Enhanced specificity bispecific antibodies (SEBA)
Bispecific tetravalent antibodies targeting EGFR and HER3 offer improved therapeutic efficacy by simultaneously inhibiting oncogenic signaling, addressing resistance issues in HER2-overexpressing cancers.
Patent Information
- Application Number
- JP2023518078
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2020-11-05
- Filing Date
- 2021-09-21
- Publication Date
- 2025-09-01
- Estimated Expiration
- 2041-09-21
Smart Images

Figure 0007731979000010 
Figure 0007731979000011 
Figure 0007731979000012
Abstract
Description
[Technical Field]
[0001] (CROSS-REFERENCE TO RELATED APPLICATIONS) This application claims priority under 35 U.S.C. 119(e) to U.S. Provisional Application No. 63 / 081,315, filed September 21, 2020, and U.S. Provisional Application No. 63 / 109,877, filed November 5, 2020, the entire disclosures of which are incorporated herein by reference.
[0002] The present disclosure relates to the field of antibody cancer therapy, and more particularly to bispecific tetravalent antibodies.
[0003] The human epidermal growth factor receptor (EGFR, also known as ErbB1 and HER1) family contains four members: EGFR, HER2, HER3, and HER4. Deregulation of each member through mutation, amplification, and overexpression plays a critical role in tumorigenesis and metastasis. Overexpression is associated with the development of a wide variety of tumors. Interrupting EGFR signaling by blocking the EGFR-binding site in the receptor's extracellular domain or inhibiting its intracellular tyrosine kinase activity can prevent the growth of EGFR-expressing tumors and improve patient outcomes. For example, HER2 overexpression occurs in 30% of breast cancer patients, indicating increased disease recurrence and poor prognosis. Overexpression is also known to occur in gastric, ovarian, and gastric cancers, lung adenocarcinoma, aggressive uterine cancer, and salivary gland cancer. HER2 mutations have been found in non-small cell lung cancer. The underlying HER2 mutations and amplification produce aberrant growth signals that activate downstream signaling pathways leading to tumorigenesis. In these cases, HER2 dimerizes with HER3 on the surface of tumor cells and activates PI3K / AKT signaling, which promotes tumor growth and survival. 1 .
[0004] Several therapeutic antibodies and small molecule inhibitors against EGFR and HER2 are approved for use in the treatment of cancer. 25Therapeutic anti-EGFR antibodies, such as cetuximab, panitumumab, and nimotuzumab, are approved for the treatment of metastatic colorectal cancer, head and neck squamous cell carcinoma, and glioma. 26,27 Monoclonal antibodies against EGFR or HER2 have been shown to be effective in the treatment of colon cancer. 28 , squamous cell carcinoma of the head and neck 29 , breast cancer and stomach cancer 25 have shown good clinical responses.
[0005] Drugs that target HER2, such as trastuzumab (Herceptin), have antitumor effects in patients with HER2-expressing breast and gastric cancer. Trastuzumab is a monoclonal antibody that binds to HER2, increasing the activity of p27, a protein that stops cell growth. Trastuzumab is only effective in cancers in which HER2 is overexpressed. One year of trastuzumab therapy is recommended for all HER2-positive breast cancer patients who are also receiving chemotherapy, and there is no additional benefit beyond 12 months. Pertuzumab, another monoclonal antibody that can inhibit the dimerization of HER2 with other receptors, such as HER3, is an FDA-approved treatment for use in combination with the chemotherapy agents trastuzumab and docetaxel for the treatment of metastatic HER2-positive breast cancer. 2,4 .
[0006] Despite these successes, long-term benefit appears to be limited in some patients. Many forms of tumors that initially respond to these therapeutic agents eventually progress by acquiring resistance to the drugs. The development of drug resistance reduces the effectiveness of these treatments. In the case of HER2-targeted therapy, resistance may occur via upregulation of HER3 or its ligand, HRG. 5 Therefore, current therapeutic approaches aimed at inhibiting activation of the HER2 / HER3 signaling pathway have failed to provide meaningful clinical benefit. 31,32 .
[0007] In summary, currently approved monospecific, bispecific, and combination antibody therapies targeting HER2 and / or HER3 suffer from low response rates or patient resistance to treatment, and there remains a need for better treatments for these cancers. Summary of the Invention
[0008] The present invention relates to the technical field of antibody therapeutics, and more particularly to bispecific tetravalent antibodies against members of the EGFR family.
[0009] In one aspect, the present invention provides a bispecific tetravalent antibody having binding specificity for human EGFR (epidermal growth factor receptor). In one embodiment, the antibody comprises, from N-terminus to C-terminus, a Fab region, an Fc domain, and an scFv domain. The Fab region has a first binding specificity for human EGFR. The Fc domain has a second binding specificity for HER3. In one embodiment, the Fab region may comprise a variable region having an amino acid sequence having at least 70%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 or 3.
[0010] In one embodiment, the bispecific tetravalent antibody may comprise an amino acid sequence having at least 98%, 95%, or 92% sequence identity to SEQ ID NO: 11, 13, or a combination thereof.
[0011] In one embodiment, the first binding affinity may be 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 50, or 100 times higher than the second binding affinity. In one embodiment, the first binding affinity has a KD of less than 20 nM and the second binding affinity has a KD of greater than about 50 nM. In one embodiment, the first binding affinity has a KD of less than 10 nM and the second binding affinity has a KD of greater than about 100 nM. In one embodiment, the first binding affinity has a KD of less than 5 nM and the second binding affinity has a KD of greater than about 50 nM.
[0012] In one embodiment, the first binding affinity has a KD of about 0.1 to about 150 nM, about 0.5 to about 50 nM, about 1 to about 10 nM, about 1 nM to about 25 nM, about 0.1, 0.5, or 1.0 nM to about 10, 25, or 50 nM. In one embodiment, the first binding affinity has a KD of about 4.61 nM.
[0013] In one embodiment, the second binding affinity has a KD of about 10 to about 500 nM, about 10 to 250 nM, about 50 to about 250 nM, about 10 or 50 nM to about 250 or 500 nM. In one embodiment, the second binding affinity has a KD of about 117 nM.
[0014] In one embodiment, the Fab regions may be disulfide bond stapled.
[0015] In one embodiment, the tetravalent bispecific antibody may be an isolated monoclonal antibody, a humanized antibody, a chimeric antibody, or a recombinant antibody.
[0016] In one embodiment, the bispecific tetravalent antibody comprises human framework regions.
[0017] In one aspect, the invention provides a heavy chain, a light chain, or a combination thereof. In one embodiment, the heavy chain comprises an amino acid sequence having at least 98% sequence identity to SEQ ID NO: 9, 13, or a combination thereof. In one embodiment, the light chain comprises an amino acid sequence having at least 98% sequence identity to SEQ ID NO: 11.
[0018] In one aspect, the present invention provides CDR sequences that are at least 98% sequence identical to the amino acid sequences disclosed herein.
[0019] In one aspect, the invention provides isolated nucleic acids encoding the tetravalent bispecific antibodies, light chains or heavy chains disclosed herein.
[0020] In one aspect, the present invention provides an expression vector comprising an isolated nucleic acid disclosed herein. In one embodiment, the expression vector is expressible in a cell.
[0021] In one aspect, the present invention provides a host cell comprising a nucleic acid as disclosed herein. In one embodiment, the present invention provides a host cell comprising an expression vector as disclosed herein. The host cell may be a prokaryotic or eukaryotic cell.
[0022] In one aspect, the invention provides a method for producing a tetravalent bispecific antibody, light chain, or heavy chain disclosed herein, comprising culturing the host cell to produce the tetravalent bispecific antibody, light chain, or heavy chain.
[0023] In one aspect, the invention provides an immunoconjugate comprising the tetravalent bispecific antibody and a cytotoxic agent, which in one embodiment may be a chemotherapeutic agent, an antiproliferative agent, a toxin, or a radioisotope, or a combination thereof.
[0024] In one aspect, the invention provides a pharmaceutical composition, in one embodiment, comprising the tetravalent bispecific antibody or immunoconjugate and a pharmaceutically acceptable carrier.
[0025] In one embodiment, the pharmaceutical composition comprises a radioisotope, a radionuclide, a toxin, a therapeutic agent, a chemotherapeutic agent, or a combination thereof.
[0026] In one aspect, the present invention provides a method of treating a subject with cancer. In one embodiment, the method comprises administering to the subject an effective amount of a tetravalent bispecific antibody or immunoconjugate disclosed herein. In one embodiment, the method further comprises co-administering an effective amount of a therapeutic agent.
[0027] In one embodiment, the therapeutic agent may be an antibody, a chemotherapeutic agent, an enzyme, or a combination thereof. In one embodiment, the therapeutic agent may include, for example, capecitabine, cisplatin, trastuzumab, fulvestrant, tamoxifen, letrozole, exemestane, anastrozole, aminoglutethimide, testolactone, vorozole, formestane, fadrozole, letrozole, erlotinib, afatinib, dasatinib, gefitinib, imatinib, pazopanib, lapatinib, sunitinib, nilotinib, sorafenib, nabparitaxel, derivatives or combinations thereof.
[0028] In one embodiment, the cancer comprises cells that express HER3 or EGFR, and in one embodiment, the cancer includes, for example, breast cancer, colorectal cancer, pancreatic cancer, head and neck cancer, melanoma, ovarian cancer, prostate cancer, non-small cell lung cancer, small cell lung cancer, glioma, esophageal cancer, nasopharyngeal cancer, kidney cancer, gastric cancer, liver cancer, bladder cancer, cervical cancer, brain tumor, lymphoma, leukemia, and myeloma.
