Antibody-based cancer therapy

Abstract

To provide antibodies that bind human Anx-A1 for use in the treatment of cancer, including drug-resistant cancer, as well as kits and products for their use.SOLUTION: The present invention provides a specific binding molecule which binds human Anx-A1 for use in the treatment of cancer in a subject, wherein: (i) the specific binding molecule comprises the complementarity-determining regions (CDRs) VLCDR1, VLCDR2, VLCDR3, VHCDR1, VHCDR2 and VHCDR3, each of the CDRs having a specific amino acid sequence; or, for each sequence, an amino acid sequence with at least 85% sequence identity thereto; and / or (ii) the specific binding molecule binds to Anx-A1 at a discontinuous epitope consisting of amino acids 197-206, 220-224 and 227-237 in a specific sequence.SELECTED DRAWING: None

Description

[Technical Field]

[0001] The present invention provides specific binding molecules for use in treating cancer in a subject. The specific binding molecule binds to human annexin A1 (Anx-A1), and in certain embodiments, the specific binding molecule is an antibody or antibody fragment.

[0002] Cancer is a group of diseases characterized by abnormal cell proliferation. The abnormal cell proliferation associated with cancer is often, but not always, characterized by the formation of a tumor (a solid mass of cells formed as a result of abnormal cell growth), particularly in the case of hematologic cancers. In 2010 (the most recent year for which detailed statistics are available), cancer was the leading single cause of death worldwide (approximately 8 million deaths) (Lozano et al., Lancet 380: 2095-2128, 2012). Furthermore, cancer rates are expected to increase as the global population ages. Therefore, new and improved cancer treatments are urgently needed. Furthermore, many cancer deaths are due to cancers that have become resistant to chemotherapy drugs. The mechanisms by which cancers acquire drug resistance are discussed in Housman et al. (Cancers 6: 1769-1792, 2014). As detailed there, cancers can develop resistance to drugs. Drug resistance can be acquired through a variety of mechanisms, including inactivation or metabolism (or prevention of metabolic activation) of the drug, mutation or modification of the drug target, and drug efflux via ABC transporters. These mechanisms can lead to multidrug resistance (MDR) in cancers. As discussed below, drug resistance is particularly problematic for treatment with platinum-based chemotherapy agents.

[0003] Platinum-based chemotherapy agents are a common first-line treatment option for a variety of cancers, including testicular, ovarian, colorectal, cervical, breast, bladder, head and neck, esophageal, lung, mesothelioma, lymphoma, brain tumors, and neuroblastoma. Platinum-based chemotherapy agents include cisplatin, oxaliplatin, and carboplatin. All platinum-based chemotherapy agents work essentially the same way, reacting with the N-7 position of guanine residues to form DNA interstrand crosslinks, intrastrand crosslinks, and DNA-protein crosslinks. These crosslinks inhibit DNA synthesis and / or repair and initiate apoptosis (Shen et al., Pharmacol. Rev. 64: 706-721, 2012). However, patients generally experience poor initial responses to platinum-based chemotherapy. However, most patients relapse due to the development of resistance to the treatment (especially in the case of cisplatin), resulting in treatment failure (Shen et al., supra). Thus, the development of resistance to platinum-based therapies is a significant challenge in oncology today. Cancers develop resistance to platinum-based therapies through a number of mechanisms, including decreased accumulation of platinum-based chemotherapeutic agents in target cells (due to reduced uptake and / or increased efflux), and (re)activation of DNA repair pathways.

[0004] Thus, the development of resistance to platinum-based therapy is a significant challenge in oncology today, and new treatment options for cancers that are inherently or acquired resistant to conventional chemotherapy, especially platinum-based chemotherapy, are urgently needed.

[0005] The present inventors have discovered that certain specific binding molecules (e.g., antibodies) against Anx-A1 are effective in treating cancer. The molecules have been found to be particularly effective in treating drug-resistant cancers, such as cancers resistant to platinum-based chemotherapy. The present invention therefore provides a new treatment option for cancer patients, particularly those with cancers resistant to chemotherapeutic agents. Such a treatment option would address the urgent need for new treatments for individuals suffering from diseases that are resistant to conventional chemotherapy.

[0006] The specific binding molecules of the present invention are effective against a wide variety of cancers, including breast cancer, colon cancer, ovarian cancer, lung cancer, and pancreatic cancer. has been found to be effective in the treatment of

[0007] Breast cancer is the most common cancer in women and kills more women worldwide than any other cancer (Becker, Int J Gynaecol Obstet 131 (2015), S36-S39). In the UK In the United States, 55,000 women are diagnosed with breast cancer each year (over 300 cases in men). While breast cancer mortality rates are lower than those of many other cancers, breast cancer accounts for over 11,000 deaths each year in the UK. Breast cancers that lack expression of estrogen receptors, progesterone receptors, and the hormone epidermal growth factor receptor HER2 (known as triple-negative breast cancer) are particularly difficult to treat, as many current breast cancer treatments target these receptors. The specific binding molecules of the present invention have been found to be effective in treating breast cancers, including triple-negative breast cancer, providing an important new treatment option for this disease.

[0008] Ovarian cancer is another common cancer in women and is difficult to treat. In the UK alone, over 7,500 cases of ovarian cancer occur each year, resulting in over 4,000 deaths (ovarian cancer is often diagnosed at a late stage, resulting in a relatively low survival rate). Pancreatic cancer is relatively common, affecting 9,000 people each year in the UK alone, but is known to be one of the most untreatable cancers, with a survival rate of less than 1% (again, largely due to the disease being diagnosed at a late stage). The specific binding molecules of the present invention have proven effective in treating both of these cancers, providing much-needed new therapies for these difficult-to-treat cancers. Colorectal cancer (or bowel cancer) is also a common cancer, with 42,000 cases diagnosed in the UK each year. Despite being the fourth most common cancer in the UK, it is the second most deadly. Similarly, lung cancer is diagnosed in 47,000 people in the UK each year, but only 5% survive for more than 10 years after diagnosis. The specific binding molecules of the present invention provide useful new therapies for these cancers.

[0009] The amino acid sequence of full-length human Anx-A1 is shown in SEQ ID NO: 17. Anx-A1 is a member of the annexin protein family. Most of the proteins in this family, including Anx-A1, are characterized by the presence of a "core" region containing four homologous repeat domains. Each repeat domain binds at least one Ca 2+ Anx-A1 contains a binding site. Each member of the family is distinguished by a unique N-terminal region. Anx-A1 is a monomeric amphipathic protein that is primarily present and expressed in the cytoplasm of cells. However, Anx-A1 can also be excreted and localized on the cell surface (D'Acquisto et al., Br. J. Pharmacol. 155: 152-169, 2008).

[0010] Anx-A1 is known to play a role in regulating the immune system. It is involved in maintaining the homeostasis of various cell types in both the innate and adaptive immune systems. For example, Anx-A1 regulates homeostasis in innate immune system cells such as neutrophils and macrophages, and has also been shown to play a role in T cells by regulating the strength of T cell receptor (TCR) signaling (D'Acquisto et al., Blood 109:1095-1102, 2007). Blocking the role of Anx-A1 in the adaptive immune system using neutralizing antibodies against Anx-A1 has been shown to be effective in treating various T cell-mediated diseases, including autoimmune diseases such as rheumatoid arthritis and multiple sclerosis (WO2010 / 064012, WO2011 / 154705). Antibodies against Anx-A1 have also been shown to be useful in treating certain psychiatric conditions, particularly anxiety, obsessive-compulsive disorder (OCD) and related disorders (WO2013 / 088111), although the mechanism by which this occurs is unknown. WO2005 / 027965 shows that Anx-A1 is localized on the surface of apoptotic cells and that anti-Anx-A1 antibodies can be used to monitor apoptosis. Based on this, the publication teaches that such antibodies can be used for cancer monitoring and diagnosis. The publication also teaches that the expression of Anx-A1 on the surface of apoptotic cells inhibits immune responses against the cells. Based on this, the publication also speculates that antibodies that bind to Anx-A1 can be used for cancer treatment by blocking the immunosuppressive effect of Anx-A1 on cells that have begun apoptosis and stimulating immune responses against cancer.

[0011] Oh et al. (Nature 429: 629-635, 2004) reported that Anx-A1 is expressed in certain solid tumors. It has been shown that anti-Anx-A1 antibodies can be used as a target for radioimmunotherapy directed at the cancer, and that such therapy improves survival in animal models of the disease. US2015 / 0086553 suggests that anti-Anx-A1 antibodies can be used for cancer therapy and diagnosis, but does not teach how such therapy would be performed. It has been shown that anti-Anx-A1 scFv binds to the gastric cancer cell line SNU-1. Wang et al. (Biochem. BioPhys. Res. Commun.314: 565-570, 2004) have investigated the relationship between Anx-A1 expression in cancer and multidrug resistance. It has been shown that Anx-A1 expression correlates with resistance to cancer. Thus, several diseases, including cancer, have been shown to be associated with Anx-A1 expression. However, prior to the present invention, it had not been demonstrated that anti-Anx-A1 antibodies could be used for cancer treatment, especially when used without concomitant therapy.

[0012] Indeed, the present invention demonstrates that not all specific binding molecules that bind to human Anx-A1 are necessarily effective in cancer treatment. The present invention provides certain specific binding molecules that bind to human Anx-A1 and can be advantageously used for cancer treatment, particularly for the treatment of cancers resistant to chemotherapy drugs, and / or breast cancer, colon cancer, ovarian cancer, lung cancer, and pancreatic cancer. It is unclear why the specific binding molecules of the present invention are effective in cancer treatment while other specific binding molecules that similarly bind to human Anx-A1 are not. Although there is no theoretical justification, it is speculated that the activity of specific binding molecules that bind to human Anx-A1 may depend on the recognized epitope.

[0013] WO2018 / 146230 discloses a number of monoclonal antibodies that recognize human Anx-A1. The antibodies disclosed in WO2018 / 146230 have particularly advantageous properties in that they bind to human Anx-A1 with very high affinity. The present inventors have now discovered that the antibodies disclosed in WO2018 / 146230 are useful for cancer treatment, as described below.

[0014] Thus, in a first aspect, the present invention provides a specific binding molecule that binds to human Anx-A1 for use in treating cancer in a subject, comprising: (i) The specific binding molecule comprises complementarity determining regions (CDRs) VLCDR1, VLCDR2, VLCDR3, VHCDR1, VHCDR2, and VHCDR3, each of the CDRs having the following amino acid sequence: VLCDR1 has the sequence shown in SEQ ID NO: 1, SEQ ID NO: 7 or SEQ ID NO: 8, VLCDR2 has the sequence shown in SEQ ID NO:2, VLCDR3 has the sequence shown in SEQ ID NO:3, VHCDR1 has the sequence shown in SEQ ID NO:4, VHCDR2 has the sequence shown in SEQ ID NO:5, VHCDR3 has the sequence set forth in SEQ ID NO:6 or, in each case, is an amino acid sequence having at least 85% sequence identity to that sequence; and / or (ii) The specific binding molecule binds to Anx-A1 via a discontinuous epitope consisting of amino acids at positions 197-206, 220-224, and 227-237 of SEQ ID NO:17.

[0015] Similarly, the present invention provides a method of treating cancer in a subject, said method comprising administering to said subject a specific binding molecule as defined above. The present invention also provides the use of a specific binding molecule as defined above in the manufacture of a medicament for treating cancer in a subject.

[0016] In a second aspect, the present invention provides a kit comprising a specific binding molecule as defined above and a chemotherapeutic agent.

[0017] In a third aspect, the present invention provides an article of manufacture comprising a specific binding molecule as defined above and a second therapeutic agent for separate, simultaneous or sequential use in the treatment of cancer in a subject.

[0018] As described above, the present invention provides specific binding molecules that bind to human Anx-A1 for use in treating cancer in a subject. As defined herein, a "specific binding molecule" is a molecule that specifically binds to a particular molecular partner (in this case, human Anx-A1). A molecule that specifically binds to human Anx-A1 is a molecule that binds to human Anx-A1 with a higher binding affinity to other molecules, i.e., at least higher affinity than the binding affinity to most other molecules. Thus, for example, when a specific binding molecule that binds to human Anx-A1 is contacted with a lysate of human cells, the specific binding molecule will primarily bind to Anx-A1. In particular, the specific binding molecule will bind to a sequence or configuration present in human Anx-A1. When the specific binding molecule is an antibody, the sequence or configuration will be or configuration is the epitope to which the specific binding molecule binds. The Anx-A1 epitopes to which the specific binding molecules for use in the present invention bind are described below.

[0019] Specific binding molecules for use herein need not necessarily bind exclusively to human Anx-A1; they may cross-react with other, less well-defined target molecules or exhibit some degree of non-specific binding when contacted with a mixture of multiple molecules (e.g., cell lysates, etc.). For example, specific binding molecules may exhibit some degree of cross-reactivity with other members of the human annexin family and / or with Anx-A1 proteins from other animals. In any event, specific binding molecules for use in the present invention will exhibit specificity for Anx-A1. One of skill in the art will be able to readily determine whether a specific binding molecule exhibits specificity for Anx-A1 using standard methods in the art, such as ELISA, Western blot, or surface plasmon resonance (SPR). In certain embodiments, specific binding molecules for use herein have a K of less than 20 nM, less than 15 nM, or less than 10 nM. D In a preferred embodiment, the specific binding molecules for use herein bind to human Anx-A1 with a K (dissociation constant) of less than 5 nM.D and binds to human Anx-A1.

