Chimeric antigen receptors directed against HER2 and methods of use thereof

Abstract

The present disclosure provides chimeric antigen receptors (CARs), nucleic acids comprising nucleotide sequences encoding CARs that bind to HER2, and conditionally activated biological (CAB) CARs that bind to HER2. The present disclosure also provides cells genetically modified to produce CARs, delivery suspensions comprising these genetically modified cells, and methods for producing such cells. The CARs of the present disclosure can be used in a variety of methods, and these methods are also provided, including methods for activating immune cells under specific conditions and methods for performing adoptive immune cell therapy, such as CAR therapy, for example, CAR therapy for cancer.

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of U.S. Provisional Patent Application No. 62 / 964,947, filed January 23, 2020, which is incorporated herein by reference in its entirety.

[0002] Sequence Listing This application incorporates by reference the Electronic Sequence Listing material filed concurrently herewith. The Electronic Sequence Listing material was submitted as a text (.txt) file entitled "F1_005_WO_01_Sequence_Listing.txt" created on January 22, 2021, has a file size of 354 KB, and is incorporated herein by reference in its entirety.

[0003] joint research agreement F1 Oncology, Inc. (now known as Exuma Biotech Corp.) and BioAtla, LLC are parties to a collaborative research agreement relating to the subject matter disclosed herein.

[0004] Field of Disclosure The present disclosure relates to chimeric antigen receptors and their use in diagnostics and therapeutics. [Background technology]

[0005] In cell-based adoptive immunotherapy, immune cells isolated from a patient are engineered to express synthetic proteins that, when subsequently returned to the patient, confer new therapeutic functions to the immune cells. One example of such a synthetic protein is the chimeric antigen receptor (CAR). One currently used CAR is a fusion of an extracellular recognition domain (e.g., an antigen-specific targeting region or ASTR), a transmembrane domain, and one or more intracellular signaling domains. Upon antigen binding, the intracellular signaling portion of the CAR can initiate an activation-related response in the immune cell, such as the release of cytolytic molecules that induce tumor cell death. While CAR and CAR-T therapies have been highly effective against certain types of hematologic cancers, there remains a need for CAR and CAR-T therapies for solid tumors, which has proven far more elusive to date.

[0006] While CAR-T therapy is a promising approach for treating various diseases, particularly hematological cancers, its safety has recently come into question due to adverse events during clinical trials. One way to reduce these adverse events is by reducing on-target and off-tumor ASTR binding. The tumor microenvironment (TME) is more acidic than the normal physiological environment due to altered metabolism in cancer cells, known as the Warburg effect. CARs with conditionally active ASTRs only bind to antigens under specific conditions (conditionally active biological CARs (CAB CARs)), such as when present in the TME, and do not bind to antigens under normal physiological conditions, reducing on-target and off-tumor binding. Therefore, the side effects of these CARs are reduced, allowing treatment to proceed more safely. Despite the development of specific examples of such CAB CARs, there remains a need for highly effective and safe CAB CARs. Furthermore, while CAR-T therapy has been shown to be highly effective in treating certain hematological cancers, developing effective CAR-T therapy for solid tumors has been much more challenging. Therefore, there remains a need for effective and safe treatments, such as novel CAB CARs, for solid tumors.

[0007] Receptor tyrosine kinases (RTKs) are a family of cell surface receptors that regulate a range of normal cellular processes through ligand-regulated tyrosine kinase activity. Over the past two decades, deregulation of RTKs has been shown to play an important role in cancer development and progression. RTKs are now recognized as prognostic molecular biomarkers and targets for tumor therapeutics. An important RTK in oncology is HER2 (ERBB2). The HER2 receptor is a 1255 amino acid, 185 kD transmembrane glycoprotein RTK expressed in many tissues (Iqbal and Iqbal, Mol Biol Int. vol. 2014, 2014: 852748). HER2 overexpression occurs in numerous solid tumors, including breast, gastric, esophageal, ovarian, endometrial, lung, and urothelial bladder cancers (ibid.). Although several antibody and small molecule inhibitors of HER2 have been approved for the treatment of certain cancers, particularly metastatic breast cancer, these therapeutics typically extend survival but are not curative (ibid.). For example, a significant proportion of HER2+ breast cancer patients treated with approved monoclonal antibodies targeting HER2 ultimately develop recurrent or progressive disease. Therefore, there remains a need to develop effective therapeutics targeting HER2 cancers. Furthermore, HER2-recognizing CARs have been engineered to attempt to provide more effective anti-HER2 therapeutics, but such CARs have resulted in safety issues and even patient deaths, which were thought to be due to off-target binding to normal lung cells, which triggered a cytokine storm (Morgan et al., Mol. Ther. 2010; 18(4)843-851).