[0029] In a further aspect, the present invention provides a solution comprising a tetravalent bispecific antibody or an immunoconjugate thereof. In one embodiment, the solution is plasma of a subject.
[0030] In one embodiment, the subject is a mammal, hi one embodiment, the subject is a human. [Brief explanation of the drawings]
[0031] The foregoing and other features of the present disclosure will become more fully apparent from the following description and appended claims, taken in conjunction with the accompanying drawings, which illustrate only some embodiments prepared in accordance with the present disclosure and therefore should not be considered limiting of its scope, the present disclosure may be explained with additional specificity and detail through the use of the accompanying drawings.
[0032] [Figure 1]Sequence alignment between the heavy chain (A; all differences are located in VH), light chain (B; all differences are located in VK), VH (C) and VK (D) of SI-1X6.4 and SI-71X14 is shown.
[0033] [Figure 2] Binding kinetics (affinity) of bispecific and control antibodies to His-tagged human EGFR extracellular domain using biolayer interferometry sensorgrams.
[0034] [Figure 3] Biolayer interferometry sensorgrams of binding kinetics (affinity) for His-tagged human HER3 extracellular domain are shown. Protein IDs are indicated at the top of each figure. Note that in contrast to all other measurements determined using the AHC sensor, SI-1R12 lacks an Fc domain and therefore must be set up with the AR2G sensor.
[0035] [Figure 4] Binding kinetics (avidity) for biotinylated human EGFR extracellular domain captured on SA sensor using biolayer interferometry sensorgrams.
[0036] [Figure 5] Thermal stability of bispecific antibodies using dynamic light scattering (A) and SEC profiles of SI-1X6.4 and SI-71X14 are shown, demonstrating lower aggregation of SI-71X14, which has a humanized EGFR-binding domain derived from cetuximab (B).
[0037] [Figure 6] 1 shows tandem binding of bispecific antibodies (SI-1X6.4 and SI-71X14) to EGFR followed by HER3.
[0038] [Figure 7] 1 shows tandem binding of bispecific antibodies (SI-1X6.4 and SI-71X14) to HER3 followed by EGFR.
[0039] [Figure 8] 1 shows the expression of EGFR family members on the surface of Fadu cancer cells.
[0040] [Figure 9] 1 shows the efficacy of SI-1X6.4 and its parent antibody, SI-1C6, on Fadu cell proliferation.
[0041] [Figure 10] 1 shows the efficacy of SI-71X14 and its parent antibody, SI-71M1, on Fadu cell proliferation.
[0042] [Figure 11] 1 shows the efficacy of SI-1X2 and its parent antibody, SI-1C3, on Fadu cell proliferation.
[0043] [Figure 12] 1 shows the efficacy of SI-1X4.2 and its parent antibody, SI-1C5, on Fadu cell proliferation.
[0044] [Figure 13] 1 shows a comparison of the efficacy of antibodies SI-1X6.4, SI-71X14, SI-1C4 and SI-1R12 on Fadu cell proliferation.
[0045] [Figure 14] 1 shows a comparison of the efficacy of antibodies SI-1X6.4, SI-71X14, SI-1C4, SI-71M1, SI-1C6 and SI-1C7 on Fadu cell proliferation. DETAILED DESCRIPTION OF THE INVENTION
[0046] The present disclosure provides bispecific tetravalent antibodies with superior therapeutic properties or efficacy compared to known anti-EGFR antibodies. In one embodiment, the antibodies target members of the EGFR family, including, but not limited to, EGFR, HER2, and HER3. These bispecific tetravalent antibodies can simultaneously inhibit oncogenic signaling through different receptors, thereby overcoming resistance to EGFR inhibitor or monoclonal antibody therapy.
[0047] As used herein, the terms "a," "an," and "the" are defined to mean "one or more," and include the plural unless the context requires otherwise.
[0048] As used herein, the terms "polypeptide," "peptide," and "protein" are used interchangeably and are defined to mean a biomolecule composed of amino acids linked by peptide bonds.
[0049] The term "antigen" refers to an entity or fragment thereof that is capable of eliciting an immune response in an organism, particularly an animal, more particularly a mammal, including a human. The term includes immunogens and regions thereof that are responsible for antigenicity or antigenic determinants.
[0050] The terms "antigen- or epitope-binding portion or fragment," "variable region," "variable region sequence," or "binding domain" refer to fragments of antibodies capable of binding to an antigen (in the present invention, e.g., EGFR). These fragments may retain the antigen-binding function of the intact antibody as well as additional functions. Examples of binding fragments include, but are not limited to, single-chain Fv fragments (scFv), which consist of the variable light (VL) and variable heavy (VH) domains of a single arm of an antibody connected by a synthetic linker in a single polypeptide chain, or Fab fragments, which are monovalent fragments consisting of the VL, constant light (CL), VH, and constant heavy 1 (CH1) domains. Antibody fragments may be smaller subfragments and may consist of a single CDR domain, particularly a domain as small as the CDR3 region of either the VL and / or VH domain. 33Antibody fragments are produced by conventional techniques known to those of skill in the art. Antibody fragments can be screened for utility using the same techniques as are used with intact antibodies.
[0051] "Antigen, epitope-binding portion or fragment," "variable region," "variable region sequence," or "binding domain" can be derived from the antibodies of the present disclosure by many techniques known in the art. For example, an antigen-binding fragment (Fab) is the region of an antibody that binds to an antigen (the Fab region). For example, a purified monoclonal antibody can be cleaved with an enzyme such as pepsin and subjected to HPLC gel filtration. Papain digestion of an antibody produces two identical antigen-binding fragments (called "Fab" fragments), each with a single antigen-binding site, and a remaining "Fc" fragment, the name of which reflects its ability to readily crystallize. Pepsin treatment yields an F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen. Appropriate fractions containing the Fab fragments can then be collected and concentrated, such as by membrane filtration. Further description of general techniques for isolating active fragments of antibodies 34,35 .
[0052] The term "antibody" is used in the broadest sense and specifically covers single monoclonal and / or recombinant antibodies (including agonist and antagonist antibodies), antibody compositions with polyepitopic specificity, and antibody fragments (e.g., Fab, F(ab')2, and Fv), so long as they exhibit the desired biological activity. In some embodiments, antibodies may be monoclonal, polyclonal, chimeric, single-chain, multispecific or multipotent, human and humanized antibodies, and active fragments thereof. Examples of active fragments of molecules that bind to known antigens include Fab, F(ab')2, scFv, and Fv fragments, including the products of a Fab immunoglobulin expression library, and epitope-binding fragments of any of the above antibodies and fragments.
[0053] The term "Fv" refers to the minimum antibody fragment which contains a complete antigen-recognition and binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In this configuration, the three CDRs from each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, a single variable domain (or half of an Fv containing only three antigen-specific CDRs) may also recognize and bind antigen, although with lower affinity than the entire binding site.
[0054] In some embodiments, antibodies may include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain a binding site that immunospecifically binds to an antigen. A typical antibody typically refers to a heterotetrameric protein having two heavy (H) chains and two light (L) chains. Each heavy chain is composed of a heavy-chain variable domain (abbreviated as VH) and a heavy-chain constant domain. Each light chain is composed of a light-chain variable domain (abbreviated as VL) and a light-chain constant domain. The light chains of antibodies (immunoglobulins) of any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequence of their constant domains. The VH and VL regions may be further subdivided into hypervariable complementarity-determining regions (CDRs) and more conserved regions called framework regions (FRs). Each variable domain (VH or VL) typically consists of three CDRs and four FRs arranged in the following order: From the amino terminus to the carboxy terminus are FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. Within the variable regions of the light and heavy chains are binding domains that interact with antigens.
[0055] Depending on the amino acid sequence of the constant domain of the heavy chain, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and some of these can be further divided into subclasses (isotypes), e.g., IgG-1, IgG-2, IgG-3, IgG-4, IgA-1, and IgA-2. The heavy chain constant domains corresponding to the different classes of immunoglobulins are called α, delta, epsilon, γ, and μ, respectively. The subunit structures and three-dimensional configurations of the different classes of immunoglobulins are well known.
[0056] The term "valency" refers to the valency of an antibody, which refers to the number of antigenic determinants that an individual antibody molecule can bind to. All antibodies have a valency of at least 2, and "antibody affinity" refers to the tendency of an antibody to bind to a specific epitope on the surface of an antigen, i.e., the strength of the interaction.
[0057] As used herein, the term "monoclonal antibody" refers to an antibody obtained from a population of substantially homogeneous antibodies. That is, the individual antibodies comprising the population are identical except for possible minor naturally occurring mutations. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies used in accordance with the disclosure herein may be those prepared by Kohler & Milstein 36 They may be made by the hybridoma method first described by I. G., et al., or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). 37By "recombinant" is meant production of the antibody by recombinant nucleic acid techniques in an exogenous host cell.
[0058] Monoclonal antibodies can be prepared by a variety of methods, including mouse hybridomas, phage display, recombinant DNA, molecular cloning of antibodies directly from primary B cells, and antibody discovery methods. 38,39,40 Monoclonal antibodies may also include "chimeric" antibodies (immunoglobulins) in which a portion of the heavy and / or light chains are identical or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chains are identical or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as the desired biological activity is exhibited. 41,42 .
[0059] "Humanized antibody" refers to a type of engineered antibody that has CDRs derived from a non-human donor immunoglobulin, with the remaining immunoglobulin-derived portions of the molecule derived from one (or more) human immunoglobulins. Additionally, framework support residues may be altered to retain binding affinity. Methods for obtaining "humanized antibodies" are well known to those skilled in the art. 43,44 .