[0020] K of specific binding molecules to Anx-A1 D is preferably Ca 2+ Measurements are performed under conditions where ions are present at a concentration of at least 1 mM, HEPES is optionally present at a concentration of 10-20 mM, and the pH is 7-8, preferably the physiological level of 7.2 or higher and 7.5 or lower. NaCl may be present at a concentration of, for example, 100-250 mM, and a low concentration of a surfactant (e.g., polysorbate 20) may also be present. Such a low concentration may be, for example, 0.01-0.5% v / v. The K of the interaction between a specific binding molecule and its ligand is D Many methods are known in the art for calculating , including SPR (e.g., Biacore) and polarization-modulated oblique incidence reflectance difference (OI-RD).

[0021] As described above, the molecule "binding to human Anx-A1" exhibits specificity for the human Anx-A1 molecule. It translates four alternatively spliced ​​Anx-A1 mRNAs. There are three isoforms of human Anx-A1 obtained by translation of the ANXA1-002 or ANXA1-003 transcript. The full-length human Anx-A1 protein is obtained by translation of the ANXA1-002 or ANXA1-003 transcript, and as noted above, its amino acid sequence is set forth in SEQ ID NO: 17. The ANXA1-004 and ANXA1-006 transcripts encode fragments of the full-length human Anx-A1 protein, and their amino acid sequences are set forth in SEQ ID NOs: 18 and 19, respectively. Specific binding molecules for use in the present invention bind to full-length human Anx-A1 (i.e., Anx-A1 of SEQ ID NO: 17, the 346 amino acid protein encoded by the ANXA1-002 or ANXA1-003 transcript). Specific binding molecules may also bind to specific fragments, portions, or variants of full-length Anx-A1, such as the fragment encoded by the ANXA1-004 or ANXA1-006 transcript. good.

[0022] As discussed below, antibodies (and molecules comprising CDRs) form suitable specific binding molecules for use in accordance with the present invention.

[0023] As mentioned above, a number of monoclonal antibodies that recognize human Anx-A1 are disclosed in WO2018 / 146230. As known to those skilled in the art, an antibody is a protein comprising four polypeptide chains: two heavy chains and two light chains. Typically, the heavy chains are identical to each other, and the light chains are identical to each other. The light chains are shorter (and therefore lighter) than the heavy chains. The heavy chains comprise four or five domains: variable (V) domains; H ) domain at the N-terminus, followed by three or four constant domains (C H 1. C H 2. C H 3, and, if present, C H 4). The light chain contains two domains: variable (V L ) domain located at the N-terminus, and the constant (C L ) domain is located at the C-terminus. In the heavy chain, an amorphous hinge region is located at the C H 1 Domain and C H The two heavy chains of an antibody are linked by disulfide bonds formed between cysteine ​​residues in the hinge region, and each heavy chain is located between the C H 1 domain and C L It is linked to one light chain by disulfide bonds between cysteine ​​residues present in the domains.

[0024] Mammals produce two types of light chains, known as lambda (λ) and kappa (κ). In kappa light chains, the variable and constant domains are V and V, respectively. K Domain and C KThe constant regions of light chains can be referred to as domains. Whether a light chain is a λ or κ light chain is determined by its constant region; that is, the constant regions of λ and κ light chains are different, but in a given species, the constant regions of all light chains of the same species are the same.

[0025] The heavy chain constant regions are all the same among antibodies of a given isotype in a given species, but vary among isotypes (examples of antibody isotypes are the IgG, IgE, IgM, IgA, and IgD classes; there are also many antibody subtypes; for example, IgG antibodies have four subtypes: IgG1, IgG2, IgG3, and IgG4). The specificity of an antibody is determined by the sequences of its variable regions, which vary between antibodies of the same species within any given individual. In particular, both the light and heavy chains of an antibody have three hypervariable complementarity-determining regions (CDRs). In a pair of light and heavy chains, the CDRs of the two chains form the antigen-binding site. The CDR sequences determine the specificity of the antibody.

[0026] The three CDRs of the heavy chain are known from N- to C-terminus as VHCDR1, VHCDR2, and VHCDR3, and the three CDRs of the light chain are known from N- to C-terminus as VLCDR1, VLCDR2, and VLCDR3. One antibody disclosed in WO2018 / 146230 has the following CDR sequence: . VLCDR1:RSSQSLENSNAKTYLN (SEQ ID NO: 1), VLCDR2: GVSNRFS (SEQ ID NO: 2), VLCDR3:LQVTHVPYT (SEQ ID NO: 3), VHCDR1:GYTFTNYWIG (SEQ ID NO: 4), VHCDR2: DIYPGGDYTNYNEKFKG (SEQ ID NO: 5), and VHCDR3:ARWGLGYYFDY (SEQ ID NO: 6). Another antibody disclosed in WO2018 / 146230 has the following CDR sequences: VLCDR1:RSSQSLENSNAKTYLN (SEQ ID NO: 7), VLCDR2: GVSNRFS (SEQ ID NO: 2), VLCDR3:LQVTHVPYT (SEQ ID NO: 3), VHCDR1:GYTFTNYWIG (SEQ ID NO: 4), VHCDR2: DIYPGGDYTNYNEKFKG (SEQ ID NO: 5), and VHCDR3:ARWGLGYYFDY (SEQ ID NO: 6). Another antibody disclosed in WO2018 / 146230 has the following CDR sequences: VLCDR1:RSSQSLENSNAKTYLN (SEQ ID NO: 8), VLCDR2: GVSNRFS (SEQ ID NO: 2), VLCDR3:LQVTHVPYT (SEQ ID NO: 3), VHCDR1:GYTFTNYWIG (SEQ ID NO: 4), VHCDR2: DIYPGGDYTNYNEKFKG (SEQ ID NO: 5), and VHCDR3:ARWGLGYYFDY (SEQ ID NO: 6).

[0027] Thus, the CDR sequences of the antibodies disclosed in WO2018 / 146230 are identical except for the VLCDR1 sequence. The VLCDR1 sequence of SEQ ID NO: 7 is the wild-type VLCDR1 sequence found in the murine antibody Mdx001, constructed from a minor mRNA sequence obtained from a hybridoma deposited at the European Collection of Cell Cultures (ECACC) under accession number 10060301. Humanized versions of the Mdx001 antibody were produced, and it was surprisingly found that altering the VLCDR1 sequence in these humanized antibodies resulted in enhanced antibodies. Substitution of the glycine residue at position 11 of SEQ ID NO: 7 improved the stability and function of the antibody. Although not supported by theory, it is believed that this was achieved by removing a site for post-translational modification of the CDR. Specifically, it is believed that substitution of this glycine residue removes a deamidation site from the protein. The VLCDR1 sequence shown in SEQ ID NO: 7 contains the sequence motif Ser-Asn-Gly. This sequence is associated with deamidation of Asn residues, converting asparagine residues to aspartic acid or isoaspartic acid, which can affect antibody stability and target binding. Substitution of any of the residues within the Ser-Asn-Gly motif would eliminate the deamidation site.

[0028] The present inventors have identified an antibody in which the glycine residue at position 11 of SEQ ID NO:7 (the glycine residue located within the deamidation site described above) has been substituted with alanine, and which exhibits improved binding to its target (Anx-A1) compared to its native Mdx001 antibody. The amino acid sequence of VLCDR1 in which glycine at position 11 has been substituted with alanine is RSSQSLENSNAKTYLN (the residue in bold is the alanine introduced by the above substitution), which is the sequence shown in SEQ ID NO:1. Furthermore, a humanized antibody containing VLCDR1 in which position 9 has been modified by substituting serine for threonine has also been found to exhibit improved binding to Anx-A1 compared to Mdx001. The amino acid sequence of VLCDR1 in which serine at position 9 has been substituted with threonine is RSSQSLENTNGKTYLN (the residue in bold is the threonine introduced by the above substitution), which is the sequence shown in SEQ ID NO:8. As described above, the present inventors have found that the antibodies disclosed in WO2018 / 146230 are suitable for use in cancer therapy.

[0029] The antibodies disclosed in WO2018 / 146230 were generated by genetic immunization of mice with human Anx-A1, meaning that the mouse immune system was exposed to full-length, unmodified human Anx-A1 in its native structure. Analysis of the antibodies of WO2018 / 146230 by hydrogen-deuterium exchange (HDX), as detailed in the Examples, showed that the antibodies bind to human Anx-A1 at a discontinuous epitope consisting of amino acids 197-206, 220-224, and 227-237 of human Anx-A1 (i.e., amino acids 197-206, 220-224, and 227-237 of SEQ ID NO: 17).

[0030] In particular, the antibodies of WO2018 / 146230 inhibit physiological concentrations of Ca 2+ It binds to Anx-A1 only in the presence of Ca. Although not supported by theory, this is thought to be a result of the location of the epitope on the Anx-A1 molecule. 2+If absent, its N-terminus would fit into a "pocket" adjacent to this discontinuous epitope. 2+ When Anx-A1 binds to Ca 2+ This is thought to occur in the presence of an antibody (such as ribonucleotides) that alters the structure of Anx-A1, exposing the N-terminus from its pocket in the core domain, thereby exposing an epitope for antibody binding. Any antibody (or similar specific binding molecule) that binds to this epitope on Anx-A1 may be used in the methods and uses described herein.

[0031] A specific binding molecule for use according to the present invention may comprise the CDR sequences of any of the three antibodies disclosed in WO2018 / 146230, or variants thereof. Alternatively / in addition, a specific binding molecule for use according to the present invention may bind to Anx-A1 at the same epitope as the antibodies of WO2018 / 146230. Thus, a specific binding molecule for use according to the present invention may comprise: (i) Complementarity determining regions (CDRs) VLCDR1, VLCDR2, VLCDR3, VHCDR1, VHCDR2, and VHCDR3, each of which has the following amino acid sequence: VLCDR1 has the sequence shown in SEQ ID NO: 1, SEQ ID NO: 7 or SEQ ID NO: 8, VLCDR2 has the sequence shown in SEQ ID NO:2, VLCDR3 has the sequence shown in SEQ ID NO:3, VHCDR1 has the sequence shown in SEQ ID NO:4, VHCDR2 has the sequence shown in SEQ ID NO:5, VHCDR3 has the sequence set forth in SEQ ID NO:6, or an amino acid sequence having at least 85%, at least 90%, or at least 95% sequence identity to that sequence, respectively; and / or (ii) It binds to human Anx-A1 via a discontinuous epitope consisting of amino acids at positions 197 to 206, 220 to 224, and 227 to 237 of SEQ ID NO: 17.

[0032] In a preferred embodiment, the specific binding molecule of (i) above binds to an epitope as described in (ii).

[0033] "Alternatively, the amino acid sequence of each CDR has at least 85%, at least 90%, or at least 95% sequence identity" means that the amino acid sequence of each CDR is as set forth in the SEQ ID NO: or has at least 85%, at least 90%, or at least 95% sequence identity thereto. Thus, VLCDR1 has the sequence set forth in SEQ ID NO:1, SEQ ID NO:7, or SEQ ID NO:8, or is an amino acid sequence having at least 85%, at least 90%, or at least 95% sequence identity thereto; VLCDR2 has the sequence set forth in SEQ ID NO:2, or is an amino acid sequence having at least 85%, at least 90%, or at least 95% sequence identity thereto; VLCDR1 has the sequence set forth in SEQ ID NO:4 or is an amino acid sequence that has at least 85%, at least 90%, or at least 95% sequence identity to SEQ ID NO:4; VHCDR2 has the sequence set forth in SEQ ID NO:5 or is an amino acid sequence that has at least 85%, at least 90%, or at least 95% sequence identity to SEQ ID NO:5; and VHCDR3 has the sequence set forth in SEQ ID NO:6 or is an amino acid sequence that has at least 85%, at least 90%, or at least 95% sequence identity to SEQ ID NO:6. Amino acid sequences that have at least 85%, at least 90%, or at least 95% sequence identity to a particular SEQ ID NO (but less than 100% sequence identity) are referred to herein as variants of that SEQ ID NO. For example, an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:1, but less than 100% sequence identity to SEQ ID NO:1, is a variant of SEQ ID NO:1.

[0034] In certain embodiments, a specific binding molecule for use according to the present invention comprises a CDR having the following amino acid sequence: VLCDR1 has the sequence shown in SEQ ID NO: 1, VLCDR2 has the sequence shown in SEQ ID NO:2, VLCDR3 has the sequence shown in SEQ ID NO:3, VHCDR1 has the sequence shown in SEQ ID NO:4, VHCDR2 has the sequence shown in SEQ ID NO:5, VHCDR3 has the sequence shown in SEQ ID NO:6.

[0035] As described above, a specific binding molecule for use in the present invention may comprise six CDRs consisting of a polypeptide sequence. As used herein, "protein" and "polypeptide" are interchangeable and refer to a sequence of two or more amino acids linked by one or more peptide bonds. Thus, a specific binding molecule may be a polypeptide. Alternatively, a specific binding molecule may comprise one or more polypeptides comprising CDR sequences. Preferably, a specific binding molecule for use in the present invention is an antibody or antibody fragment.

[0036] Specific binding molecules for use in the present invention may be synthesized by any method known in the art. In particular, specific binding molecules may be synthesized using protein expression systems, such as cellular expression systems using prokaryotic cells (e.g., bacterial cells) or eukaryotic cells (e.g., yeast cells, fungal cells, insect cells, or mammalian cells). Another protein expression system includes in vitro cell-free expression systems, in which a nucleotide sequence encoding the specific binding molecule is transcribed into mRNA in vitro, and this mRNA is translated into protein. Kits for cell-free expression systems are widely available and can be purchased, for example, from ThermoFisher Scientific (USA). Alternatively, specific binding molecules may be chemically synthesized in a non-biological system. Liquid-phase or solid-phase synthesis may be used to generate polypeptides that may form or be contained in specific binding molecules for use in the present invention. Those skilled in the art can readily produce specific binding molecules using appropriate techniques common in the art. In particular, specific binding molecules may be expressed by recombinant techniques in mammalian cells, such as CHO cells.

