises the amino acid sequence of SEQ ID NO: 50 and the VL comprises the amino acid sequence of SEQ ID NO: 55; The T cell of claim 1.

3. The CAR, (a) SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, and SEQ ID NO:48; (b) SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, and SEQ ID NO:70; The T cell of claim 1, comprising an amino acid sequence selected from the group consisting of:

4. The polynucleotide comprising: (a) SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, and SEQ ID NO:47; (b) SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67, and SEQ ID NO:69; The T cell of claim 1, comprising a nucleic acid sequence selected from the group consisting of:

5. The T cell described in claim 1, wherein the CAR further comprises at least one costimulatory domain.

6. The costimulatory domain is selected from the group consisting of CD28, OX-40, 4-1BB, CD2, CD7, CD27, CD30, CD40, programmed cell death-1 (PD-1), inducible T cell costimulatory molecule (ICOS), lymphocyte function-associated antigen-1 (LFA-1), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT, NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class I molecule, TNF receptor protein, immunoglobulin protein, cytokine receptor, integrin, signaling lymphocyte activation molecule (SLAM protein), activating NK cell receptor, BTLA, Toll ligand receptor, ICAM-1, CDS, GITR, BAFFR, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8 alpha, CD8 beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGA D, CD11d, ITGAE, CD103, ITGAL, CD11a, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, IT GB7, NKG2D, TNFR2, TRANCE, DNAM1 (CD226), SLAMF4 (CD244), CD84, CD96 (Tactile), CEACAM1, CRT The T cell according to claim 5, wherein the signal transduction region is a ligand that specifically binds to AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG, CD19a, or CD83, or any combination thereof.

7. The T cell described in claim 5, wherein the costimulatory domain includes a CD28 signaling region.

8. The T cell described in claim 7, wherein the CD28 signaling region comprises an array selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6 and SEQ ID NO:

8.

9. The T cell described in claim 6, wherein the CD8 signaling region comprises sequence number 14.

10. A T cell described in any one of claims 1 to 9, which is an autologous T cell.

11. A T cell described in any one of claims 1 to 9, which is an allogeneic T cell.

12. A pharmaceutical composition comprising a T cell described in any one of claims 1 to 11.

13. The pharmaceutical composition of claim 12, for use in treating a disease or disorder in a subject in need of treatment.

14. The pharmaceutical composition of claim 13, wherein the disease or disorder is cancer.

15. The pharmaceutical composition of claim 14, wherein the cancer is leukemia, lymphoma or myeloma.

16. The pharmaceutical composition of claim 13, wherein the disease or disorder is at least one of acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia, atypical chronic myeloid leukemia, acute promyelocytic leukemia (APL), acute monoblastic leukemia, acute erythroleukemia, acute megakaryoblastic leukemia, myelodysplastic syndromes (MDS), myeloproliferative disorders, myeloid neoplasms, myeloid sarcoma, blastic plasmacytoid dendritic cell neoplasm (BPDCN), and inflammatory / autoimmune diseases.

17. The pharmaceutical composition of claim 16, wherein the inflammatory / autoimmune disease is at least one of rheumatoid arthritis, psoriasis, allergies, asthma, Crohn's disease, IBD, IBS, fibromyalgia, mastocytosis and celiac disease.

Images