[0060] "Isolated" or "purified" refers to a biological molecule that is free from at least some of the components with which it naturally occurs. "Isolated" or "purified," when used to describe various polypeptides disclosed herein, refers to a polypeptide that has been identified and separated and / or recovered from the cell or cell culture in which it is expressed. Typically, a purified polypeptide is prepared by at least one purification step. "Isolated or purified antibody" refers to an antibody that is substantially free of other antibodies with different antigen-binding specificities.
[0061] The term "immunogenic" refers to a substance that induces or enhances the production of antibodies, T cells, or other reactive immune cells against the immunogenic substance and contributes to a human or animal immune response. An immune response occurs when an individual produces sufficient antibodies, T cells, and other reactive immune cells against the administered immunogenic composition of the invention to alleviate or ameliorate the disorder being treated. An immunogenic response generally includes both the cellular (T cell) and humoral (antibody) arms of the immune response, with antibodies against therapeutic proteins (anti-drug antibodies, ADA) being composed of IgM, IgG, IgE, and / or IgA isotypes.
[0062] "Specific binding" or "binds specifically" or "specific" for a particular antigen or epitope refers to binding that is distinct from non-specific interactions. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which is generally a molecule of similar structure that has no binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target.
[0063] The term "affinity" refers to the measure of the attractive force between two polypeptides, such as antibody / antigen or receptor / ligand. The inherent attractive force between two polypeptides can be expressed as the binding affinity equilibrium dissociation constant (KD) of a specific interaction. The KD binding affinity constant can be measured, for example, by biolayer interferometry. Here, KD is the ratio of kD (dissociation rate constant) to kD (association rate constant), i.e., KD = kD / kD.
[0064] Specific binding to a particular antigen or epitope can be exhibited by an antibody having a KD for the antigen or epitope of, for example, at least about 10 M, at least about 10 M, at least about 10 M, at least about 10 M, at least about 10 M, at least about 10 M, at least about 10 M, at least about 10 M, or more. Here, KD refers to the equilibrium dissociation constant of a particular antibody-antigen interaction. Typically, an antibody that specifically binds to an antigen may have a KD for the antigen or epitope that is 20-, 50-, 100-, 500-, 1000-, 5000-, or 10,000-fold or greater than that of a control molecule.
[0065] Specific binding to a particular antigen or epitope can also be demonstrated by an antibody having a K A or K A for the antigen or epitope that is at least 20-, 50-, 100-, 500-, 1000-, 5000-, 10000-, or greater than that for a control epitope, where K A or K A refers to the association rate of a particular antibody-antigen interaction.
[0066] Bispecific antibodies may offer advantages over combination therapies, which are often more toxic than single-agent therapies. Bispecific agents, such as the bispecific antibodies of the present invention, can act as single agents targeting the same antigen as combination therapies, but with improved efficacy and response rates and reduced toxicity compared to combination therapies. Compared to combination therapies using two monoclonal antibodies, bispecific antibody therapy may be less toxic to patients and / or more potent due to the increased binding specificity.
[0067] In one aspect, the present invention provides a bispecific antibody having an N-terminus and a C-terminus and comprising at least two binding domains, the binding domains comprising a Fab region and an scFv domain. The scFv domain may be attached to either the N-terminus or the C-terminus of the antibody. The Fab region and the scFv domain each independently have binding specificity for a different protein in the EGFR family.
[0068] In some embodiments, the scFv molecules described herein comprise a linker (G) that operably connects the VH and VL, regardless of the orientation of the V regions (LH or HL). m S) n The other portion of the bispecific antibody may consist of a human IgG Fc or IgG null Fc heavy chain VH-CH1-hinge-CH2-CH3 and the corresponding kappa or lambda light chain VL-CL. These scFv domains may be separated by a linker (G m S) n The IgG heavy chains are genetically linked to the N- or C-terminus of the IgG heavy chain via a contiguous ~75 kDa heavy chain monomer peptide. When co-transfected with the appropriate light chain, the final symmetric bispecific molecule can be purified by human IgG Fc (Protein A) and assayed for functional activity.
[0069] In one embodiment, the binding domain with binding specificity for EGFR comprises cetuximab, panitumumab, and nimotuzumab. Cetuximab is an EGFR inhibitor used to treat metastatic colorectal cancer and head and neck cancer. Cetuximab is a murine / human chimeric monoclonal antibody administered by intravenous infusion.
[0070] In one embodiment, the binding domain with binding specificity for HER3 comprises MM-111 (a bispecific HER2 and HER3 binding protein). MM-111 is a human serum albumin (HSA)-supported bispecific antibody fragment that contains one therapeutic binding to HER3, but whose binding to HER2 alone is insufficient to be considered a therapeutic binding. In contrast, trastuzumab contains one single therapeutic binding to HER2.
[0071] The bispecific antibodies disclosed herein have the advantage of reproducing the synergistic effect of simultaneously binding both EGFR and HER3 using a single agent. The bispecific tetravalent antibodies comprise an immunoglobulin G (IgG) moiety having two heavy chains and two light chains, and a linker (e.g., (Gly-Gly-Gly-Gly-Ser) n Linker, (Gly-Gly-Gly-Ser) n Linker or (G m S) n The scFv fragment may comprise two scFv moieties covalently linked to the C-terminus or N-terminus of the heavy or light chain via a linker.
[0072] Single therapeutic agents are known to pose significant challenges, as the choice of binding moiety and backbone structure can affect in vivo binding efficiency and therapeutic efficacy in patients. For example, ALM is a bispecific antibody targeting HER2 / HER3 that exhibits growth inhibitory activity against tumor cells in vivo. However, its short circulating half-life and rapid renal clearance make it a less likely candidate. 3 .
[0073] Both cetuximab and panitumumab are monoclonal antibodies targeting EGFR (Table 1), differing in their isotypes (i.e., IgG1 and IgG2). This suggests that differences in KD values of binding affinity may go beyond the sequences of CDRs and FRs. Indeed, reformatting a "2-in-1" bivalent bispecific antibody against IgG1 affects the KD values of binding affinity to EGFR and HER3, respectively. SI-1XC6.4(C3) (WO2016106157A1) 20 ; also known as SI-B001 in clinical trial NCT04603287, which is incorporated herein by reference in its entirety) is a tetravalent bispecific antibody targeting EGFR and HER3, and durigotuzumab (also known as MEHD7945A, a "2-in-1" antibody, or SI-1C4, as described in WO2016106157A1). 20) has an improved EC50 directly compared to cetuximab. SI-1X6.4(C3) contains the same anti-EGFR binding domain as cetuximab, but their affinity KD values are different (Table 1a). SI-1X6.4(C3) contains the same anti-HER3 binding domain as MM-111, but their affinity KD values are significantly different (Table 1a). The structural configuration of each bispecific antibody may contribute to the differences in tumor cell killing efficacy. Because many forms of human cancer overexpress EGFR or HER2, but not HER3, the unexpected advantage of the reduced affinity KD of the anti-HER3 binding domain may allow SI-B001 to bind HER3 only in EGFR-positive tumor cells and not in HER3-positive normal cells.
[0074] The term "therapeutic binding" refers to binding domains tested in clinical trials as antibody therapeutics for safety. The concept of enhanced specificity bispecific antibodies (SEBAs) defines bispecific antibodies configured to have a combination of therapeutic binding to two tumor antigens on the same tumor cell, but not normal cells. Taking the EGFR family as an example, there are multiple therapeutic binding domains, including those derived from cetuximab, trastuzumab, MM-111, and "2-in-1" antibodies. The goal of SEBAs is to develop and / or improve bispecific antibodies as single therapeutic agents containing therapeutic binding to two members of the EGFR family (e.g., EGFR / HER2, EGFR / HER3, or HER2 / HER3 pairs). Each configuration may exhibit different effects in binding specificity, affinity, avidity, heregulin binding, inhibition of EGFR / HER3 dimerization and downstream signaling, and ultimately therapeutic efficacy and cytotoxicity in patients.
[0075] A potential drawback of cetuximab is that its variable regions are murine in origin. It has been demonstrated that chimeric antibodies that retain non-human sequences may have a higher immunogenic potential when compared to humanized or human antibodies. 6 On the other hand, humanization can increase the stability of antibodies by increasing the compatibility of the framework regions. 7Another concern is the glycan occupancy site of VH N85 (Kabat), where Fab glycosylation may affect the biological properties of the antibody and introduce glycan heterogeneity that needs to be well controlled during production. 8,9 Although the immunogenicity of cetuximab is low due to the low incidence of anti-cetuximab IgG responses (5%), hypersensitivity is common and is primarily due to pre-existing IgE antibodies against galactose-α-1,3-galactose oligosaccharides that decorate VH expressed on SP2 / 0 cells. 10 To overcome these drawbacks, humanization and post-translational modification of cetuximab can stabilize the antibody and reduce the potential for immunogenicity while maintaining high affinity for EGFR. Thus, a humanized EGFR-binding domain that retains the therapeutic binding domain derived from cetuximab can improve the therapeutic efficacy of the existing SEBA, SI-B001.
[0076] Example The following examples are offered by way of illustration only, and not by way of limitation. Those of ordinary skill in the art will readily recognize a variety of non-critical parameters that can be changed or modified to yield essentially the same or similar results.