[0037] Binds to human Anx-A1 at an epitope as defined above (i.e., from amino acids 197-206, 220-224, and 227-237 of SEQ ID NO: 17). Specific binding molecules (such as those described herein) can be generated using standard techniques in the art (e.g., genetic immunization of antibodies), and antibodies bearing the desired epitope can be identified using standard techniques of epitope mapping known in the art. Examples of such techniques include HDX, epitope excision, peptide panning, X-ray cocrystallography, and NMR (Clementi et al., Methods Mol. Biol. 1131: 427-446, 2014; Abbott et al., Immunology 142(4): 526-535, 2014). Specific binding molecules can also be generated by modifying (e.g., by expression of modified sequences) existing specific binding molecules known to bind to the epitope, and molecules that bind to the epitope can be identified using the methods described herein. Specific binding molecules that bind to the epitope may also be identified by competition with antibodies known to bind the epitope (e.g., those described herein) or by comparing binding of the epitope disclosed herein to its epitope variants (no binding to a variant of an epitope indicates specific binding to the epitope).

[0038] Specific binding molecules for use according to the present invention may be isolated (i.e., purified) if necessary. As used herein, "isolated" means that the specific binding molecule is the major component (i.e., the majority of components) of a solution or the like containing the specific binding molecule. Particularly when the specific binding molecule is initially produced in a mixture or mixed solution, isolation of the specific binding molecule means that the specific binding molecule has been separated or purified. Thus, for example, when the specific binding molecule is a polypeptide and the polypeptide is produced using a protein expression system as described above, the specific binding molecule is isolated so that it is the most abundant polypeptide in the solution or composition in which it is present, preferably so that it constitutes the majority of the polypeptides in the solution or composition, and is enriched relative to other polypeptides and biomolecules present in the original production medium. In particular, specific binding molecules for use according to the present invention are isolated so that they are the predominant (majority) specific binding molecule in the solution or composition. In a preferred aspect, the specific binding molecule is present in the solution or composition with a purity of at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% when assessed relative to the abundance of other components, particularly other polypeptide components, in the solution or composition.

[0039] For example, if the specific binding molecule is a protein produced in a protein expression system, the solution of the specific binding molecule may be analyzed by quantitative proteomics to determine whether the specific binding molecule for use in the present invention is predominant and isolated. For example, 2D gel electrophoresis and / or mass spectrometry may be used. Such isolated molecules may be present in formulations or compositions as described below.

[0040] The specific binding molecules of the present invention may be isolated using any method known in the art. For example, the specific binding molecules may contain affinity tags, such as polyhistidine tags, strep tags, FLAG tags, and HA tags, that allow the molecules to be isolated by affinity chromatography using appropriate binding partners. For example, polyhistidine-tagged molecules can be produced by 2+ The specific binding molecule may be purified using ions. In embodiments in which the specific binding molecule is an antibody, the specific binding molecule may be isolated by affinity chromatography using one or more antibody-binding proteins, such as Protein G, Protein A, Protein A / G, or Protein L. Alternatively, the specific binding molecule may be isolated by, for example, size exclusion chromatography or ion exchange chromatography. In contrast, specific binding molecules produced by chemical synthesis (i.e., non-biological methods) may be produced in isolated form. Thus, specific binding molecules for use in accordance with the present invention that are considered isolated may not require a specific purification or isolation step if synthesized in a manner that produces an isolated molecule.

[0041] In embodiments of the invention in which a specific binding molecule comprises a CDR sequence that is a variant of SEQ ID NO: 1 (or SEQ ID NO: 7 or SEQ ID NO: 8) or SEQ ID NOs: 2-6, the variant may be modified by substitution, addition, and / or deletion of amino acid residues compared to the reference CDR sequence (i.e., a CDR sequence with which the specific binding molecule has at least 85% but less than 100% sequence identity).

[0042] When a CDR sequence is modified by substituting a specific amino acid residue, the substitution may be a conservative amino acid substitution. As used herein, the term "conservative amino acid substitution" refers to an amino acid substitution in which a certain amino acid residue is replaced with another amino acid residue having a similar side chain. Since amino acids with similar side chains tend to have similar properties, conservative substitution of an amino acid that is important in the structure or function of a polypeptide can be expected to have less of an effect on the structure / function of the polypeptide than non-conservative amino acid substitution at the same position. Families of amino acid residues with similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine, etc.), acidic side chains (e.g., aspartic acid, glutamic acid, etc.), uncharged polar side chains (e.g., asparagine, glutamine, serine, threonine, tyrosine, etc.), non-polar side chains (e.g., glycine, cysteine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, etc.), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine, etc.).Therefore, conservative amino acid substitutions can be considered as substitutions in which a specific amino acid residue is replaced with another amino acid from the same family.However, substitutions of CDR residues can also be non-conservative substitutions, where an amino acid is replaced with another amino acid having a side chain from a different family.

[0043] Amino acid substitutions or additions within the scope of the present invention may be made with proteinogenic amino acids encoded by the genetic code, proteinogenic amino acids not encoded by the genetic code, or non-proteinogenic amino acids. Preferably, amino acid substitutions or additions are made with proteinogenic amino acids. The amino acids constituting the CDR sequence may include amino acids that are not naturally occurring but are variants of naturally occurring amino acids. These non-naturally occurring amino acids may be used to generate the CDRs described herein without reducing sequence identity, provided they do not alter the sequence or affect specificity. That is, they are considered to provide the amino acids of the CDR. For example, amino acid derivatives, such as methylated amino acids, may be used. In one embodiment, the specific binding molecules for use in the present invention are not naturally occurring molecules, i.e., not molecules found in nature.

[0044] Modifications to the amino acid sequences of the CDRs shown in SEQ ID NOs: 1 to 8 may be made using any suitable technique, such as site-directed mutagenesis of the encoding DNA sequence or solid phase synthesis.

[0045] Specific binding molecules for use in the present invention may comprise the CDRs described above. Furthermore, such molecules may comprise linker or framework sequences that allow for proper presentation of the CDRs. Advantageously, additional sequences may be present that may confer additional properties, such as peptide sequences that allow for the isolation or identification of molecules containing the CDRs described above. In such cases, fusion proteins may be produced.

[0046] As noted above, specific binding molecules for use in accordance with the present invention may comprise CDRs that have at least 85% sequence identity to SEQ ID NO: 1 (or SEQ ID NO: 7, or SEQ ID NO: 8) and SEQ ID NOs: 2-6. In other embodiments of the invention, the CDR sequences may be modified by substitution, addition, or deletion of no more than two amino acids compared to SEQ ID NO: 1 (or SEQ ID NO: 7 or SEQ ID NO: 8) and SEQ ID NOs: 2 to 6, respectively, provided that the sequence identity of the resulting CDR sequence to SEQ ID NO: 1 (or SEQ ID NO: 7 or SEQ ID NO: 8) and SEQ ID NOs: 2 to 6 is at least 85% or at least 90%, as described above. "Substitution, addition, or deletion" also includes combinations of substitution, addition, and deletion. Thus, in particular, the sequence of VLCDR1 may be the sequence of SEQ ID NO: 1 (or SEQ ID NO: 7 or SEQ ID NO: 8) with one or two amino acid substitutions, additions or deletions, the sequence of VLCDR2 may be the sequence of SEQ ID NO: 2 with one amino acid substitution, addition or deletion, the sequence of VLCDR3 may be the sequence of SEQ ID NO: 3 with one amino acid substitution, addition or deletion, the sequence of VHCDR1 may be the sequence of SEQ ID NO: 4 with one amino acid substitution, addition or deletion, the sequence of VHCDR2 may be the sequence of SEQ ID NO: 5 with one or two amino acid substitutions, addition or deletion, and the sequence of VHCDR3 may be the sequence of SEQ ID NO: 6 with one amino acid substitution, addition or deletion, preferably, the substitution of one or two amino acids in SEQ ID NO: 1, SEQ ID NO: 7 or SEQ ID NO: 8 is made at positions 9 and / or 11 within the sequence.

[0047] Sequence identity may be assessed by any convenient method. However, to determine the degree of sequence identity between sequences, computer programs that align sequences pairwise or multiply are useful, such as the EMBOSS Needle or EMBOSS stretcher programs (both published by Rice, P. et al.). , Trends Genet. 16, (6) pp. 276-277, 2000) is used for pairwise sequence alignment. Alternatively, Clustal Omega (Sievers F et al., Mol. Syst. Biol. 7:539, 2011) or MUSCLE (Edgar, RC, Nucleic Acids Res. 32(5):1792-1797, 2004) may be used for multiple sequence alignment, although other suitable programs may be used. The alignment, whether pairwise or multiple, must be global (i.e., across the entire reference sequence) rather than local.

[0048] Sequence alignments and percent identity calculations may be performed using, for example, standard parameters for Clustal Omega (i.e., Gonnet matrix, gap opening penalty = 6, gap extension penalty = 1). Alternatively, standard parameters for EMBOSS needle (i.e., BLOSUM62 matrix, gap opening penalty = 10, gap extension penalty = 0.5) may be used. Other appropriate parameters may be used instead.

[0049] For the purposes of this application, in case of discrepancies between sequence identity values ​​obtained using different methods, the value obtained from a global pairwise alignment using the EMBOSS needle with default parameters is to be considered valid.

[0050] As mentioned above, the specific binding molecules for use in the present invention are preferably antibodies or antibody fragments. An "antibody" is an immunoglobulin having the characteristics described above. The present invention also contemplates variants of naturally occurring antibodies that retain the CDRs but are presented in a different framework, as described below, and that function similarly, i.e., retain specificity for the antigen. Thus, antibodies include functional equivalents or homologs in which naturally occurring domains have been replaced, in part or in whole, with similarly functioning natural or non-natural equivalents or homologs.

[0051] When the specific binding molecule for use in the present invention is an antibody, it is preferably a monoclonal antibody. "Monoclonal antibody" refers to an antibody preparation consisting of a single antibody species. That is, all of the antibodies in the preparation have identical amino acid sequences and contain the same CDRs, and therefore bind to the same epitope on the target antigen ("target antigen" means an antigen containing the epitope to which a specific antibody binds; i.e., the target antigen of an anti-Anx-A1 antibody is Anx-A1) and exert the same effect. In other words, antibodies for use in the present invention are preferably not part of a polyclonal antibody mixture.

[0052] As described above, in antibodies, CDR sequences are located in the heavy and light chain variable domains. The CDR sequences are present within a polypeptide framework, thereby properly positioning the CDRs for antigen binding. Thus, the remainder of the variable domain (i.e., the portion of the variable domain sequence that does not form part of any CDR) constitutes the framework region. The N-terminus of the mature variable domain forms framework region 1 (FR1), the polypeptide sequence between CDR1 and CDR2 forms FR2, the polypeptide sequence between CDR2 and CDR3 forms FR3, and the polypeptide sequence connecting CDR3 to the constant domain forms FR4. In antibodies for use in the present invention, the amino acid sequence of the framework region of the variable region may be any suitable amino acid sequence that allows the antibody to bind to human Anx-A1 via its CDRs. The constant region may be the constant region of any mammalian (preferably human) antibody isotype.

[0053] In certain embodiments of the present invention, the specific binding molecule may be a multispecific monoclonal antibody, such as a bispecific monoclonal antibody. A multispecific binding molecule comprises regions or domains (antigen-binding regions) that bind to at least two different molecular binding partners, e.g., two or more different antigens or epitopes. In the case of a bispecific antibody, the antibody comprises two heavy chains and two light chains in the configuration described above, except that the variable domains of the two heavy chains and the two light chains are different, thus forming two different antigen-binding regions. In a multispecific (e.g., bispecific) binding molecule for use according to the present invention, such as a multispecific monoclonal antibody, one of the antigen-binding regions has the CDR sequences of a specific binding molecule for use according to the present invention as defined herein and thus binds to Anx-A1. The other antigen-binding region of a multispecific binding molecule for use according to the present invention is different from the antigen-binding region formed by the CDRs for use according to the present invention, e.g., has CDR sequences that differ from those defined herein for the specific binding molecule for use according to the present invention. For example, in a bispecific antibody, the additional (e.g., second) antigen-binding region of the specific binding molecule may bind to Anx-A1, but at a different epitope than the first antigen-binding region (which comprises the CDRs of the specific binding molecule for use according to the invention) that binds to Anx-A1. Alternatively, the additional (e.g., second) antigen-binding region may bind to an additional (e.g., second) different antigen that is not Anx-A1. In another embodiment, two or more antigen-binding regions in a specific binding molecule, such as an antibody, may each bind to the same antigen, i.e., providing a multivalent (e.g., bivalent) molecule.

[0054] The specific binding molecule may be an antibody fragment or a synthetic construct capable of binding to human Anx-A1. Thus, an antibody fragment for use in the present invention comprises an antigen-binding domain (i.e., the antigen-binding domain of the antibody from which the antibody fragment is derived). Antibody fragments are described in Rodrigo et al., Antibodies, Vol. 4(3), pp. 259-277, 2015. Antibody fragments for use in the present invention are preferably monoclonal (i.e., not part of a polyclonal antibody mixture). Antibody fragments include, for example, Fab fragments, F(ab')2 fragments, Fab' fragments, and Fv fragments. Fab fragments are described in Roitt et al., Immunology second edition (1989), Churchill Livingstone, NY, USA. ne, London. The Fab fragment consists of the antigen-binding domain of an antibody. That is, an individual antibody may be considered to contain two Fab fragments, each consisting of a light chain and the N-terminal portion of a heavy chain bound to it. Thus, a Fab fragment contains the entire light chain and the V of the heavy chain to which it binds. H Domain and C H 1 domain. Fab fragments may be obtained by digesting antibodies with papain.

[0055] The F(ab')2 fragment consists of two Fab fragments of an antibody and the hinge region of the heavy domain, containing a disulfide bond connecting the two heavy chains. In other words, the F(ab')2 fragment can be considered to be two covalently bound Fab fragments. The F(ab')2 fragment can be obtained by digesting an antibody with pepsin. The F(ab')2 fragment can be reduced to obtain two Fab' fragments. These can be considered to be Fab fragments containing additional sulfhydryl groups that may be useful for conjugating the fragment to other molecules.

[0056] Fv fragments consist of only the variable domains of the light and heavy chains, which are not covalently linked but are only weakly held together by non-covalent interactions. Fv fragments can be engineered to produce synthetic constructs known as single-chain Fv (scFv) molecules. Typically, such engineering is achieved by manipulating antibody genes to produce a single polypeptide V H Domains and V L scFv fragments can be produced recombinantly by producing a fusion protein containing both the V and V domains. H Area and V L The peptide linker covalently connects the domains and contributes to the stability of the molecule. The linker may consist of 1 to 20 amino acids, for example, 1, 2, 3, or 4 amino acids, or 5, 10, or 15 amino acids, or any other number conveniently ranging from 1 to 20. The peptide linker may be formed from commonly convenient amino acid residues such as glycine and / or serine. An example of a suitable linker is Gly4Ser. Multimers of such linkers, such as dimers, trimers, tetramers, or pentamers (e.g., (Gly4Ser)2, (Gly4Ser)3, (Gly4Ser)4, or (Gly4Ser)5, may also be used. However, the presence of a linker is not essential, and V L The domains are connected by peptide bonds to form the V H The scFv may be linked to a domain. As used herein, an scFv is defined as an antibody fragment.

[0057] The specific binding molecule may be an analog of an scFv. For example, an scFv may be linked to other specific binding molecules (e.g., other scFvs, Fab antibody fragments, and chimeric IgG antibodies (e.g., with human frameworks)). An scFv may be linked to other scFvs to form multimers, e.g., dimers, trimers, or tetramers, which are multispecific binding proteins. Bispecific scFvs may be referred to as diabodies, trispecific scFvs may be referred to as triabodies, and tetraspecific scFvs may be referred to as tetrabodies. In other embodiments, an scFv for use in the present invention may be linked to other identical scFv molecules, thereby forming monospecific but multivalent multimers, e.g., bivalent dimers or trivalent trimers.

[0058] Synthetic constructs that can be used include CDR peptides. These are synthetic peptides that contain antibody binding determinants. Peptide mimetics can also be used. These molecules are typically conformationally restricted organic rings that mimic the CDR loop structure and have side chains that interact with the antigen.

[0059] As noted above, in certain embodiments, specific binding molecules for use according to the invention comprise CDRs having the amino acid sequences set forth in SEQ ID NO: 1, SEQ ID NO: 7, or SEQ ID NO: 8, and SEQ ID NOs: 2-6. As detailed above, these are derived from the murine antibody Mdx001. However, antibodies, or fragments thereof, for use in accordance with the present invention are preferably human or humanized antibodies.

[0060] Antibodies or antibody fragments for use in the present invention may be human / mouse chimeric antibodies or, preferably, humanized. This is particularly true for monoclonal antibodies and antibody fragments thereof. Humanized or chimeric antibodies, or fragments thereof, are desirable when the molecules are intended for human therapy. Therapeutic treatment of humans using non-human antibodies (e.g., murine antibodies) is ineffective for many reasons, including the short in vivo half-life of antibodies, poor recognition of non-human heavy chain constant regions by Fc receptors on human immune effector cells, resulting in weak effector functions mediated by the xenogeneic heavy chain constant region, patient sensitization to the antibody, and (with murine antibodies) the development of a human anti-mouse antibody (HAMA) response, which neutralizes murine antibodies by HAMA and results in loss of therapeutic efficacy.

[0061] Chimeric antibodies are antibodies that have variable regions derived from one species and constant regions derived from another species. Thus, antibodies or antibody fragments for use in accordance with the present invention may be chimeric antibodies or chimeric antibody fragments comprising murine variable domains and human constant domains.

[0062] As detailed above, the isotype of an antibody is defined by the sequence of its heavy chain constant region. The constant region of a chimeric antibody for use in the present invention may be of any human antibody isotype or any subclass within each isotype. For example, a chimeric antibody may have the Fc region of an IgA, IgD, IgE, IgG, or IgM antibody (i.e., a chimeric antibody may contain the constant domains of heavy chains α, δ, ε, γ, or μ), but preferably, an antibody for use in the present invention is an IgG isotype. Thus, a chimeric antibody of the present invention may be of any isotype. The light chain of a chimeric antibody may be a κ light chain or a λ light chain. That is, it may contain the constant region of a human λ light chain or a human κ light chain. Similarly, a chimeric antibody fragment is an antibody fragment containing a constant domain (e.g., a Fab fragment, a Fab' fragment, or a F(ab')2 fragment). The constant domains of a chimeric antibody fragment for use according to the invention may be constant domains as described above for chimeric monoclonal antibodies.

[0063] Chimeric antibodies may be produced using any suitable method, such as recombinant DNA technology, in which a DNA sequence for a murine variable domain is fused to a DNA sequence for a human constant domain to encode the chimeric antibody. Chimeric antibody fragments may be obtained by using recombinant DNA technology to produce DNA sequences encoding such polypeptides, or by processing chimeric antibodies for use in the present invention to produce the desired fragments, as described above. Chimeric antibodies are expected to overcome the problems associated with using xenogeneic antibodies, e.g., murine antibodies, in human therapy, such as short in vivo half-life and weak effector function, thereby reducing the likelihood of patient sensitization and HAMA. However, due to the presence of murine sequences in the variable domains, chimeric antibodies may still sensitize patients and cause HAMA when administered to human patients.

[0064] Thus, antibodies or antibody fragments for use in accordance with the present invention are preferably fully humanized. Humanized antibodies are antibodies derived from other species, such as mouse, in which the constant domains of the antibody chains have been replaced with human constant domains, and the amino acid sequences of the variable regions have also been modified to replace heterologous (e.g., murine) framework sequences with human framework sequences, such that the only non-human sequences in the antibody are preferably CDR sequences. Humanized antibodies address the problems associated with using non-human antibodies in humans for therapeutic purposes. All of these problems can be overcome, for example by avoiding or minimizing the possibility of patient sensitization and HAMA.

[0065] Antibody humanization is typically performed by a process known as CDR grafting, although other methods known in the art may be used. Antibody grafting is discussed in Williams, DG et al., Antibody Engineering, Vol. 1, eds. R. Kontermann and S. Dubel, Chapter 21, pp. 319-339. This process has been well described. In this process, a chimeric antibody, as described above, is first generated. Thus, in antibody humanization, the non-human constant domains are first replaced with human constant domains, resulting in a chimeric antibody comprising human constant domains and non-human variable domains.

[0066] Subsequent humanization of heterologous (e.g., murine) variable domains involves inserting murine CDRs from each immunoglobulin chain into the FRs of the most appropriate human variable domain. This is done by aligning the murine variable domains with known human variable domain databases (e.g., IMGT or Kabat). Suitable human framework regions are identified from the best-aligned variable domains, e.g., domains with high sequence identity between the human and murine framework regions, domains containing CDRs of the same length, and domains with the most similar structure (based on homology modeling). Next, murine CDR sequences are grafted into the appropriate positions of the initial human framework sequences using recombinant DNA technology, and humanized antibodies are then produced and tested for binding to the target antigen. Those skilled in the art know and understand the antibody humanization process and can perform this method without further instruction. Antibody humanization services are also provided by many commercial companies, such as GenScript (USA / China) and MRC Technology (UK). Humanized antibody fragments Fragments can be readily obtained from humanized antibodies, as described above.

[0067] Alternatively, fully human monoclonal antibodies can be obtained in vitro without immunization using phage display technology, as described by Frenzel et al. (Transfus. Med. Hemother. 44(5): 312-318, 2017).

[0068] Thus, antibodies or antibody fragments for use in accordance with the present invention may be derived from any species, for example, murine antibodies or antibody fragments. However, it is preferred that the antibody or antibody fragment is a chimeric antibody or antibody fragment thereof. That is, it is preferred that only the variable domains of the antibody or antibody fragment are of non-human origin, and all of the constant domains are of human origin. Optimally, antibodies or antibody fragments for use in accordance with the present invention are humanized antibodies or antibody fragments thereof.

[0069] As detailed in WO2018 / 146230, a humanized version of Mdx001 has been developed by the present inventors. Humanized light chain variable domains have been developed comprising the amino acid sequences set forth in SEQ ID NO:9 (known as the L1M2 variable region) and SEQ ID NO:10 (known as the L2M2 variable region) and the CDRs described above. In certain embodiments, antibodies or fragments thereof for use according to the present invention comprise a light chain variable region comprising or consisting of the amino acid sequence set forth in SEQ ID NO:9 or SEQ ID NO:10, or an amino acid sequence that has at least 70% sequence identity (preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to these amino acid sequences and that has at least 85% sequence identity to CDR sequences VLCDR1-3 set forth in SEQ ID NO:1, SEQ ID NO:7, or SEQ ID NO:8, and SEQ ID NO:2-3, respectively.

[0070] Humanized heavy chain variable domains have been developed with the amino acid sequences set forth in SEQ ID NO: 11 (known as the H4 variable region) and SEQ ID NO: 12 (known as the H2 variable region). In certain embodiments, an antibody or fragment thereof for use according to the present invention comprises a heavy chain variable region comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 11 or SEQ ID NO: 12, or an amino acid sequence which has at least 70% sequence identity (preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to these amino acid sequences and at least 85% sequence identity to SEQ ID NOs: 4 to 6 for CDR sequences VH CDR1 to 3, respectively.

[0071] In a particular embodiment, the specific binding molecule for use according to the invention is a monoclonal antibody of the IgG1 isotype and comprises a light chain of the Kappa subtype. The L1M2 light chain is of the Kappa subtype and its amino acid sequence is set forth in SEQ ID NO: 13. The H4 heavy chain has an amino acid sequence set forth in SEQ ID NO: 14. In a particular embodiment, the specific binding molecule for use according to the invention is an L1M2H4 antibody comprising an L1M2 light chain and an H4 heavy chain. Thus, the specific binding molecule for use according to the invention may be a monoclonal antibody comprising or consisting of: (i) a light chain comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 13, or an amino acid sequence having at least 70% sequence identity (preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to this amino acid sequence and at least 85% sequence identity to SEQ ID NO: 1, SEQ ID NO: 7, or SEQ ID NO: 8, and SEQ ID NO: 2 to 3, respectively, of CDR sequences VLCDR1 to VLCDR3; (ii) a heavy chain comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 14, or an amino acid sequence having at least 70% sequence identity (preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to this amino acid sequence and at least 85% sequence identity to SEQ ID NOs: 4 to 6 for each of CDR sequences VH CDR1 to 3.

[0072] Similarly, the L2M2 light chain is of the kappa subtype and its amino acid sequence is set forth in SEQ ID NO: 15. The amino acid sequence of the H2 heavy chain is set forth in SEQ ID NO: 16. In a particular embodiment, a specific binding molecule for use according to the invention is an L2M2H2 antibody comprising an L2M2 light chain and an H2 heavy chain. Accordingly, a specific binding molecule for use according to the invention may be a monoclonal antibody comprising or consisting of: (i) a light chain comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 15, or an amino acid sequence having at least 70% sequence identity (preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to this amino acid sequence and at least 85% sequence identity to SEQ ID NO: 1, SEQ ID NO: 7, or SEQ ID NO: 8, and SEQ ID NO: 2 to 3, respectively, of CDR sequences VLCDR1 to VLCDR3; (ii) a heavy chain comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 16, or an amino acid sequence having at least 70% sequence identity (preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to this amino acid sequence and at least 85% sequence identity to SEQ ID NOs: 4 to 6 for each of CDR sequences VH CDR1 to 3.

[0073] In another embodiment, the L1M2 light chain is paired with an H2 heavy chain and the L2M2 light chain is paired with an H4 heavy chain. Can be paired with a chain.

[0074] As is known to those skilled in the art, antibody chains are naturally produced with signal sequences. Antibody signal sequences are amino acid sequences located at the N-terminus of the light and heavy chains, i.e., the N-terminus of the variable region. The signal sequence enables the antibody chain to be transported from the cell in which it is produced. When produced in a cell expression system, the light and heavy chains having the amino acid sequences of SEQ ID NOS: 13-16 may be encoded by the signal sequence. The signal sequence for the L1M2 light chain and the L2M2 light chain is shown in SEQ ID NOS: 20, and the signal sequence for the H2 heavy chain and the H4 heavy chain is shown in SEQ ID NOS: 21. Therefore, when synthesized with a signal sequence, the L1M2 chain may be synthesized with the amino acid sequence shown in SEQ ID NOS: 22, the H4 chain may be synthesized with the amino acid sequence shown in SEQ ID NOS: 23, the L2M2 chain may be synthesized with the amino acid sequence shown in SEQ ID NOS: 24, and the H2 chain may be synthesized with the amino acid sequence shown in SEQ ID NOS: 25. Nucleotide sequences encoding such sequences can be easily derived by those skilled in the art, but examples of sequences that encode the antibody chains of SEQ ID NOs: 22 to 25 and are suitable for use in their synthesis include the nucleotide sequences shown in SEQ ID NOs: 26 to 29, respectively.