[0077] Example 1: Bispecific tetravalent anti-EGFRxHER3 antibody SI-71X14
[0078] Cetuximab humanization was designed using various input models with Calculate Mutation Energy set to True (CHARMm force field) to generate optimal single-mutant sequences. The cetuximab model generated by Discovery Studio's Antibody Modeling Cascade was used. The input sequences were cetuximab VH (ending with TVSS instead of TVSA) and cetuximab VL. Humanization incorporated changes to the input sequences to increase the similarity of the VH C-terminus to the human consensus sequence (Figure 1) or to make the Vκ C-terminus more Vλ-like. After humanization in Discovery Studio, the VL was further modified by converting the last three residues of the Vκ domain to the corresponding residues in the λJ gene. These changes were evaluated due to the known importance of the last VL β-strand in determining scFv stability and aggregation propensity, and the more hydrophobic nature of the Vλ terminus, which could provide packing energy for stabilizing interactions. 22,23,24 The top five framework templates were used with a sequence similarity cutoff of 10. The CDR loop definition was set to Honegger, the maximum number of templates per loop was set to 3, and the optimization level was set to high. After generating the humanized sequence, the VL was further modified by replacing the last four residues of the VL with LTVL to mimic the stable FR4 of lambda antibodies.
[0079] Humanized cetuximab SI-71M1 was designed based on structural analysis of cetuximab by mutating framework residues to residues occurring at least 5% frequently in the human germline, which resulted in the most stable structure in silico. Because the energetic analysis of this type of humanization depends on the input model, several input structures were examined. SI-71X14 was produced by linking the HER3 scFv of MM-111 to the C-terminus of the SI-71M1 heavy chain via a (GmS)n linker.
[0080] Therefore, SI-71X14 is a modification of SI-1X6.4 in which the cetuximab murine variable regions were replaced with humanized cetuximab variable regions. Except for its different primary sequence from SI-1X6.4, SI-71X14 is also an αEGFR and αHER3 bispecific tetravalent antibody.
[0081] The amino acid changes are shown in Figure 1. Figure 1A shows that the 17 residue differences in the heavy chain sequence are located in the anti-EGFR cetuximab VH domain. Figure 1B shows that the 22 amino acid differences in the light chain sequence are located in the anti-EGFR cetuximab VK domain. Figure 1C expands the VH region to show all amino acid differences in the heavy chain. Figure 1D expands the VK region to show all differences in the light chain.
[0082] In addition to these two bispecific proteins, many other bispecific and monospecific molecules were tested in subsequent assays, and their properties are shown in Table 1b, allowing for the comparison of different EGFR and HER3 binding domains as well as different types of structures.
[0083] Proteins were expressed by transfecting expression plasmids for SI-1C7 and SI-1R12 (single plasmid) or cotransfecting the heavy and light chains (for other formats) for SI-1C3, SI-1C5, SI-1C6, SI-71M1, SI-1X2, SI-1X6.4, SI-71X14, and SI-1C4 using the ExpiCHO system (Thermo Fisher Scientific). Briefly, 10 μg of each expression plasmid (or 20 μg of unpaired plasmids) was brought to 1 ml with OptiPRO SFM medium. 1 ml of OptiPRO SFM medium containing 80 μl of Expifectamine CHO reagent was added to the DNA and incubated for 2.5 minutes at room temperature. The resulting mixture was then transfected into 25 ml of ExpiCHO cells in a 125 ml Erlenmeyer flask at 6 × 10 ribosomal DNA. 6Cells were added at 1000 cells / ml and incubated at 37°C, 5% CO2, and 150 rpm. 24 hours after transfection, cells were fed with 8.75 ml of ExpiCHO feed and 150 μl of CHO enhancer and shifted to 32°C, 5% CO2, and 150 rpm. 48 hours after transfection, cells were again fed with 8.75 ml of ExpiCHO feed. Eight days after transfection, culture supernatants were harvested, centrifuged at 4500 rpm for 1 hour to pellet cells, and passed through a 0.2 mm filter.
[0084] Fc-containing proteins were purified from the collected supernatant using a 1 ml MAbSelect PrismA Protein A column (GE Healthcare). The column was equilibrated with phosphate-buffered saline. The supernatant was then passed through the column at a flow rate of 2 ml / min. The column was washed with 10 ml PBS + 0.1% Triton X-100, followed by 10 ml PBS + 300 mM NaCl, and finally with 10 ml PBS. The protein was then eluted by passing 5 ml of 50 mM sodium acetate (pH 3.5) through the column. The eluted protein was immediately neutralized by adding 0.5 ml of 1 M Tris-Cl (pH 8.0).
[0085] The His-tagged scFv protein was purified from the collected supernatant using a 1 ml HisTrap HP column (GE). The column was equilibrated with phosphate-buffered saline (pH 7.4) containing 0.5 M NaCl and 20 mM imidazole. The supernatant was spiked with 10x binding buffer to reach 0.5 M NaCl and 20 mM imidazole and passed through the column at a flow rate of 2 ml / min. The column was washed with 10 column volumes of PBS containing 0.5 M NaCl and 20 mM imidazole. The protein was then eluted with PBS containing 0.5 M NaCl and 500 mM imidazole (pH 7.4) (HisTrap) or 50 mM sodium acetate (pH 3.5).
[0086] Immediately after first-stage Protein A or His-tag purification, proteins were analyzed by analytical SEC using a Waters Acquity UPLC H-Class with an ACQUITY UPLC® Protein BEH SEC 200A, 4.6 mm x 150 mm, 1.7 μm column. PBS (125 mM sodium phosphate, 137 mM sodium chloride, pH 6.8) was used as the mobile phase, run at 0.3 ml / min for 10 minutes, and 10 μg of protein was injected.
[0087] Cetuximab has two unique N-glycosylation sites, N85 (Kabat) and N297 (Eu), located in the Fab and Fc regions, respectively. Potential immunogenic N-glycans at the N85 position may affect the pharmacokinetic profile and potentially lead to anti-drug antibodies (ADA). In the humanized version, position 85 was mutated from N to D, eliminating the consensus N-glycosylation site and resulting in undetectable glycosylation in the expressed protein. As shown in Tables 2 and 4, this strategy facilitated protein purification and characterization but did not affect binding affinity.
[0088] Example 2: Binding kinetics to human EGFR
[0089] Monomeric EGFR extracellular domain binding was measured by biolayer interferometry (BLI) binding assay using an Octet Red 384 instrument (Sartorius). 10 μg / mL of SI-71X14, SI-71M1, SI-1X6.4, SI-1C3, SI-1X2, SI-1C6, SI-1X4.2, SI-1C4, or SI-1C5 was diluted in assay buffer (PBS containing 1% bovine serum albumin and 0.05% Tween 20) and captured on an anti-hu IgG Fc (AHC) biosensor chip for 180 seconds. The chip was washed with assay buffer for 60 seconds and then loaded with human EGFR (expressed and purified in-house) samples in a 1:2 serial dilution from 100 nM to 0 nM. Binding of the EGFR extracellular domain to the chip was recorded as the biolayer interferometry signal (Δnm) over the 180-second association time. The chip was transferred to assay buffer and dissociation was observed for 420 seconds. The sensor was regenerated with 10 mM glycine (pH 1.5). The kinetic parameter k on , k dis and K. D To extract the σ, the data were globally fitted to a 1:1 binding model for each antibody (Figure 2, Table 2).
[0090] Notably, all cetuximab-based proteins exhibited similar binding kinetics to human EGFR. For example, mAbs SI-1C6 (cetuximab) and SI-71M1 (humanized cetuximab) exhibited K values of 5.34 and 4.76 nM, respectively. D The bispecific (EGFRxHER3) molecules SI-1X6.4 (containing cetuximab variable regions with a murine framework) and SI-71X14 (humanized cetuximab framework) had similar EGFR binding kinetics and K DThe KD values were 5.38 and 4.61 nM, respectively. On the other hand, the panitumumab-based mAb (SI-1C3) and bispecific (SI-1X2) protein had slightly higher affinities, with KD values of 2.28 and 2.77 nM, respectively, and slower dissociation rates. The nimotuzumab-based mAb (SI-1C5) and bispecific (SI-1X4.2) protein had lower affinities, with KD values of 15.8 and 18.8 nM, respectively, due to slower binding kinetics and faster dissociation kinetics. The 2-in-1 bispecific antibody durigotuzumab (SI-1C4) had an EGFR affinity of 14.6 nM and the fastest dissociation rate.
[0091] Example 3: Binding kinetics to human HER3
[0092] Monomeric HER3 extracellular domain binding was measured by biolayer interferometry (BLI) binding assay using an Octet Red384 instrument (Sartorius). 10 μg / mL SI-71X14, SI-1C7, SI-1C4, SI-1X6.4, SI-1X2, or SI-1X4.2 was diluted in assay buffer (PBS containing 1% bovine serum albumin and 0.05% Tween 20) and captured on an anti-hu IgG Fc (AHC) biosensor chip for 180 seconds. The chip was washed with assay buffer for 60 seconds and then transferred to human HER3 (Acro ER3-H5223) samples in a 1:2 serial dilution from 400 nM to 0 nM. Binding of the HER3 extracellular domain to the chip was recorded as biolayer interferometry signal (Δnm) over the 180-second association time. The chip was then transferred to assay buffer, and dissociation was monitored for 420 seconds. The sensor was regenerated with 10 mM glycine (pH 1.5). The kinetic parameter k on , k dis and K. D To extract the σ, the data were globally fitted to a 1:1 binding model for each antibody (Figure 3, Table 3).
[0093] Notably, all proteins whose anti-HER3 domains were derived from MM-111 had similar binding kinetics to human HER3. For example, the cetuximab-based bispecific proteins SI-1X6.4 (cetuximab variable regions with murine frameworks) and SI-71X14 (humanized cetuximab frameworks) had K values of 107 and 117 nM, respectively. D Panitumumab- and nimotuzumab-based bispecific antibodies SI-1X2 and SI-1X4.2 had the same HER3 K activity as the panitumumab- and nimotuzumab-based bispecific antibodies SI-1X2 and SI-1X4.2, respectively. D The K values were 131 and 146 nM. A control Fc-scFv protein with the same anti-HER3 domain (SI-1C7) had similar binding kinetics and D The 2-in-1 bispecific antibody durigotuzumab (SI-1C4) has a different anti-HER3 variable region than other bispecific proteins, resulting in significantly stronger HER3 binding and a K D was 4.29 nM.