[0075] As detailed above, the present invention provides specific binding molecules (as described above) for use in treating cancer in a subject. Use in the treatment of cancers such as testicular cancer, ovarian cancer, colon cancer, cervical cancer, breast cancer, bladder cancer, bile duct cancer, gastric cancer, head and neck cancer, esophageal cancer, lung cancer, pancreatic cancer, mesothelioma, lymphoma, brain tumor, neuroblastoma, and the like is also within the scope. In a preferred embodiment, ovarian cancer is treated. In another preferred embodiment, breast cancer is treated. In a preferred embodiment, the breast cancer expresses one or more of estrogen receptor (ER), progesterone receptor (PR), and human epidermal growth factor receptor HER2. In another embodiment, the breast cancer is triple negative (i.e., ER- / PR- / HER2-). In another preferred embodiment, colon cancer is treated. In another preferred embodiment, pancreatic cancer is treated. In another preferred embodiment, lung cancer is treated. Cancer types (adenocarcinoma, squamous cell carcinoma, All types of cancer, including basal cell carcinoma, transitional cell carcinoma, sarcoma, leukemia, and lymphoma , may be treated according to the present invention.

[0076] According to the present invention, cancers of any stage (i.e., grade) may be treated, including stage I cancer, stage II cancer, stage III cancer, and stage IV cancer. Both metastatic and localized (i.e., non-metastatic) cancers may be treated.

[0077] In certain embodiments of the present invention, the cancer expresses Anx-A1 (meaning that cells in the cancer express Anx-A1, for example, on the cell surface). It is straightforward for one skilled in the art to determine whether a cancer expresses Anx-A1. Anx-A1 expression may be analyzed in a cancer biopsy sample, for example, at the protein level by immunohistochemical analysis of the sample. The sample is immunostained with an anti-Anx-A1 antibody (such as the antibody described above that can be used in accordance with the present invention) to detect Anx-A1 expression according to standard procedures in the art. Intracellular and extracellular Anx-A1 may be detected by permeabilizing the sample (e.g., with a detergent, as is standard in the art).

[0078] Alternatively, Anx-A1 expression can be analyzed at the nucleic acid level, for example, by quantitative PCR (qPCR). mRNA can be extracted from tissue samples and reverse transcribed into DNA using standard procedures in the art. The Anx-A1 expression level can then be determined by quantitative amplification of the target Anx-A1 sequence. Suitable qPCR techniques, such as TaqMan, are well known in the art.

[0079] In certain embodiments, the cancer overexpresses Anx-A1. "Expresses" means that cancer cells express Anx-A1 at a higher level than healthy tissue from the same source. That is, cancer cells express Anx-A1 at a higher level than healthy (i.e., non-cancerous) cells from the same source. "Same source" means the same tissue. For example, if an ovarian epithelial cell carcinoma expresses Anx-A1 at a higher level than healthy ovarian epithelial tissue, it would be considered to overexpress Anx-A1. To determine whether a cancer tissue overexpresses Anx-A1, a quantitative comparison of Anx-A1 expression in at least two different tissues (cancer tissue and healthy control tissue) is required. Any suitable technique can be used to make this comparison, but qPCR would be most suitable. It would be straightforward for one skilled in the art to determine whether a cancer overexpresses Anx-A1. In certain embodiments, the difference in Anx-A1 expression level between an Anx-A1-overexpressing cancer and a healthy tissue is statistically significant. In other embodiments, expression of Anx-A1 in cancer tissue is increased by at least 10% or more, 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, or 100% or more compared to corresponding healthy tissue.

[0080] In another embodiment of the present invention, cancer expresses Anx-A1 on its surface (i.e., Anx-A1 is expressed on the surface of cancer cells). Expression of Anx-A1 on the surface of cancer cells means that the cells express Anx-A1 and that the expressed Anx-A1 is transported and localized on the cell surface. Cell surface expression of Anx-A1 may be identified by immunohistochemistry, as described above. In particular, to analyze cell surface Anx-A1 expression, immunohistochemistry is performed without permeabilization. This means that the antibody used to detect Anx-A1 cannot enter the interior of the cell, and only extracellular (e.g., surface-localized) protein is detected. Transported Anx-A1 is usually attached to the cell surface (rather than released into plasma or other extracellular spaces), and therefore, the Anx-A1 detected by immunohistochemistry on non-permeabilized cells may be considered to be surface-localized Anx-A1. However, prior to staining, the tissue may be washed to remove free extracellular material such as proteins, according to standard protocols.

[0081] The cancer to be treated by the present invention may be a drug-resistant cancer. That is, the cancer may be resistant to one or more chemotherapeutic agents (chemotherapeutic drugs). Drug resistance in cancer is discussed in Housman et al. (see above). If the cancer cannot tolerate the chemotherapeutic drug, If the drug becomes ineffective (or ineffective) against the cancer, the cancer can be considered resistant to the chemotherapy drug. As previously reported, cancers can acquire drug resistance through various mechanisms, including drug inactivation or metabolism (or prevention of metabolic activation), mutation or modification of the drug target, and drug efflux via ABC transporters. Methods for identifying whether a cancer is resistant to a drug are known in the art. For example, Wang et al. (Genes & Diseases 2: 219-221, 2015) and See the teachings of Wang and Volm & Efferth (Front. Oncol. 5: 282, 2015), both of which are incorporated herein by reference. Such methods include testing the effect of drugs on cell populations ex vivo and genetically screening cancer cells for sensitivity / resistance markers.

[0082] In certain embodiments, the cancer treated by the present invention is multidrug resistant (MDR). MDR cancer refers to a cancer that is resistant to one or more chemotherapeutic agents, particularly to one or more families of chemotherapeutic agents. An MDR cancer may be resistant to two or more, three or more, four or more, or five or more different chemotherapeutic agents or families (classes) of chemotherapeutic agents. The term "MDR cancer" is well known in the art and is used in this context according to its meaning in the art. An MDR cancer may be resistant to all known chemotherapeutic agents. Multidrug resistance can occur due to one or more ABC transactivators. This may be mediated by the expression of the porter multidrug resistance protein (MDR1), multidrug resistance-associated protein 1 (MRP1), and breast cancer resistance protein (BCRP), all three of which have broad substrate specificity and can efflux many different classes of chemotherapeutic agents from cells that express them.

[0083] The specific binding molecules for use in the present invention are shown in the Examples to be particularly effective in inhibiting the growth of cancer cells resistant to platinum-based chemotherapy. In certain embodiments, the cancer treated in accordance with the present invention is resistant to platinum-based chemotherapy. (Preferably, the cancer is breast cancer, colon cancer, ovarian cancer, lung cancer, or pancreatic cancer.) Platinum-based chemotherapy agents include cisplatin, oxaliplatin, carboplatin, and nedaplatin, all of which are approved for human use. Other known platinum-based chemotherapy agents include satraplatin, picoplatin, phenanthriplatin, and triplatin tetranitrate. The cancer treated in accordance with the present invention may be resistant to any or all of these agents. In certain embodiments, the cancer is resistant to cisplatin.

[0084] Cancer cells may also or alternatively be resistant to other bifunctional alkylating agents, such as nitrogen mustards (eg, bendamustine, chlorambucil, cyclophosphamide, ifosfamide, mechlorethamine, and melphalan).

[0085] In alternative or additional embodiments, the cancer treated according to the present invention may be resistant to chemotherapeutic agents such as taxanes (e.g., paclitaxel or docetaxel), topoisomerase inhibitors (e.g., topotecan), anthracyclines (e.g., doxorubicin or epirubicin), or nucleoside analogs (e.g., gemcitabine). Preferably, the chemotherapeutic agent in this embodiment is an anthracycline, such as doxorubicin (also known as adriamycin). In other embodiments, the cancer treated according to the present invention is resistant to hormone therapy (e.g., anti-estrogen hormone therapy, such as tamoxifen). Breast cancer may be particularly resistant to hormone therapy, such as tamoxifen. The cancer treated according to the present invention may be resistant to any or all of these agents. (Preferably, the cancer is breast, colon, ovarian, lung, or pancreatic cancer.) In certain embodiments, the cancer is resistant to doxorubicin (possibly in addition to being resistant to platinum-based chemotherapy agents).

[0086] As noted above, there are numerous mechanisms by which cancer cells acquire resistance to platinum-based chemotherapy. For example, cancers produce metallothionein and / or glutathione, which inactivate platinum-based drugs, and DNA damage induced by these drugs is repaired by active nucleotide excision repair and homologous recombination pathways, subverting the activity of platinum-based drugs. Other mechanisms are also operative, and multiple non-overlapping mechanisms may be required to create cells resistant to platinum-based therapy. Patients identified as platinum-resistant have tumor progression within six months of their most recent platinum-based chemotherapy. Cell proliferation assays, which examine germ cell survival after drug exposure, may be used to identify cells as platinum-resistant. This is determined by the ability of cancer cells to form tumors or masses after drug exposure.

[0087] The specific binding molecule may be administered to a subject to be treated in the form of a pharmaceutical composition. Such a composition may contain one or more pharmaceutically acceptable diluents, carriers, or excipients. As used herein, "pharmaceutically acceptable" refers to a component that is compatible with the other components of the composition and physiologically acceptable to the recipient. The type and dosage of the composition and carrier or excipient substance may be selected in a routine manner depending on preferences, the desired route of administration, and the like. The dosage may also be determined in a routine manner, taking into account the type of molecule, the age of the patient, and the like. It may be determined depending on the administration form, etc.

[0088] The pharmaceutical composition may be prepared by any suitable means for administration to a subject. Such administration may be, for example, oral, rectal, nasal, topical, vaginal, or parenteral administration. Oral administration herein includes buccal and sublingual administration. Topical administration herein includes transdermal administration. Parenteral administration as defined herein includes subcutaneous, intramuscular, intravenous, intraperitoneal, and intradermal administration.

[0089] The pharmaceutical compositions disclosed herein may be in the form of solutions or syrups, solid compositions such as powders, granules, tablets, or capsules, creams, ointments, and other compositions commonly used in the art. Suitable pharmaceutically acceptable diluents, carriers, and excipients for use in such compositions are well known in the art. For example, suitable excipients include lactose, corn starch or its derivatives, stearic acid or its salts, vegetable oils, waxes, fats, and polyols. Suitable carriers or diluents include carboxymethylcellulose (CMC), methylcellulose, hydroxypropylmethylcellulose (HPMC), dextrose, trehalose, liposomes, polyvinyl alcohol, pharmaceutical-grade starch, mannitol, lactose, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose (and other sugars), magnesium carbonate, gelatin, fats and oils, alcohols, surfactants, and emulsifiers such as polysorbates. Stabilizers, wetting agents, emulsifiers, sweeteners, and the like may also be used. Stabilizing agents, wetting agents, emulsifying agents, sweetening agents, and the like may also be used.

[0090] Liquid pharmaceutical compositions, whether in solution, suspension, or other similar form, may contain one or more of the following: sterile diluents such as water for injection, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic monoglycerides or diglycerides that can serve as solvents or suspending media, polyethylene glycol, glycerin, propylene glycol, or other solvents; antibacterial agents such as benzyl alcohol or methylparabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates, or phosphates, and agents for adjusting tonicity such as sodium chloride or dextrose. Parenteral preparations can be enclosed in ampoules, disposable syringes, or multiple-dose vials made of glass or plastic. Injectable pharmaceutical compositions are preferably sterile.

[0091] Therefore, pharmaceutical compositions for use according to the present invention may be administered in an appropriate manner. The dosage and frequency of administration are determined by factors such as the patient's condition and the type and severity of the patient's disease, and appropriate dosages may be determined through clinical trials. Specific binding molecules for use according to the present invention may be conveniently administered to a subject once daily, once weekly, or once monthly, or at intermediate frequencies. For example, administration may be every 2, 3, 4, 5, or 6 days, or every 2, 3, 4, 5, or 6 weeks, or every 2, 3, 4, 5, or 6 months, or once or twice a year. Administration may be in the range of 10 ng / kg to 100 mg / kg of body weight, for example, in the range of 1 μg / kg to 10 mg / kg of body weight, or in the range of 10 μg / kg to 1 mg / kg of body weight. A skilled clinician will be able to calculate the appropriate dosage for a patient based on all relevant factors such as age, height, weight, and the condition being treated.

[0092] Preferably, the specific binding molecules, formulations, or pharmaceutical compositions for use in accordance with the present invention are administered to a subject in need thereof in a therapeutically effective amount. By "therapeutically effective amount" is meant an amount sufficient to have an effect on the subject's condition. Whether or not this amount is sufficient may be determined by a doctor / veterinarian.

[0093] The treatment may further comprise administering a second therapeutic agent to the subject. However, in the uses of the present invention, the specific binding molecule is conveniently the only therapeutic molecule used in the treatment, e.g., without other cytotoxic or immunotherapeutic agents. Cytotoxic agents are discussed below. Immunotherapeutic agents are administered agents that act to induce, enhance, or suppress an immune response.

[0094] In certain embodiments, specific binding molecules for use in the present invention are not used to deliver a second therapeutic molecule to a cancer target, e.g., in certain embodiments, the specific binding molecule is not conjugated to (or provides a binding partner for) a second therapeutic molecule, such as a cytotoxic molecule or a radionuclide.

[0095] When a second therapeutic agent is used, it may be administered in the same pharmaceutical composition as the specific binding molecule that binds Anx-A1, or in a separate pharmaceutical composition, which may be as described above. (Thus, in the case of use in making a medicament, the medicament may include the specific binding molecule (or second therapeutic agent), and the treatment may involve administering the second therapeutic agent (or specific binding molecule) separately, simultaneously, or sequentially with the medicament.) The specific binding molecule that binds Anx-A1 and the second therapeutic agent may be administered separately, simultaneously, or sequentially to a subject. As used herein, "separate" administration means that the specific binding molecule and the second therapeutic agent are administered to a subject simultaneously, or at least substantially simultaneously, sequentially, but by different administration routes. As used herein, "simultaneous" administration means that the specific binding molecule and the second therapeutic agent are administered to a subject simultaneously, or at least substantially simultaneously, by the same administration route. As used herein, "sequential" administration means that the specific binding molecule and the second therapeutic agent are administered to a subject at different times. In particular, administration of a first therapeutic agent is completed before administration of a second therapeutic agent begins. Sequential administration may occur by separating the administration of a first therapeutic agent and the administration of a second therapeutic agent by 10 minutes to 30 days, for example, 1 hour to 96 hours (or 2 weeks). When administered sequentially to a subject, the first and second therapeutic agents may be administered by the same or different routes of administration.

[0096] The second therapeutic agent may be a second anti-cancer agent, but in other embodiments may function differently. For example, the second therapeutic agent may be an antibiotic or anti-fungal agent, or another agent useful for treating the patient. In certain embodiments, the second therapeutic agent is a chemotherapeutic agent, particularly a cytotoxic agent. As referred to herein, a chemotherapeutic agent is an agent administered to destroy malignant cells or tissue. A cytotoxic agent is a substance that destroys cells or prevents cell proliferation. Any chemotherapeutic agent from any class may be used. For example, taxanes (e.g., paclitaxel and docetaxel), topoisomerase inhibitors (e.g., topotecan), anthracyclines (e.g., doxorubicin and epirubicin), nucleoside analogs (e.g., gemcitabine), platinum-based agents (e.g., cisplatin and carboplatin), alkylating agents (e.g., cyclophosphamide), kinase inhibitors, and the like. Anti-cancer drugs (such as imatinib), or other chemotherapeutic agents or agents previously mentioned may also be used.

[0097] Such agents may be used in combination with the specific binding molecules for use in the present invention. In one embodiment, the chemotherapeutic agent may be an agent to which the cancer is resistant (when treated without the specific binding molecules for use in the present invention). In another embodiment, the chemotherapeutic agent is not an agent to which the cancer is resistant (when treated without the specific binding molecules for use in the present invention).

[0098] The specific binding molecules for use according to the present invention may also be administered to a subject in combination with radiation therapy and / or surgery.

[0099] As detailed above, the present invention is for use in treating cancer in a subject. Treatment may be curative (or may be intended to be curative) or may be palliative (i.e., merely limiting, relieving, or ameliorating the symptoms of cancer, or prolonging survival). Preferably, treatment shrinks the tumor or slows or reduces its rate of growth. A reduction in tumor size of at least 10%, preferably at least 20%, 30%, or 50% (e.g., Preferably, the level of proliferation reduction is less than 30%, less than 50%, less than 75%, or less than 100%.

[0100] The subject to be treated in the present invention refers to a mammal, for example, livestock such as cows, horses, sheep, pigs, or goats, pet animals such as rabbits, cats, or dogs, or primates such as monkeys, chimpanzees, gorillas, or humans. Most preferably, the subject is a human. The subject may be any animal (preferably a human) suffering from or suspected of suffering from cancer. Thus, the subject is an individual in need of cancer treatment.

[0101] The present invention may therefore be viewed as providing a method of treating cancer in a subject, said method comprising administering to said subject a specific binding molecule that binds to human Anx-A1, wherein said treatment, cancer, subject, and / or specific binding molecule may be as defined above.

[0102] Similarly, the present invention may be considered to provide the use of a specific binding molecule that binds human Anx-A1 in the manufacture of a medicament for the treatment of cancer in a subject, wherein the treatment, cancer, subject, and / or specific binding molecule may be as defined above.

[0103] In another aspect, the present invention provides a kit comprising a specific binding molecule that binds to human Anx-A1, as defined above, and a chemotherapeutic agent. Suitable chemotherapeutic agents are described above. The specific binding molecule and the chemotherapeutic agent may be provided in separate containers, i.e., as separate compositions, or may be provided in a single container as a single composition. Each therapeutic agent may be provided in an appropriate form, for example, as an aqueous solution or as a lyophilized product.

[0104] In another aspect, the present invention provides a product comprising a specific binding molecule that binds to human Anx-A1, as defined above, and a second therapeutic agent, for separate, simultaneous, or sequential use in treating cancer in a subject. The second therapeutic agent, the cancer, and / or the subject may be as defined above. In certain embodiments, the second therapeutic agent is a chemotherapeutic agent. The specific binding molecule and the second therapeutic agent may be provided in separate containers, i.e., in separate compositions, or may be provided in a single container as a single composition. Each therapeutic agent may be provided in an appropriate form, for example, as an aqueous solution or as a lyophilized product.

[0105] All documents cited in this application are incorporated herein by reference in their entirety.

[0106] The present invention will be further understood by reference to the following non-limiting examples. [Brief explanation of the drawings]

[0107] [Figure 1] Figure 1 shows the effects of the anti-Anx-A1 antibodies L1M2H4 and L2M2H2 on the proliferation of the breast cancer cell line MCF7. Error bars indicate the standard error of the mean. [Figure 2] Figure 2 shows the effects of the anti-Anx-A1 antibodies L1M2H4 and L2M2H2 on the proliferation of the breast cancer cell line HCC1806. Error bars indicate the standard error of the mean. [Figure 3] Figure 3 shows the effects of anti-Anx-A1 antibodies L1M2H4 and L2M2H2 on the proliferation of the ovarian cancer cell line A2780. Error bars indicate the standard error of the mean. [Figure 4] 4 shows the effects of anti-Anx-A1 antibodies L1M2H4 and L2M2H2 on the proliferation of the ovarian cancer cell line A2780cis. Error bars indicate the standard error of the mean. [Figure 5] 5 shows the effect of the anti-Anx-A1 antibody L2M2H2 on the proliferation of the ovarian cancer cell line A2780ADR. Error bars indicate the standard error of the mean. [Figure 6] 6 shows the effects of anti-Anx-A1 antibodies L1M2H4 and L2M2H2 on the proliferation of the pancreatic cancer cell line MIA PaCa-2. Error bars indicate the standard error of the mean. [Figure 7] 7 shows the effects of anti-Anx-A1 antibodies L1M2H4 and L2M2H2 on the proliferation of the pancreatic cancer cell line BxPC-3. Error bars indicate the standard error of the mean. [Figure 8] Figure 8 shows the effects of anti-Anx-A1 antibodies MDX-124 and ab65844 on the proliferation of the breast cancer cell line HCC1806. The effect of a nonspecific control IgG is also shown. Error bars indicate the standard error of the mean. [Figure 9] 9 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of breast cancer cell line MCF7. Error bars indicate the standard error of the mean. [Figure 10] 10 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of the tamoxifen-resistant breast cancer cell line MCF-7 / TAMR7. Error bars indicate the standard error of the mean. [Figure 11]Figure 11 shows the effects of anti-Anx-A1 antibodies MDX-124 and ab65844 on the proliferation of the ovarian cancer cell line A2780. The effect of a nonspecific control IgG is also shown. Error bars indicate the standard error of the mean. [Figure 12] Figure 12 shows the effects of the anti-Anx-A1 antibodies MDX-124 and ab65844 on the proliferation of the colon cancer cell line HCT116. The effect of a nonspecific control IgG is also shown. Error bars indicate the standard error of the mean. [Figure 13] 13 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of the colon cancer cell line Caco-2. Error bars indicate the standard error of the mean. [Figure 14] 14 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of the colon cancer cell line SW480. Error bars indicate the standard error of the mean. [Figure 15] Figure 15 shows the effects of anti-Anx-A1 antibodies MDX-124 and ab65844 on the proliferation of the pancreatic cancer cell line BxPC-3. The effect of a nonspecific control IgG is also shown. Error bars indicate the standard error of the mean. [Figure 16] 16 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of the pancreatic cancer cell line MIA PaCa-2. Error bars indicate the standard error of the mean. [Figure 17] 17 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of the pancreatic cancer cell line PANC-1. Error bars indicate the standard error of the mean. [Figure 18] Figure 18 shows the effects of anti-Anx-A1 antibodies MDX-124 and ab65844 on the proliferation of the lung cancer cell line COR-L23. The effect of a nonspecific control IgG is also shown. Error bars indicate the standard error of the mean. [Figure 19]19 shows the effects of anti-Anx-A1 antibody MDX-124 and nonspecific control IgG on the proliferation of the adriamycin-resistant lung cancer cell line COR-L23.5010. Error bars indicate the standard error of the mean. [Figure 20] Figure 20 shows the results of treatment with MDX-124 in a mouse model of breast cancer. The figure shows the mean tumor volume for the four treatment groups. Group 1 was the control group and received only the vehicle (PBS) at the dose level. Group 2 received MDX-124 at a dose of 1 mg / kg, Group 3 received MDX-124 at a dose of 10 mg / kg, and Group 4 received MDX-124 at a dose of 25 mg / kg. Error bars indicate the standard error of the mean. [Figure 21] Figure 21 shows the results of treatment with MDX-124 in a mouse model of breast cancer. The figure shows the mean relative tumor volumes for the four treatment groups. Group 1 was the control group and received only the vehicle (PBS) at the dose level. Group 2 received a 1 mg / kg dose of MDX-124, Group 3 received a 10 mg / kg dose of MDX-124, and Group 4 received a 25 mg / kg dose of MDX-124. The tumor volume on day 12, the day of the first treatment administration, is defined as the baseline tumor volume, i.e., 100% relative tumor volume. The relative tumor volumes presented therefore correspond to the volume of each tumor as a percentage based on the volume on day 12.

[0108] Example Example 1 - Effect of antibodies on cell proliferation material The cell lines MCF7, MCF-7 / TAMR7, A2780, A2780cis, A2780ADR, HCT116, Caco-2, SW480, COR-L23, COR-L23.5010, MIA-PaCa-2, PANC-1, and BxPC-3 were obtained from Public Health England Culture Collections. The cell line HCC1806 was obtained from ATCC. MCF7 is a human breast cancer cell line that is estrogen receptor and progesterone receptor positive. MCF-7 / TAMR7 is a tamoxifen-resistant derivative of MCF7. HCC1806 is a triple-negative human breast cancer cell line. A2780 is a human ovarian cancer cell line, and A2780cis is a cisplatin-resistant human ovarian cancer cell line (derived from A2780). A2780ADR is an adriamycin-resistant human ovarian cancer cell line (derived from A2780). MIA PaCa-2 is a human pancreatic cancer cell line. BxPC-3 is a Human pancreatic adenocarcinoma cell lines. PANC-1 is a human pancreatic epithelioid carcinoma cell line. Caco-2 is a human colorectal adenocarcinoma cell line. HCT116 is a human colorectal adenocarcinoma cell line. SW480 is a human colorectal adenocarcinoma cell line. COR-L23 is a human large cell lung carcinoma cell line. COR-L23 .5010 is an adriamycin-resistant derivative of COR-L23. The L1M2H4 and L2M2H2 anti-Anx-A1 antibodies are disclosed in WO2018 / 146230 and their sequences are set forth herein. The L1M2H4 antibody has a light chain having the amino acid sequence set forth in SEQ ID NO: 13 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: 14. The L2M2H2 antibody has a light chain having the amino acid sequence set forth in SEQ ID NO: 15 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16. Anti-Anx-A1 antibody ab65844 was obtained from Abcam (UK). This antibody is a polyclonal rabbit antibody that binds to human Anx-A1 amino acids 3-24 (SEQ ID NO: 30). This epitope sequence is located in Ca 2+ It forms part of the N-terminal region of Anx-A1, which binds in the core pocket of Anx-A1 in the absence of ATP. That's exactly what I did.

[0109] method cell culture For the initial proliferation assay, cells were cultured in the following medium: DMEM + Glutamax, 10% FBS + penicillin / streptomycin (MCF7, MIA PaCa-2, HCC1806), PRMI1640 + 2 mM L-glu, 10% FBS + penicillin / streptomycin (BxPc-3, A2780). A2780cis and A2780ADR were cultured in the same growth medium as A2780, but contained the respective drug to maintain drug resistance at various stages of culture (i.e., A2780cis contained cisplatin, and A2780ADR contained adriamycin). In further proliferation assays, cells were cultured in the following media under the following conditions. MCF7, HCC1806, MIA PaCa-2, and PANC-1 were cultured in 10% FBS. , cultured in DMEM containing 1% penicillin / streptomycin, and 1% L-glutamine. MCF7 / TAMR7 cells were cultured in 1% FBS, 1% penicillin / streptomycin, 1 % L-glutamine, and 1% insulin in phenol red-free DMEM / F12. A2780, COR-L23, COR-L23.5010, and BxPC-3 were cultured in RPMI containing 10% FBS, 1% penicillin / streptomycin, and 1% L-glutamine. HCT116 were cultured in McCoy's 5A containing 10% FBS, 1% penicillin / streptomycin, and 1% L-glutamine. SW480 were cultured in L-15 containing 10% FBS, 1% penicillin / streptomycin, and 1% L-glutamine. Caco-2 were cultured in MEM containing 10% FBS, 1% penicillin / streptomycin, 1% L-glutamine, and 1% non-essential amino acid solution. Furthermore, COR-L23.5010 was cultured in the presence of adriamycin to maintain drug resistance. All cell lines were cultured at 37°C in an atmosphere containing 5% CO2.