[0094] Due to the lack of an Fc domain, another comparative bispecific protein (SI-1R12 = MM-111, a HER2xHER3 albumin fusion) was tested using the same Octet instrument with an AR2G sensor in a different assay format. 20 μg / mL SI-1R12 was diluted in 10 mM acetate (pH 6.0) and covalently coupled with EDC / NHS according to the manufacturer's instructions in a 600-second loading step. After SI-1R12 immobilization, the chip was washed with assay buffer for 120 seconds and then transferred to human HER3 (Acro ER3-H5223) samples in a 1:2 serial dilution from 400 nM to 0 nM. Binding of the HER3 extracellular domain to the chip was recorded as a biolayer interferometry signal (Δnm) over a 180-second association time. The chip was then transferred to assay buffer, and dissociation was observed for 420 seconds. The kinetic parameter k was measured. on , k dis and K. DThe data were globally fitted to a 1:1 binding model for each antibody to extract K (Figure 3, Table 3). The binding kinetics of SI-1R12 to HER3 were similar to the other bispecifics tested, with K D The value was 95.6 nM.
[0095] Example 4: Simultaneous binding to human EGFR and HER3
[0096] Bispecific binding to the EGFR and HER3 extracellular domains was measured using a sandwich biolayer interferometry (BLI) binding assay using an Octet RED384 instrument (Sartorius). After a 180-second baseline step in assay buffer (PBS containing 1% BSA and 0.05% Tween 20), biotinylated human EGFR (Acro EGF-H82E3) was loaded onto the SA sensor at 5 μg / ml in assay buffer for 240 seconds. After an additional 180-second baseline step, binding with two-fold serial dilutions (0–100 nM) of SI-1C7, SI-1X2, SI-1X4.2, SI-1X6.4, SI-71M1, or SI-71X14 in assay buffer was performed for 240 seconds, followed by dissociation in protein-free assay buffer for 600 seconds. Immediately following the antibody binding step, another binding step with 500 nM HER3 ECD (expressed in-house) was performed, followed by a 600 s dissociation step. Each binding / dissociation event was individually fitted using a 1:1 binding model to extract the binding kinetics of the bispecific EGFR and HER3 binding.
[0097] The first binding event measured in this assay is that of antibody binding to immobilized EGFR, representing the avidity of interactions that may occur at the cell surface. These data are shown in Figure 4, and kinetic parameters are shown in Table 4. The data demonstrate that cetuximab-based antibodies, including the humanized cetuximab mAb (SI-71M1) and the bispecific cetuximab x anti-HER3 antibodies SI-1X6.4 (cetuximab variable regions with a murine framework) and SI-71X14 (humanized cetuximab framework), all have very high avidity for immobilized EGFR, demonstrating the K of the interaction. D The K was too small to be accurately quantified but was estimated to be less than 1 pM. This high avidity was due to a very slow dissociation rate. Similarly, the panitumumab-based EGFRxHER3 bispecific antibody SI-1X2 also had high avidity, with a K D The nimotuzumab-based EGFRxHER3 bispecific antibody SI-1X4.2 also had strong avidity, with a fitted K D The value was 398 pM. As expected, SI-1C7, an Fc-scFv protein specific for HER3, did not exhibit binding to EGFR.
[0098] The second event of interest is the binding of the captured antibody (already bound via its anti-EGFR domain) to the HER3 protein in solution. The kinetic parameters of these interactions are shown in Table 5. The cetuximab-based EGFRxHER3 bispecific antibodies SI-1X6.4 (cetuximab variable regions with murine frameworks) and SI-71X14 (humanized cetuximab frameworks) bind to the HER3 K protein. DThe values were 617 and 922 nM, respectively. The panitumumab- and nimotuzumab-based EGFRxHER3 bispecific antibodies SI-1X2 and SI-1X4.2 had similar HER3 affinities, 770 and 165 nM, respectively. Notably, the humanized cetuximab mAb (SI-71M1) showed no binding in this assay step due to its lack of specificity for HER3. The HER3-targeting Fc-scFv protein SI-1C7 showed no binding response due to lack of loading in the EGFR binding step. Thus, this sandwich assay demonstrates that EGFRxHER3 bispecific antibodies can simultaneously bind to EGFR and HER3, whereas proteins with specificity for only either EGFR or HER3 did not show a binding response in this assay.
[0099] Example 5: Improved Thermal Stability
[0100] For protein thermal stability analysis, dynamic light scattering was performed on a Wyatt DynaPro Plate Reader III. Proteins were diluted to 1 mg / ml in 30 μl / well in 25 mM sodium acetate, 75 mM sodium chloride, and 5% (w / v) sucrose (pH 5.5). The temperature was increased from 25 to 85°C at 1.0°C / min while the radius was monitored. Due to the difficulty of reproducibly fitting unfolding curves with different shapes, the temperature at which the radius exceeded 15 nm was used as an objective measure of thermal stability. Samples were run in duplicate, and buffer alone was run as a negative control.
[0101] Figure 5 shows the thermal melting curves for SI-71X14, SI-71M1, SI-1C7, SI-1C4, SI-1X6.4, SI-1C6, SI-1R12, SI-1C5, SI-1C3, SI-1X2, and SI-1X4.2, and Table 6 shows the Tm values of these proteins. The EGFR mAbs panitumumab (SI-1C3), nimotuzumab (SI-1C5), cetuximab (SI-1C6), and humanized cetuximab (SI-71M1) had Tm values of 77.05, 65.79, 68.39, and 77.80°C, respectively. Thus, humanization of cetuximab not only increased its thermal stability by more than 9°C, but also produced the most stable EGFR mAb of the four tested. The bispecific EGFRxHER3 antibodies based on panitumumab (SI-1X2), nimotuzumab (SI-1X4.2), cetuximab (SI-1X6.4), and humanized cetuximab (SI-71X14) had Tm values of 63.73, 63.79, 62.33, and 64.10°C, respectively. Thus, the addition of an anti-HER3 scFv to the C-terminus of an EGFR mAb tended to reduce thermal stability by a normalized amount. In particular, the bispecific EGFRxHER3 antibody based on humanized cetuximab had the highest thermal stability, improving the stability of the parent cetuximab protein by 1.77°C. The Tm of a control protein based on an antibody Fc fused to anti-HER3 scFv (SI-1C7) was 63.17°C, similar to that of the bispecific molecules containing this anti-HER3 scFv domain. The bispecific antibody SI-1C4 had a Tm of 69.80 °C, confirming the high stability of the mAb-like platform. Finally, the MM-111 bispecific HSA fusion (SI-1R12) had the lowest thermal stability, with a Tm of 60.41 °C. This result demonstrates the favorable stability of the antibody format compared to other protein scaffolds.
[0102] Example 6: Sequential binding to human EGFR and HER3
[0103] Bispecific binding to EGFR and HER3 extracellular domains was measured by tandem biolayer interferometry (BLI) binding assay using an Octet RED384 instrument (Sartorius).
[0104] In one format, antibody protein was captured on the AHC sensor, followed by a first binding step with EGFR, a second binding step with HER3, and a subsequent dissociation step (Figure 6). Specifically, after a 20-second baseline step in assay buffer (PBS containing 1% BSA and 0.05% Tween 20), 10 μg / ml antibody protein was loaded for 180 seconds, followed by a 60-second baseline step. Next, the first binding step was performed with 100 nM EGFR (purified in-house) for 720 seconds, and the second binding step was performed with 100 nM EGFR and 400 nM HER3 (Acro ER3-H5223) for 720 seconds. Note that the second step contained HER3 protein, but the same amount of EGFR (100 nM) as in the first step was additionally included, so that dissociation of EGFR did not complicate the kinetics observed in the second step. Finally, a 720-second dissociation step was performed.
[0105] In the EGFR-first, then HER3-step assay, the control EGFR mAbs SI-1C6 and SI-71M1 showed significant responses at the EGFR step but no significant increase in responses at the HER3 step. This indicates that they bind to EGFR at the first step, but not to HER3 at the second step. SI-1C7, a control Fc-scFv protein targeting HER3, showed no binding at the first EGFR step but a significant response at the second HER3 step. The 2-in-1 control mAb SI-1C4 showed binding at both the EGFR and HER3 steps, indicating that the first EGFR step was not sufficient to saturate antibody binding, allowing additional HER3 molecules to bind at the second step. The bispecific EGFRxHER3 antibodies SI-1X6.4 and SI-71X14 showed significant binding responses at both the EGFR and HER3 steps, confirming that these proteins can simultaneously bind to EGFR and HER3 molecules.
[0106] In the above assay, SI-71X14 also showed a better binding response than SI-1X6.4 (nm on the Y axis), with the EGFR and EGFR / HER3 binding step being approximately 0.1 nm, indicating that the binding amount of SI-71X14 was higher than that of SI-1X6.4.
[0107] In another format, antibody protein was captured on the AHC sensor, followed by a first binding step with HER3, a second binding step with EGFR, and then a dissociation step (Figure 7). Specifically, after a 20-second baseline step in assay buffer (PBS containing 1% BSA and 0.05% Tween 20), 10 μg / ml antibody protein was loaded for 180 seconds, followed by a 60-second baseline step. Next, the first binding step was performed with 400 nM HER3 (Acro ER3-H5223) for 720 seconds, and the second binding step was performed with 100 nM EGFR (purified in-house) and 400 nM HER3 for 720 seconds. Note that the second step contained EGFR protein, but additionally contained the same amount of HER3 (400 nM) as the first step, so that dissociation of HER3 did not complicate the kinetics observed in the second step. Finally, a 720-second dissociation step was performed.