[0110] Cell proliferation assay Cell proliferation was measured using the MTT colorimetric assay to measure cellular metabolic activity. In this assay, NADPH-dependent cellular oxidoreductase reduces a yellow tetrazolium dye, or MTT, to an insoluble purple formazan product, which is quantified by measuring absorbance at 500–600 nm using a spectrophotometer. The amount of formazan is proportional to the level of cell proliferation; rapidly dividing cells reduce higher levels of MTT. Assays were performed in triplicate. Cells were seeded in a final volume of 100 μL. In the initial proliferation assay, cells were seeded at the following densities: 1 × 10 5 / mL (MCF7, MIA PaCa-2, and A2780cis in n = 2), 2 × 10 5 / mL(A 2780, A2780ADR, and A2780cis (n = 1), 5 × 10 4 / mL (HCC1806) and 2.5 × 10 4 / mL(BxPC-3). In further proliferation assays, cells were seeded at the following densities: MCF7, HCC1806, A2780, A2780, A2780cis, COR-L23, and HCT116 cells were cultured at 5 × 10 3 Seed per well, MCF7 / TAMR7, COR-L23.5010, SW480, Caco-2, MIA PaCa-2, BxPC-3, and PANC-1 cells were cultured at 1 × 10 4 / well. The cells were then cultured for 24 hours before assay, after which cell proliferation was measured according to one of the following protocols: (a) In the absence of antibody (as a control), ) was added at 1 μM, or antibodies (L1M2H4 or L2M2H2) were added at 10 μM, and the cells were cultured for 48 hours. MTT assays were performed up to three times separately with various cancer cell lines (primary proliferation assay). (b) Cultured for 72 hours in the absence or presence of antibodies at concentrations of 2.5 μM, 5 μM, 7.5 μM, or 10 μM. The antibodies used in this protocol were L1M2H4 (also referred to herein as MDX-124), the commercially available anti-Anx-A1 antibody ab65844, and a non-Anx-A1 specific IgG (Thermo Fisher Scientific, USA, Cat. No. 31154) as an isotype control (further proliferation assays). The cell counts of the control cultures were established as baseline counts for the proliferation assay. Cell counts of the antibody-treated cultures were normalized to the baseline and presented as a percentage of the baseline value (referred to as "viability"). Statistical analysis of cell proliferation assay results was performed using the Mann-Whitney U test.

[0111] ELISA ELISA was performed by The Antibody Company (UK) using standard ELISA techniques. 25 μg / ml of full-length Anx-A1 or Anx-A1 N-terminal peptide was used. (corresponding to Anx-A1 amino acids 2-26, SEQ ID NO: 31), and coating buffer (45 mM Na2CO3, pH 9.6 supplemented with 1 mM CaCl2) for 17 hours at 4°C on an ELISA plate. CaCl2, 10 mM HEPES, 2% w / v BSA) at room temperature for 1.5 hours Then, the plate was blocked. The primary antibody (ab65844) was then added to the plate. The antibody was applied across the plate in duplicate at four-fold dilutions, starting at a concentration of 1 μg / ml and ending at 2.38 × 10 -7 The antibody was diluted in wash buffer (10 mM HEPES, 150 mM NaCl, 0.05% (v / v) Tween-20, and 1 mM CaCl) supplemented with 0.1% BSA. The primary antibody was added to the plate for 1 hour at room temperature, and then incubated for 1 hour. The plate was washed with wash buffer. Next, a detection antibody was added. For detection, a horseradish peroxidase (HRP)-conjugated goat anti-rabbit antibody (Merck, Germany, Cat. No. AP156P) was used at a dilution of 1:3000. This was added to the ELISA plate at room temperature for 1 hour. After that, the ELISA plate was washed again with wash buffer. Next, the colorimetric substrate OPD (o-phenylenediamine dihydrochloride, Sigma-Aldrich, P4664) was added to the plate. OPD solution was prepared according to the manufacturer's instructions to obtain a 0.4 mg / ml OPD solution in phosphate-citrate buffer (pH 5). Just before use, add 40 μl of 30% H2O2 per 100 ml of OPD solution. Then, 100 μl of the obtained OPD solution was added to each well of the plate. Incubate the plate for 20 minutes in the dark at room temperature, then add 50 μl of 3M H2 The reaction was stopped by adding SO4. Immediately after the addition of H2SO4, the plate was read for absorbance at 492 nm.

[0112] result The commercially available anti-Anx-A1 antibody ab65844 was tested by ELISA to confirm binding of its reported epitope. This assay demonstrated that antibody ab65844 binds to both full-length Anx-A1 and the N-terminal Anx-A1 peptide (data not shown), confirming the reported epitope of amino acids 3-24 of human Anx-A1 (SEQ ID NO: 30).

[0113] Early proliferation assay The first proliferation assay measured proliferation over a 48-hour period and tested two antibodies: The effect of L1M2H4 and antibody L2M2H2 on the cell lines was compared to incubation in the absence of antibody (ie using protocol (a) above). The results of these proliferation assays for breast cancer cell lines are shown in Figures 1 and 2. As shown, the L1M2H4 antibody reduced MCF7 cell proliferation at 10 μM with a statistically significant effect (p<0.001), n=1. In the HCC1806 cell line, the L2M2H2 antibody also significantly reduced proliferation at 10 μM (p<0.05) (n=2). The results of a proliferation assay of the ovarian cancer cell line A2780 are shown in Figure 3. As shown, incubation with the L1M2H4 antibody resulted in a statistically significant decrease in proliferation at 10 μM (p<0.01) (n=2). In the cisplatin-resistant ovarian cancer cell line, A2780cis (Figure 4), incubation with the L1M2H4 antibody resulted in a statistically significant decrease in proliferation at 1 μM (p<0.001) and 10 μM (p<0.01) (n=2), and the use of the L2M2H2 antibody resulted in a statistically significant decrease in proliferation at 10 μM (p<0.05) (n=3). The results of a proliferation assay of the adriamycin-resistant ovarian cancer cell line A2780ADR are shown in Figure 5. The L2M2H2 antibody had a significant effect on the proliferation of these cells. The results of the proliferation assay of pancreatic cancer cell lines are shown in Figures 6 and 7.

[0114] Further proliferation assays The proliferation assays were repeated, measuring proliferation over 72 hours. These assays compared the effect of an antibody of the invention (L1M2H4, also known as MDX-124) on proliferation to that of a nonspecific IgG control and, where indicated, to the effect of the commercially available anti-Anx-A1 antibody ab65844. Comparisons were also made to proliferation in the absence of antibody and used as a baseline. All experiments were performed in triplicate (MDX-124 and the IgG control were performed in triplicate, and where ab65844 was also tested, experiments with this antibody were performed twice).

[0115] We found that MDX-124 had a significant effect on the proliferation of the HCC1806 breast cancer cell line, reducing viability by nearly two-thirds (63%) compared to baseline (Figure 8). A nonspecific IgG control had no effect on viability. Compared to the nonspecific IgG control, MDX-124 was found to cause a statistically significant decrease in HCC1806 cell viability at all concentrations tested, with P values ​​of <0.001 (at an antibody concentration of 2.5 μM) or <0.0001 (at all antibody concentrations). Notably, the polyclonal anti-Anx-A1 antibody ab65844 actually increased cell viability (and thus proliferation). Indeed, at all antibody concentrations, MDX-124 was found to cause a statistically significant decrease in HCC1806 cell viability compared to ab65844, with P values ​​of <0.01 (at an antibody concentration of 2.5 μM) or <0.001 (at all antibody concentrations). This result indicates that MDX-124 inhibits the proliferation of HCC1806 cells (causing a significant decrease in viability). However, this effect is not observed for all anti-Anx-A1 antibodies, as ab65844 has the opposite effect on cell viability.

[0116] MDX-124 was also found to have a significant effect on the proliferation of the breast cancer cell line MCF7 and its tamoxifen-resistant derivatives (Figures 9 and 10, respectively). In both instances, the nonspecific IgG control reduced proliferation by no more than 26%. At the highest concentration, MDX-124 caused a significant 76% reduction in MCF7 cell viability and a significant (albeit lower) 47% reduction in the viability of the tamoxifen-resistant derivative MCF7 cells. Compared to the nonspecific IgG control, MDX-124 was found to cause a statistically significant reduction in MCF7 cell viability at all concentrations examined, with a P value of <0.0001. Compared to the nonspecific IgG control, MDX-124 also caused a statistically significant decrease in MCD7 / TAMR7 cell viability at concentrations of 5 μM, 7.5 μM, and 10 μM. P values ​​were P<0.01 for 5 μM and 7.5 μM, and P<0.05 for 10 μM, respectively. These results demonstrate that MDX-124 is highly effective in inhibiting breast cancer cell proliferation in both triple-negative and hormone receptor-positive cell lines. This antibody also has efficacy against drug-resistant breast cancer. This effect is specific to MDX-124 and is not seen with all anti-Anx-A1 antibodies.

[0117] Similarly, we found that MDX-124 had a significant effect on the proliferation of the ovarian cancer cell line A2780 (Figure 11). While nonspecific IgG reduced proliferation by only 30% (at the highest concentration), MDX-124 had more than a twofold effect on proliferation (causing a 61% reduction in proliferation at the highest concentration). Compared to the nonspecific IgG control, MDX-124 also caused a statistically significant reduction in A2780 cell viability at concentrations of 5 μM and 7.5 μM, as well as at 10 μM. P values ​​were P<0.05 for 5 μM and 7.5 μM, and P<0.01 for 10 μM, respectively. This effect was also not observed with the polyclonal anti-Anx-A1 antibody ab65844, which had no significant effect on proliferation. This antibody slightly increased proliferation at low concentrations (below 5 μM), but only a modest 5% reduction in proliferation at the highest concentration. Indeed, at antibody concentrations of 5 μM, 7.5 μM, and 10 μM, MDX-124 was found to cause a statistically significant decrease in A2780 cell viability compared to ab65844, with a P value of <0.001.

[0118] MDX-124 was also found to have a significant effect on colon cancer cell proliferation (Figures 12-14). The results for the proliferation of the HCT116 cell line are shown in Figure 12. MDX-124 reduced the proliferation of these cells by just over half (maximum 54% reduction in proliferation at the highest concentration). A nonspecific IgG control had virtually no effect on proliferation, while the polyclonal anti-Anx-A1 antibody ab65844 had different effects at different concentrations. Compared to the nonspecific IgG control, MDX-124 was found to cause a statistically significant decrease in HCT116 cell viability at all concentrations tested, with P values ​​of <0.001 (at antibody concentrations of 2.5 μM and 7.5 μM) or <0.0001 (at antibody concentrations of 5 μM and 10 μM). While the data for ab65844 are slightly conflicting, there is a general trend that this antibody further promotes cancer cell proliferation. On the other hand, compared to ab65844, MDX-124 was found to cause a statistically significant decrease in HCT116 cell viability at antibody concentrations of 2.5 μM and at antibody concentrations of 5 and 10 μM (P<0.01 at 2.5 μM and P<0.001 at both 5 and 10 μM). None of the data points suggest that ab65844 causes a decrease in proliferation.

[0119] Results with the cell lines Caco-2 (Figure 13) and SW480 (Figure 14) showed similar results. That is, MDX-124 significantly reduced proliferation, while the nonspecific IgG control had only a minimal effect. Compared to the nonspecific IgG control, MDX-124 was found to cause a statistically significant reduction in Caco-2 cell viability at all concentrations tested, with P values ​​of <0.05 (at antibody concentrations of 2.5 μM and 5 μM) or <0.001 (at antibody concentrations of 7.5 μM and 10 μM). Compared to the nonspecific IgG control, MDX-124 was found to cause a statistically significant reduction in SW480 cell viability at all concentrations tested, with P values ​​of <0.01 (at antibody concentration of 2.5 μM) or <0.0001 (at all antibody concentrations tested). These results demonstrate that MDX-124 is highly effective in inhibiting colon cancer cell proliferation, and this effect is also specific to MDX-124 and anti-Anx-A. 1 Not seen with all antibodies.

[0120] The effects of MDX-124 on pancreatic cancer cell lines are shown in Figures 15-17. The effects of MDX-124 on the cell line BxPC-3 are shown in Figure 15. MDX-124 also had a significant effect on cell proliferation, halving proliferation at the highest concentration. While a nonspecific IgG control had only a minimal effect on proliferation, the polyclonal anti-Anx-A1 antibody ab65844 again significantly increased proliferation. Compared to the nonspecific IgG control, MDX-124 caused a statistically significant decrease in BxPC-3 cell viability at all concentrations tested, with P values ​​of <0.001 (at an antibody concentration of 2.5 μM) or <0.0001 (at all antibody concentrations tested). Compared to ab65844, MDX-124 caused a statistically significant decrease in BxPC-3 cell viability, with P values ​​of <0.001 at all antibody concentrations tested.

[0121] The effects of MDX-124 on the MIA PaCa-2 and PANC-1 cell lines were investigated. This is shown in Figures 16 and 17. In both examples, MDX-124 caused a significant reduction in proliferation by almost half, while nonspecific IgG caused a much smaller reduction in viability. Compared to the nonspecific IgG control, MDX-124 caused a statistically significant reduction in MIA PaCa-2 cell viability at antibody concentrations of 5 μM and 10 μM. Compared to the nonspecific IgG control, MDX-124 was found to cause a statistically significant decrease in PANC-1 cell viability at all concentrations tested, with P values ​​of <0.05 (at an antibody concentration of 2.5 μM) or <0.001 (at all antibody concentrations tested).

[0122] The effects of MDX-124 on the lung cancer cell lines COR-L23 and COR-L23.5010 are shown in Figures 18 and 19, respectively. These results indicate that the MDX-124 antibody had a modest, but negative, effect on proliferation, whereas the nonspecific IgG control and the polyclonal anti-Anx-A1 antibody ab65844 showed very little effect on proliferation. Similar results were obtained with other lung cancer cell lines (data not shown).

[0123] conclusion Exposure to MDX-124 significantly reduced proliferation of cell lines from breast cancer (including triple-negative, hormone receptor-positive, and drug-resistant cell lines), colon cancer, ovarian cancer, lung cancer, and pancreatic cancer. The effect of MDX-124 on cancer cell proliferation is antibody-specific, meaning that not all antibodies directed against the same target (Anx-A1) have the same effect. This is demonstrated by the fact that ab65844 did not significantly decrease proliferation of any of the cell lines tested, and in fact increased proliferation in many cases. A nonspecific IgG control also did not cause the significant decrease in proliferation seen with MDX-124.