[0108] In the HER3-first, EGFR-second step assay, the control EGFR mAbs SI-1C6 and SI-71M1 showed no response in the HER3 binding step, as expected, but a significant response in the subsequent EGFR step. The control HER3-targeting Fc-scFv protein SI-1C7 showed binding in the first HER3 step, as expected, but no binding in the second EGFR step. The 2-in-1 control mAb SI-1C4 showed significant binding in the first HER3 step but no additional binding in the second EGFR binding step. This is because both Fab regions of this antibody bound to HER3 in the first step, leaving no free Fab to bind to EGFR in the second step. The bispecific EGFRxHER3 antibodies SI-1X6.4 and SI-71X14 showed significant binding responses in both the EGFR and HER3 steps, indicating that these molecules can simultaneously bind to EGFR and HER3 molecules. Importantly, the tetravalent nature of the SI-1X6.4 and SI-71X14 structures and the respective binding domains for each antigen allowed these antibodies to simultaneously bind to EGFR and HER3, a phenomenon that could not occur with the 2-in-1 control mAb, SI-1C4.
[0109] In the above assay, SI-71X14 also showed a better binding response than SI-1X6.4 (nm on the Y axis), with the HER3 and EGFR / HER3 binding steps being approximately 0.1 nm, indicating that the binding amount of SI-71X14 was higher than that of SI-1X6.4.
[0110] Therefore, characterization of binding kinetics indicates the mechanism of action of SEBA, i.e., bispecific antibodies with enhanced specificity (e.g., SI-71X14 and SI-1X6.4). Unlike in vitro kinetics, the response and efficacy of bispecific antibody therapy may depend on the tissue distribution of EGFR and HER3. In patients with various forms of solid tumors, EGFR expression may be deregulated, while HER3 may be expressed by both normal and tumor cells. However, many anti-HER3 antibody therapies have failed due to safety issues, suggesting the potential for targeting more normal cells than tumor cells in vivo. In the present invention, the above results demonstrate that both SI-1X6.4 and SI-71X14 can perform sequential binding, and that SI-71X14, which contains a humanized EGFR-binding domain, exhibits improved binding kinetics. The different KD values for EGFR (strong) and HER3 (weak) underlie the selective binding of both SI-71X14 and SI-1X6.4, favoring binding to EGFR-expressing cancer cells compared with HER3-positive normal cells. In this context, SEBAs may be useful for achieving reduced side effects in vivo. Furthermore, the different binding affinities for two tumor-associated antigens (TAAs), as measured by strong and weak KD values, may provide a novel strategy for designing SEBAs to target cancer-causing receptors.
[0111] Example 7: Inhibition of tumor cell proliferation
[0112] To evaluate the growth-inhibitory potential of anti-EGFR domain-containing antibodies, we compared the effects of the EGFR domain (wt) derived from cetuximab and a humanized EGFR-binding domain in different therapeutic formats. Growth-inhibitory effects were tested against the Fadu cell line (hypopharyngeal squamous cell carcinoma, ATCC HTB-43), which expresses both EGFR and HER3 proteins, as well as HER2 proteins (Figure 8). Specific antigen presentation was determined by incubating Fadu cells with fluorescently conjugated antibodies specific for either EGFR, HER3, or HER2, as well as an isotype-matched control antibody. Antibody binding to cells was quantified by FACS (BD Bioscience LSR-Fortessa).
[0113] Cell lines were seeded in 96-well tissue culture plates at a density of 5000 cells per well in 200 μl of RPMI-1640 medium containing 1% FBS. Treatments were administered within a dose range of 90 nM to 85.8 fM. Cells were cultured in triplicate plates for 63 hours in the presence of the test antibody. Nuclei were counted using time-series microscopy (Incucyte Zoom) based on stable expression of the nuclear-localized fluorescent reporter protein mKate2 in the Fadu cell line. Data were collected at baseline and at intervals during culture. Normalized proliferation is reported based on well seeding and untreated control conditions. The comparative antiproliferative effects of wt cetuximab and humanized cetuximab were expressed as dose-response curves and IC50s of inhibition, based on regression analysis using sigmoidal, 4PL, and least-squares methods (X is concentration, and curve fits are shown in the figures). 2 values are provided (Graphpad Prism 9).
[0114] When the wt cetuximab domain is utilized in a bispecific format with HER3 (SI-X6.4), the IC-50 is reduced 3-fold compared to the EGFR mAb alone (SI-1C6), and the addition of the HER3 domain results in a greater overall antiproliferative effect (Figure 9). However, when the humanized cetuximab domain is combined with the HER3-binding domain (SI-71X14), the antiproliferative IC-50 is restored compared to the humanized cetuximab mAb alone (SI-71M1), and retains a greater overall antiproliferative effect at higher concentrations (Figure 10).
[0115] Consistent with the role of HER3 in enhancing EGFR inhibitory function in bispecific formats, panitumumab (SI-1C3) achieves a higher overall antiproliferative effect when engineered into a bispecific format (SI-1X2) with a HER3 domain (Figure 11). The EGFR antibody nimotuzumab (SI-1C5) exhibits poor inhibitory potency against Fadu cell proliferation in this assay system, and the addition of HER3 to nimotuzumab in a bispecific format (SI-1X4.2) is not observed to confer any benefit. This demonstrates the critical requirement for the EGFR domain to drive antiproliferative effects and achieve the benefits of HER3 blockade in bispecific drug design (Figure 12).
[0116] The Fadu response to humanized cetuximab combined with the HER3-binding domain in a bispecific format (SI-71X14) achieves a 3-fold superior antiproliferative IC-50 compared to wt cetuximab in the same format (SI-1X6.4). The humanized EGFR in SI-71X14 further achieves a significantly higher overall antiproliferative effect at high concentrations (Figure 13). In comparison, SI-1C4 is a bispecific antibody against EGFR and HER3 built on the two-in-one platform described by Schaefer et al. 30IC4 has a structure similar to a monoclonal antibody. This molecule can bind to either EGFR or HER3 on each Fab arm, but cannot simultaneously bind both targets on each Fab arm. When either EGFR or HER3, or both receptors, are blocked in excess, the antiproliferative potential of the 2-in-1 antibody is lower than that of both the SI-71X14 and SI-1X6.4 bispecific formats (Figure 14). In comparison, SI-1R12 is a HER2XHER3 bispecific antibody, MM-111, which has reported antiproliferative effects. However, although Fadu expresses both HER2 and HER3, inhibition is not achieved. This demonstrates the critical combination of EGFR, which drives the antiproliferative effect of HER3 blockade, but not HER2 and HER3, on this cell line (Figure 13).
[0117] Re-engineering of the cetuximab antibody results in increased anti-proliferative potency when engineered in a multispecific format and when combined with a HER3-binding domain compared to wt cetuximab, as demonstrated by bi- and pentaspecific structures of T cell engagers. The humanized cetuximab domain also results in increased overall anti-proliferative efficacy when combined with a HER3-binding domain compared to wt cetuximab.
[0118] table
[0119] Table 1a: KD values of TAA binding domains may vary depending on the therapeutic antibody. [Table 1a] #Results of ADCC analysis using Fadu and NCI-H1975 cells
[0120] Table 1b: Antibodies with therapeutic binding domains targeting EGFR, HER3, or both [Table 1b]
[0121] Table 2: Binding kinetics (affinity) of anti-EGFR proteins to His-tagged human EGFR extracellular domain measured by biolayer interferometry. [Table 2]
[0122] Table 3: Binding kinetics (affinity) of anti-HER3 proteins to His-tagged human HER3 extracellular domain measured by biolayer interferometry. Note that in contrast to all other measurements determined using the AHC sensor, SI-1R12 had to be set up with the AR2G sensor since it lacks an Fc domain. [Table 3]
[0123] Table 4: Binding kinetics (avidity) of anti-EGFR proteins to biotinylated human EGFR extracellular domain measured by biolayer interferometry. [Table 4]
[0124] Table 5: Binding kinetics (affinity) of anti-EGFRxHER3 proteins and controls to human His-tagged HER3 after binding to biotinylated human EGFR in a sandwich Octet assay. Note that the monospecific anti-EGFR (SI-71M1) and anti-HER3 (SI-1C7) proteins did not show binding signals during the HER3 binding step, as expected. [Table 5]
[0125] Table 6: Binding kinetics of anti-HER3 proteins to His-tagged human EGFR extracellular domain measured by biolayer interferometry. Note that in contrast to all other measurements determined using the AHC sensor, SI-1R12 had to be set up with the AR2G sensor since it lacks an Fc domain. [Table 6]
[0126] Sequence Listing
[0127] αEGFR variable domain sequence [Table 7]
[0128] Monoclonal and bispecific antibody sequences [Table 8] >Sequence ID 1: SI-71X14 αEGFR VH amino acid sequence QVQLQQSGPGLVKPSETLSITCTTVSGFSLTNYGVHWIRQAPGKGLEWLGVIWSGGNTDYNTPFTSRFTITKDNSKNQVYFKLRSVRADDTAIYYCARALTYYDYEFAYWGQGTLVTVSS >Sequence ID 2: SI-71X14 αEGFR VH nucleotide sequence CAAGTTCAGTTGCAGCAGTCTGGCCCTGGCCTGGTCAAGCCTTCTGAGACACTGTCCATCACCTGTACCGTGTCCGGCTTCTCCCTGACCAATTACGGCGTGCACTGGATCAGACAGGCCCCTGGCAAAGGACTGGAATGGCTGGGAGTGATTTGGAGCGGCGGCAACACCGACTACAACACCCCTTTCACCAGCCGGTTCACCATCACCAAGGACAACTCCAAGAACCAGGTGTACTTCAAGCTGCGGAGCGTGCGGGCTGATGACACCGCCATCTACTACTGTGCTCGGGCCCTGACCTACTACGACTACGAGTTTGCTTACTGGGGCCAGGGCACCCTGGTCACAGTTTCTTCT >Sequence ID 3: SI-71X14 αEGFR VL amino acid sequence EIVLTQSPSTLSVSPGERATFSCRASQSIGTNIHWYQQKPGKPPRLLIKYASESISGIPDRFSGSGSGTEFTLTISSVQSEDFAVYYCQQNNNWPTTFGPGTKLTVL >Sequence ID 4: SI-71X14 αEGFR VL nucleotide sequence GAGATCGTGCTGACCCAGTCTCCTTCCACACTGTCTGTGTCTCCCGGCGAGAGAGCCACCTTCAGCTGTAGAGCCTCTCAGTCCATCGGCACCAACATCCACTGGTATCAGCAGAAGCCCGGCAAGCCTCCTCGGCTGCTGATTAAGTACGCCTCCGAGTCCATCAGCGGCATCCCTGACAGATTCTCCGGCTCTGGCTCTGGCACCGAGTTTACCCTGACCATCTCCTCCGTGCAGTCCGAGGATTTCGCCGTGTACTACTGCCAGCAGAACAACAACTGGCCCACCACCTTTGGACCCGGCACCAAGCTGACCGTGCTG >Sequence ID 5: SI-71X14 αHER3 VH amino acid sequence QVQLQESGGGLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANINRDGSASYYVDSVKGRFTISRDDAKNSLYLQMNSLRAEDTAVYYCARDRGVGYFDLWGRGTLVTVSS >Sequence ID 6: SI-71X14 αHER3 VH nucleotide sequence CAGGTGCAATTGCAGGAGTCGGGGGGAGGCCTGGTCAAGCCTGGAGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGTAGTTATTGGATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCAACATAAACCGCGATGGAAGTGCGAGTTACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACGACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAGATCGTGGGGTGGGCTACTTCGATCTCTGGGGCCGTGGCACCCTGGTCACCGTCTCGAGC >Sequence ID 7: SI-71X14 αHER3 VL amino acid sequence QSALTQPASVSGSPGQSITISCTGTSSDVGGYNFVSWYQQHPGKAPKLMIYDVSDRPSGVSDRFSGSKSGNTASLIISGLQADDEADYYCSSYGSSSTHVIFGGGTKVTVL >Sequence ID 8: SI-71X14 αHER3 VL nucleotide sequence CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTTTGTCTCCTGGTACCAACAACACCCAGGCAAAGCCCCCAAACTCATGATCTATGATGTCAGTGATCGGCCCTCAGGGGTGTCTGATCGCTTCTCCGGCTCCAAGTCTGGCAACACGGCCTCCCTGATCATCTCTGGCCTCCAGGCTGACGACGAGGCTGATTATTACTGCAGCTCATATGGGAGCAGCAGCACTCATGTGATTTTCGGCGGAGGGACCAAGGTGACCGTCCTA >Sequence ID 9: SI-71M1 HC amino acid sequence QVQLQQSGPGLVKPSETLSITCTVSGFSLTNYGVHWIRQAPGKGLEWLGVIWSGGNTDYNTPFTSRFTITKDNSKNQVYFKLRSVRADDTAIYYCARALTYYDYEFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG >Sequence ID 10: SI-71M1 HC nucleotide sequence >Sequence ID 11: SI-71M1 and SI-71X14 LC amino acid sequence EIVLTQSPSTLSVSPGERATFSCRASQSIGTNIHWYQQKPGKPPRLLIKYASESISGIPDRFSGSGSGTEFTLTISSVQSEDFAVYYCQQNNNWPTTFGPGTKLTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC >Sequence ID 12: SI-71M1 and SI-71X14 LC nucleotide sequence GAGATCGTGCTGACCCAGTCTCCTTCCACACTGTCTGTGTCTCCCGGCGAGAGAGCCACCTTCAGCTGTAGAGCCTCTCAGTCCATCGGCACCAACATCCACTGGTATCAGCAGAAGCCCGGCAAGCCTCCTCGGCTGCTGATTAAGTACGCCTCCGAGTCCATCAGCGGCATCCCTGACAGATTCTCCGGCTCTGGCTCTGGCACCGAGTTTACCCTGACCATCTCCTCCGTGCAGTCCGAGGATTTCGCCGTGTACTACTGCCAGCAGAACAACAACTGGCCCACCACCTTTGGACCCGGCACCAAGCTGACCGTGCTGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG >Sequence ID 13: SI-71X14 HC amino acid sequence QVQLQQSGPGLVKPSETLSITCTVSGFSLTNYGVHWIRQAPGKGLEWLGVIWSGGNTDYNTPFTSRFTITKDNSKNQVYFKLRSVRADDTAIYYCARALTYYDYEFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGGSGGGGSQVQLQESGGGLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANINRDGSASYYVDSVKGRFTISRDDAKNSLYLQMNSLRAEDTAVYYCARDRGVGYFDLWGRGTLVTVSSGGGGSGGGGSGGGGSQSALTQPASVSGSPGQSITISCTGTSSDVGGYNFVSWYQQHPGKAPKLMIYDVSDRPSGVSDRFSGSKSGNTASLIISGLQADDEADYYCSSYGSSSTHVIFGGGTKVTVL >Sequence ID 14: SI-71X14 HC nucleotide sequence
[0129] References 1. Diaz-Serrano, A. et al. Genomic Profiling of HER2-Positive Gastric Cancer: PI3K / Akt / mTOR Pathway as Predictor of Outcomes in HER2-Positive Advanced Gastric Cancer Treated with Trastuzumab. Oncologist.23, 1092-1102 (2018). 2. Durkee, BY, et al. Cost-Effectiveness of Pertuzumab in Human Epidermal Growth Factor Receptor 2-Positive Metastatic Breast Cancer. Journal of Clinical Oncology. 2016, 34 (9): 902-9. 3. Robinson, Matthew K., et al. "Targeting ErbB2 and ErbB3 with a bispecific single-chain Fv enhances targeting selectivity and induces a therapeutic effect in vitro." British journal of cancer 99.9 (2008): 1415-1425. 4. Goel, S. & Winer, E. P. POINT: HER2-Targeted Combinations in Advanced HER2-Positive Breast Cancer. Oncology (Williston Park). 29, 797-798, 802 (2015). 5. Luque-Cabal, M. et al. Mechanisms Behind the Resistance to Trastuzumab in HER2-Amplified Breast Cancer and Strategies to Overcome It. Clin. Med. Insights Oncol.10, 21-30 (2016). 6. Hwang WYK, Foote J. Immunogenicity of engineered antibodies. Methods 2005; 36:3-10. 7. Park SS, Kim J, Brandts JF, Hong HJ. Stability of murine, chimeric and humanized antibodies against pre-S2 surface antigen of hepatitis B virus. Biologicals 2003; 31:295-302. 8. Ayoub D, Jabs W, Resemann A, Evers W, Evans C, Main L, Baessmann C, Wagner-Rousset E, Suckau D, Beck A. Correct primary structure assessment and extensive glyco-profiling of cetuximab by a combination of intact, middle-up, middle-down and bottom-up ESI and MALDI mass spectrometry techniques. MAbs 2013; 5:699-710. 9. van de Bovenkamp FS, Hafkenscheid L, Rispens T, Rombouts Y. The Emerging Importance of IgG Fab Glycosylation in Immunity. J Immunol 2016; 196:1435-41. 10. Chung CH, Mirakhur B, Chan E, Le Q-T, Berlin J, Morse M, Murphy BA, Satinover SM, Hosen J, Mauro D, et al. Cetuximab-Induced Anaphylaxis and IgE Specific for Galactose-α-1,3-Galactose. N Engl J Med 2008; 358:1109-17. 11. Cetuximab: https: / / www.ema.europa.eu / en / documents / scientific-discussion / erbitux-epar-scientific-discussion_en.pdf 12. Garcia-Foncillas, Jesus, et al. "Distinguishing features of cetuximab and panitumumab in colorectal cancer and other solid tumors." Frontiers in oncology 9 (2019): 849. 13. Tundidor, Yaima, et al. "Affinity-matured variants derived from nimotuzumab keep the original fine specificity and exhibit superior biological activity." Scientific reports 10.1 (2020): 1-14. 14. Lakayan, Dina, et al. "Affinity profiling of monoclonal antibody and antibody-drug-conjugate preparations by coupled liquid chromatography-surface plasmon resonance biosensing." Analytical and bioanalytical chemistry 410.30 (2018): 7837-7848. 15. Pertuzumab:https: / / www.tga.gov.au / sites / default / files / auspar-pertuzumab-131001.pdf 16. Malm, Magdalena, et al. "Targeting HER3 using mono-and bispecific antibodies or alternative scaffolds." MAbs. Vol. 8. No. 7. Taylor & Francis, 2016. 17. Aurisicchio, Luigi, et al. "The promise of anti-ErbB3 monoclonals as new cancer therapeutics." Oncotarget 3.8 (2012): 744. 18. McDonagh, Charlotte F., et al. "Antitumor activity of a novel bispecific antibody that targets the ErbB2 / ErbB3 oncogenic unit and inhibits heregulin-induced activation of ErbB3." Molecular cancer therapeutics 11.3 (2012): 582-593. 19. Schaefer, Gabriele, et al. "A two-in-one antibody against HER3 and EGFR has superior inhibitory activity compared with monospecific antibodies." Cancer cell 20.4 (2011): 472-486. 20. SI-1X6.4(C3): US15 / 119,694. 21. Liu, Meilin, et al. "Identification and characterization of a fully human antibody directed against epidermal growth factor receptor for cancer therapy." (2004): 163-163. 