[0124] Example 2 - Epitope Determination HDX analysis was performed at the Natural and Medical Sciences Institute (NMI) of the University of Tübingen, Germany, using the L1M2H4 antibody.

[0125] Sample preparation and analysis Antibody-antigen complex formation and hydrogen-deuterium exchange Five aliquots of antibody-antigen samples and five aliquots of antigen without antibody were prepared as follows: 0.8 μL of Anx-A1 (41 μM), 1.8 μL of antibody (38.7 μM) or HEPES buffer (10 mM HEPES, 1 mM CaCl, 150 mM NaCl, pH 7.4), 1 μL of HEPES buffer, 0.5 μL of CaCl 2 (8 mM) was added and the mixture was incubated at 20° C. for 10 minutes. The salt content was adjusted by adding 8.5 μL of HEPES buffer. The antibody-antigen complexes were lyophilized overnight at 0°C and then at 15°C for 2 hours to remove as much water as possible. Ten lyophilized aliquots were frozen at -20°C until HDX exchange and LC-MS analysis. One aliquot of each antibody-antigen complex and the antigen without the antibody was solubilized in 12.5 μL of H2O, and the other in 12.5 μL of D2O. Each aliquot was prepared separately immediately before analysis, and the aliquots were incubated for the following times: 0 min (H2O standard sample); 5 min, 70 min, 360 min, and 24 h (DO deuterium exchanged dynamic sample). The exchange was quenched by adding 12.5 μL of freshly prepared quenching solution (0.8 M guanidine hydrochloride, 0.4 M TCEP, 100 mM ammonium formate buffer, pH 2.5).

[0126] Pepsin digestion Immediately after the addition of the quenching solution, 0.35 μL of pepsin (100 μM) was added and digestion was carried out for 2 min at 20° C. Aliquots were immediately placed into autosampler vials pre-cooled to −20° C. and injected into a liquid chromatography-mass spectrometry (LC-MS) system via a pre-cooled syringe.

[0127] LC-MS The resulting peptide mixture was injected and separated without pretreatment using reversed-phase high-performance liquid chromatography (HPLC, RSLC3000 LC, Thermo Scientific Dionex, Idstein, Germany). An LC column (ACQUITY UPLC BEH300 C18 1.7 μm 1x50mm Thermo Scientific Dionex, Idstein, Germany) was used for sample separation. was performed during successive sample runs. Chromatographic separation was performed using a nearly isocratic gradient over 31 min. Eluent A was water containing 0.1% formic acid, and eluent B was acetonitrile containing 0.1% formic acid. An optimized 20 min linear gradient was applied at temperatures up to 0 °C with varying slopes as follows (min / %B): 0 / 8, 3 / 8, 11.9 / 20, 31.9 / 20, 33 / 99, 34 / 99, 35 / 8. Manual injections were performed. The injection volume was 25.35 μL using a 20 μL sample loop. The flow rate was 40 μL / min. The HPLC eluent was injected directly into a QTOF mass spectrometer (MaXis HD, Bruker). The mass spectrometer was operated in positive ion mode, with a spray voltage of 1.9 kV, a capillary temperature of 275°C, and an S-lens RF voltage of 55 V.

[0128] Data analysis Data were analyzed using the software HDExaminer 2.40 beta1, 64-bit (SierraAnalytics, Modesto, CA, USA). Briefly, raw data sets containing different exchange time points were examined, and for each time point, analyses of Anx-A1 with and without antibody were considered. Using the Anx-A1 sequence information and a list of peptic peptide sequences with corresponding retention times and charges, the software identified deuterium-exchanged peptides. The deuterium uptake per peptide was calculated as the difference in centroid mass between deuterated and non-deuterated peptides. The overlapping peptide information (individual mass shifts of overlapping peptides) was used to manually further define the epitope region.

[0129] result After initial data evaluation using HDExaminer, individual peptic peptides were manually verified for statistically valid deuterium uptake. For peptides containing deuterium, the epitope region is the N-terminal portion of the peptide with deuterium incorporation and Further refinement was performed using HDX data without deuterium uptake, covering the C- and N-terminal portions. All experiments were repeated twice. In the first experiment, a potential epitope region was identified, but statistically significant deuterium uptake was also observed in a very long peptide, including the N-terminus, which is somewhat flexible from a structural point of view. In the second experiment, the epitope region could be defined, but the N-terminus showed no deuterium uptake. The underlined region in the sequence indicates the epitope to which the antibody binds. MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNE DLADSDARAL YEAGERRKGTDVN VFNTI LT TRSYPQLRRVF QKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN (SEQ ID NO: 17)

[0130] The identified epitope region is not in the self-interaction region of Anx-A1, and peptides from the self-interaction region show a slight tendency to incorporate more deuterium in the antibody-antigen complex sample, which may be due to a slight difference in local Anx-A1 concentration when two Anx-A1 molecules bind to the two arms of the antibody.

[0131] Example 3 - In vivo anticancer activity of MDX-124 method Tolerability study A tolerability study was conducted by Crown Biosciences (USA). Mice were administered MDX-124 at 1 mg / kg, 10 mg / kg, or 29 mg / kg once a week for two weeks. The body weight of each mouse was measured daily during the experiment. Weight loss was considered to be an indication of antibody toxicity to the mice.

[0132] Mouse breast cancer model Experiments using mice were performed by Crown Biosciences (USA). The mice used were 8-9 week-old female BALB / c mice. The breast cancer model used was the luciferase-expressing mouse breast cancer cell line 4T1-Luc. The cell line was obtained from ATCC and cultured in RPMI medium containing 10% FBS, 2 mM L-glutamine, and 2 μg / ml puromycin. Mice were shaved and implanted with a transponder chip for individual identification 72 hours later. Bepanthen cream was applied immediately after shaving and daily thereafter until tumor inoculation. Each mouse was first treated with 5 × 10 4T1-Luc cells suspended in 100 μl of PBS. 4 The mice were inoculated with 1000 mAbs. The inoculation was performed on day 0 into the mammary gland subcutaneous fat (the second-lowest mammary gland subcutaneous fat on the lower left side) while the mice were anesthetized with gas. The skin at the inoculation site was disinfected with 70% ethanol before inoculation.

[0133] Tumor size measurements were performed three times a week starting on day 5 using an IVIS Spectrum in vivo imaging system (PerkinElmer, USA). Bioluminescence imaging was used to measure each tumor in two dimensions using electronic calipers. Tumor volume was calculated using the formula 0.5(L × W) 2 ) where L is the tumor length and W is the tumor width. 3 Treatment was initiated when the tumor size reached 100 mg / kg. After the initial tumor measurement, Bepanthen cream was again applied to the area around the tumor. Bepanthen cream was applied daily thereafter. Mice were divided into four groups of 12 mice each to ensure consistent mean tumor volumes across groups. Treatment was administered weekly. Four control groups of mice received vehicle only (PBS). Three experimental groups received MDX-124 at doses of 1 mg / kg, 10 mg / kg, or 25 mg / kg in PBS. Each dose was administered intravenously at a volume of 10 ml / kg. Treatment continued for up to three weeks. Tumor measurements were continued three times weekly after treatment began. Mice were weighed three times weekly before treatment and daily after treatment began.

[0134] result To determine whether MDX-124 is inherently toxic to mice, we performed a tolerability study. Mice were administered the antibody and their body weights were monitored. No significant weight loss was observed in any of the mice (data not shown), indicating that the antibody was not toxic to mice at any of the doses tested. The anticancer effects of MDX-124 were investigated in a mouse model of breast cancer. The mean tumor volumes for each group of mice studied are shown in Figure 20. Following tumor cell inoculation on day 0, the first treatment dose was administered to all groups on day 12. As shown, by day 17 of the study, mice treated with MDX-124 showed a significant decrease in tumor volume compared to vehicle-treated control mice. The trend toward increased tumor growth in the control group continued through day 19. The decrease in tumor volume observed in the MDX-124-treated group also corresponded to a decrease in relative tumor volume in these groups (see Figure 21). Tumor volume on day 12 was defined as the baseline tumor volume (i.e., 100% relative tumor volume). By day 19, tumors in mice treated with MDX-124 had grown approximately 2.5-fold in size. Tumors in control mice had grown approximately 3.3-fold in size. This means that treatment with MDX-124 resulted in approximately one-third reduction in tumor growth compared to controls by day 19, demonstrating the anti-cancer efficacy of this antibody. Mice were administered the antibody at three different concentrations (1 mg / kg, 10 mg / kg, and 25 mg / kg), and all of these treatment regimens had similar effects on tumor growth (i.e., increasing the amount of antibody administered did not appear to increase the effectiveness of the treatment).

Claims

1. A pharmaceutical composition for use in treating cancer in a subject, comprising an antibody or antigen-binding fragment thereof that binds to human Anx-A1, the antibody or antigen-binding fragment thereof comprises complementarity determining regions (CDRs) VLCDR1, VLCDR2, VLCDR3, VHCDR1, VHCDR2, and VHCDR3; VLCDR1 has the sequence shown in SEQ ID NO:1, SEQ ID NO:7 or SEQ ID NO:8, or a variant sequence thereof comprising conservative amino acid substitutions at positions 9 and / or 11; VLCDR2 has the sequence shown in SEQ ID NO:2, VLCDR3 has the sequence shown in SEQ ID NO:3, VHCDR1 has the sequence shown in SEQ ID NO:4, VHCDR2 has the sequence shown in SEQ ID NO:5, VHCDR3 has the sequence shown in SEQ ID NO:6 Pharmaceutical compositions.

2. VLCDR1 has the sequence shown in SEQ ID NO: 1, VLCDR2 has the sequence shown in SEQ ID NO:2, VLCDR3 has the sequence shown in SEQ ID NO:3, VHCDR1 has the sequence shown in SEQ ID NO:4, VHCDR2 has the sequence shown in SEQ ID NO:5, 2. The pharmaceutical composition of claim 1, wherein the VHCDR3 has the sequence set forth in SEQ ID NO:

6.

3. VLCDR1 has the sequence shown in SEQ ID NO:8, VLCDR2 has the sequence shown in SEQ ID NO:2, VLCDR3 has the sequence shown in SEQ ID NO:3, VHCDR1 has the sequence shown in SEQ ID NO:4, VHCDR2 has the sequence shown in SEQ ID NO:5, 2. The pharmaceutical composition of claim 1, wherein the VHCDR3 has the sequence set forth in SEQ ID NO:

6.

4. (i) the antibody or antigen-binding fragment thereof is humanized, or (ii) the antibody is a monoclonal antibody, or the antigen-binding fragment is a Fab antigen-binding fragment, a Fab' antigen-binding fragment, or a F(ab') 2 an antigen-binding fragment, or scFv molecule, A pharmaceutical composition according to any one of claims 1 to 3.

5. The antibody or antigen-binding fragment thereof (i) a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9 or SEQ ID NO: 10, or an amino acid sequence having at least 90% sequence identity to these amino acid sequences; (ii) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 11 or SEQ ID NO: 12, or an amino acid sequence having at least 90% sequence identity to these amino acid sequences.

6. The antibody is a monoclonal antibody, and the monoclonal antibody comprises: (i) a light chain comprising the amino acid sequence set forth in SEQ ID NO: 13, or an amino acid sequence having at least 90% sequence identity to this amino acid sequence; (ii) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 14, or an amino acid sequence having at least 90% sequence identity to this amino acid sequence.

7. The antibody is a monoclonal antibody, and the monoclonal antibody comprises: (i) a light chain comprising the amino acid sequence set forth in SEQ ID NO: 15, or an amino acid sequence having at least 90% sequence identity to this amino acid sequence; 6. The pharmaceutical composition of claim 5, comprising: (ii) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 16, or an amino acid sequence having at least 90% sequence identity to this amino acid sequence.

8. The pharmaceutical composition according to any one of claims 1 to 7, wherein the cancer expresses Anx-A1.

9. The pharmaceutical composition according to claim 8, wherein Anx-A1 is expressed on the surface of the cancer cells.

10. The pharmaceutical composition of any one of claims 1 to 9, wherein the cancer is resistant to one or more chemotherapeutic agents.

11. The cancer is (i) whether it is multidrug resistant; (ii) is resistant to platinum-based chemotherapy; and / or (iii) resistant to cisplatin, adriamycin, and / or tamoxifen; The pharmaceutical composition of claim 10.

12. The pharmaceutical composition of any one of claims 1 to 11, wherein the treatment further comprises administering to the subject a second therapeutic agent.

13. 13. The pharmaceutical composition of claim 12, wherein the second therapeutic agent is a chemotherapeutic agent.

14. 14. The pharmaceutical composition of claim 13, wherein the chemotherapeutic agent is a cytotoxic agent.

15. The pharmaceutical composition of any one of claims 1 to 14, wherein the subject is a human.

16. The pharmaceutical composition according to any one of claims 1 to 15, wherein the cancer is selected from breast cancer, colon cancer, ovarian cancer, lung cancer, and pancreatic cancer.

17. 8. Use of a pharmaceutical composition in the manufacture of a medicament for the treatment of cancer in a subject, wherein said pharmaceutical composition is as defined in any one of claims 1 to 7.

18. Use according to claim 17, wherein the cancer is as defined in any one of claims 8 to 11 and 16, the treatment is as defined in any one of claims 12 to 14, and / or the subject is as defined in claim 15.

19. A kit comprising a pharmaceutical composition as defined in any one of claims 1 to 7 and a chemotherapeutic agent.

20. 10. A product comprising a pharmaceutical composition as defined in any one of claims 1 to 7 and a second therapeutic agent for separate, simultaneous or sequential use in the treatment of cancer in a subject.

21. 21. The product of claim 20, wherein the cancer is as defined in any one of claims 8 to 11 and 16, the second therapeutic agent is as defined in claim 13 or 14, and / or the subject is as defined in claim 15.

Images