22. Borras, Leo, et al. "Generic approach for the generation of stable humanized single-chain Fv fragments from rabbit monoclonal antibodies." Journal of Biological Chemistry 285.12 (2010): 9054-9066. 23. Ewert, Stefan, et al. "Biophysical properties of human antibody variable domains." Journal of molecular biology 325.3 (2003): 531-553. 24. Nieba, Lars, et al. "Disrupting the hydrophobic patches at the antibody variable / constant domain interface: improved in vivo folding and physical characterization of an engineered scFv fragment." Protein engineering 10.4 (1997): 435-444. 25. Arteaga, Carlos L., et al. "Treatment of HER2-positive breast cancer: current status and future perspectives." Nature reviews Clinical oncology 9.1 (2012): 16-32. 26. Price, Katharine AR, and Ezra E. Cohen. "Current treatment options for metastatic head and neck cancer." Current treatment options in oncology 13.1 (2012): 35-46. 27. Bode, Udo, et al. "Nimotuzumab treatment of malignant gliomas." Expert opinion on biological therapy 12.12 (2012): 1649-1659. 28. Price, Timothy J., et al. "Panitumumab versus cetuximab in patients with chemotherapy-refractory wild-type KRAS exon 2 metastatic colorectal cancer (ASPECCT): a randomised, multicentre, open-label, non-inferiority phase 3 study." The Lancet Oncology 15.6 (2014): 569-579. 29. Cohen, Roger B. "Current challenges and clinical investigations of epidermal growth factor receptor (EGFR)-and ErbB family-targeted agents in the treatment of head and neck squamous cell carcinoma (HNSCC)." Cancer treatment reviews 40.4 (2014): 567-577. 30. Schaefer, Gabriele, et al. "A two-in-one antibody against HER3 and EGFR has superior inhibitory activity compared with monospecific antibodies." Cancer cell 20.4 (2011): 472-486. 31. Geuijen, Cecile AW, et al. "Unbiased combinatorial screening identifies a bispecific IgG1 that potently inhibits HER3 signaling via HER2-guided ligand blockade." Cancer Cell 33.5 (2018): 922-936. 32. Yu, Shengnan, et al. "A novel asymmetrical anti-HER2 / CD3 bispecific antibody exhibits potent cytotoxicity for HER2-positive tumor cells." Journal of Experimental & Clinical Cancer Research 38.1 (2019): 1-16. 33. Beiboer, Sigrid HW, et al. "Guided selection of a pan carcinoma specific antibody reveals similar binding characteristics yet structural divergence between the original murine antibody and its human equivalent." Journal of molecular biology 296.3 (2000): 833-849. 34. Khaw, Ban An, et al. "Technetium-99m labeling of antibodies to cardiac myosin Fab and to human fibrinogen." Journal of Nuclear Medicine 23.11 (1982): 1011-1019. 35. Rousseaux, J., R. Rousseaux-Prevost, and Herve Bazin. "
[63] Optimal conditions for the preparation of proteolytic fragments from monoclonal IgG of different rat IgG subclasses." Methods in enzymology 121 (1986): 663-669. 36. Kohler, Georges, and Cesar Milstein. "Continuous cultures of fused cells secreting antibody of predefined specificity." nature 256.5517 (1975): 495-497. 37. U.S. Pat. No. 4 ,816,567 38. Siegel, D. L. "Recombinant monoclonal antibody technology." Transfusion clinique et biologique 9.1 (2002): 15-22. 39. Tiller, Thomas. "Single B cell antibody technologies." New biotechnology 28.5 (2011): 453-457. 40. Seeber, Stefan, et al. "A robust high throughput platform to generate functional recombinant monoclonal antibodies using rabbit B cells from peripheral blood." PloS one 9.2 (2014): e86184. 41. U.S. Pat. No. 4,816,567 42. Morrison, Sherie L., et al. "Chimeric human antibody molecules: mouse antigen-binding domains with human constant region domains." Proceedings of the National Academy of Sciences 81.21 (1984): 6851-6855. 43. Queen, Cary, et al. "A humanized antibody that binds to the interleukin 2 receptor." Proceedings of the National Academy of Sciences 86.24 (1989): 10029-10033. 44. Hodgson, John. "Making monoclonals in microbes." Bio / technology 9.5 (1991): 421-425.
Claims
1. A bispecific tetravalent antibody having binding specificity for human EGFR (epidermal growth factor receptor), From the N-terminus to the C-terminus, a Fab region having a first binding specificity for human EGFR, the Fab region having a variable region having an amino acid sequence having at least 98% sequence identity to SEQ ID NO: 1 (with the proviso that the CDR regions are 100%) and at least 98% sequence identity to SEQ ID NO: 3 (with the proviso that the CDR regions are 100%); an Fc domain; and an scFv domain with a second binding specificity for HER3; 1. A bispecific tetravalent antibody comprising:
2. 2. The bispecific tetravalent antibody of claim 1, comprising an amino acid sequence having at least 98% sequence identity with SEQ ID NO: 11 (100% in the CDR regions) and an amino acid sequence having at least 98% sequence identity with SEQ ID NO: 13 (100% in the CDR regions).
3. 2. The bispecific tetravalent antibody of claim 1, wherein the first binding affinity has a KD of 0.1 to 50 nM.
4. 2. The bispecific tetravalent antibody of claim 1, wherein the second binding affinity has a KD of 10 nM to 500 nM.
5. 2. The bispecific tetravalent antibody of claim 1, wherein the first binding affinity has a KD of less than 20 nM and the second binding affinity has a KD of more than 50 nM.
6. 2. The bispecific tetravalent antibody of claim 1, wherein the Fab regions are stapled by disulfide bonds.
7. 2. The bispecific tetravalent antibody of claim 1, wherein the bispecific tetravalent antibody is an isolated monoclonal antibody.
8. The bispecific tetravalent antibody of claim 1 , comprising human framework regions.
9. The bispecific tetravalent antibody of claim 1 , wherein the antibody is a humanized antibody, a chimeric antibody, or a recombinant antibody.
10. 2. The bispecific tetravalent antibody of claim 1 , wherein the Fab region has a variable region having the amino acid sequence of SEQ ID NO: 1 and a variable region having the amino acid sequence of SEQ ID NO:
3.
11. An isolated nucleic acid encoding the bispecific tetravalent antibody of claim 1.
12. An expression vector comprising the isolated nucleic acid of claim 11.
13. A host cell comprising the nucleic acid of claim 11.
14. 14. A method for producing a bispecific tetravalent antibody, comprising culturing the host cell of claim 13 so as to produce the bispecific tetravalent antibody.
15. A pharmaceutical composition comprising the bispecific tetravalent antibody of claim 1 and a pharmaceutically acceptable carrier.
16. 16. The pharmaceutical composition of claim 15, further comprising a radioisotope, a radionuclide, a toxin, a therapeutic agent, a chemotherapeutic agent, or a combination thereof.
17. An immunoconjugate comprising the bispecific tetravalent antibody of claim 1 and a cytotoxic agent.
18. 18. The immunoconjugate of claim 17, wherein the cytotoxic agent comprises a chemotherapeutic agent, an antiproliferative agent, a toxin, or a radioisotope.
19. 18. A pharmaceutical composition comprising the immunoconjugate of claim 17 and a pharmaceutically acceptable carrier.
20. 10. A pharmaceutical composition for use in treating a subject with cancer, comprising the bispecific tetravalent antibody of claim 1, The treatment comprises administering to the subject an effective amount of the bispecific tetravalent antibody of claim 1.
21. 21. The pharmaceutical composition of claim 20, wherein the cancer comprises cells that express HER3 or EGFR.
22. 21. The pharmaceutical composition of claim 20, wherein the cancer comprises breast cancer, colorectal cancer, pancreatic cancer, head and neck cancer, melanoma, ovarian cancer, prostate cancer, non-small cell lung cancer, small cell lung cancer, glioma, esophageal cancer, nasopharyngeal cancer, kidney cancer, gastric cancer, liver cancer, bladder cancer, cervical cancer, brain tumor, lymphoma, leukemia, and myeloma.
23. 21. The pharmaceutical composition of claim 20, wherein the treatment further comprises co-administering an effective amount of a therapeutic agent.
24. 24. The pharmaceutical composition of claim 23, wherein the therapeutic agent comprises an antibody, a chemotherapeutic agent, an enzyme, or a combination thereof.
25. 24. The pharmaceutical composition of claim 23, wherein the therapeutic agent comprises capecitabine, cisplatin, trastuzumab, fulvestrant, tamoxifen, letrozole, exemestane, anastrozole, aminoglutethimide, testolactone, vorozole, formestane, fadrozole, letrozole, erlotinib, afatinib, dasatinib, gefitinib, imatinib, pazopanib, lapatinib, sunitinib, nilotinib, sorafenib, nabparitaxel, derivatives thereof or combinations thereof.
26. 21. The pharmaceutical composition of claim 20, wherein the subject is a human.
Citation Information
Patent Citations
Modified anti-epidermal growth factor receptor antibodies and methods of use thereof
JP2016536342A
Antibodies that bind egfr and erbb3
JP2017512756A
Bispecific tetravalent antibody and method of making and using same
JP2018509175A
Multispecific antibody analogs comprising a common light chain, and methods of their preparation and use
US20170022291A1
Compositions for the treatment of disease
US20190153471A1