[0008] While harnessing the power of the immune system to fight cancer, there remains a need for effective therapies that reduce or eliminate on-target and off-tumor effects, as well as off-target effects. While monoclonal antibodies against HER2 are commercially available, there is a need for CARs containing antibody fragments that are conditionally active and target HER2, effectively targeting cells that only express HER2 in specific environments, such as the tumor microenvironment. Creating such conditionally active CARs presents numerous challenges. For example, if an antibody fragment is expressed on the surface of T cells or NK cells as part of a CAR, antibody fragments that not only bind to HER2 but also recognize epitopes exposed on cancer cells must be created and identified. Furthermore, such CARs would ideally bind to their targets in a conditionally active manner, particularly under the acidic pH of tumors compared to normal physiological pH. Furthermore, upon binding to their targets, such candidate CARs must activate CAR-expressing T cells or NK cells to exert their cytotoxic function. Therefore, there are many requirements for CARs containing such antibody fragments to help address the challenges posed by current CAR-T approaches. Furthermore, because HER2 is expressed in numerous solid tumors, such conditionally active CARs against HER2 hold promise for treating solid tumors using CAR-T therapy, thus overcoming the major limitations of current CAR-T therapy. Summary of the Invention

[0009] The present disclosure provides chimeric antigen receptors (CARs), nucleic acids comprising nucleotide sequences encoding CARs that bind to HER2, and conditionally activated biological (CAB) CARs that bind to HER2. The present disclosure also provides cells genetically modified to produce CARs, delivery suspensions comprising populations of these CAB CAR-containing cells, particularly CAB CAR T cells and NK cells, and methods for producing such cells. The CARs of the present disclosure can be used in a variety of methods, including immune cell activation under specific conditions, such as the pH of the TME, and methods for performing adoptive cell therapy, such as CAR therapy for cancer. Using exemplary examples of T cells and / or NK cells expressing CAB CARs provided herein, proof-of-concept experiments disclosed herein have shown that such CAB CAR T cells and / or NK cells are effective biologics that can overcome problems associated with on-target, off-tumor effects, particularly for anti-HER2 CARs.

[0010] Details of the aspects and embodiments provided herein are provided throughout this disclosure. For clarity, this Summary section is not intended to, and should not be construed as, limiting the scope of the disclosure provided herein. [Brief explanation of the drawings]

[0011] [Figure 1A-1B] 1A and 1B show the binding activity of various antibodies to human HER2 protein at different pH values ​​as measured by ELISA. Conditionally active antibodies are shown along with a HER2 benchmark antibody (BM). [Figure 2]Figure 2 shows the lysis rate of CHO-S-HER2 target cells in a luciferase killing assay. CHO-S-HER2 cells and CAR-T effector cells were cocultured for up to 6 hours at low and high pH. Data are shown for the benchmark CAR, X4-04, and five CAB-CARs, each differing from X4-04 by five different single amino acid substitutions in either the heavy or light chain of the ASTR-containing scFv. [Figure 3A] Figure 3 shows the lysis rate of CHO-S-HER2 target cells in a luciferase killing assay. CHO-S-HER2 cells and CAR-T effector cells were co-cultured for up to 6 hours at low and high pH. Data are shown for CAB CARs containing VH-1 and VL-3 in each orientation, coupled with either linker A (Figure 3A) or linker B (Figure 3B), compared to benchmark CARs containing VH-1 and VL-1 in each orientation. [Figure 3B] Figure 3 shows the lysis rate of CHO-S-HER2 target cells in a luciferase killing assay. CHO-S-HER2 cells and CAR-T effector cells were co-cultured for up to 6 hours at low and high pH. Data are shown for CAB CARs containing VH-1 and VL-3 in each orientation, coupled with either linker A (Figure 3A) or linker B (Figure 3B), compared to benchmark CARs containing VH-1 and VL-1 in each orientation. [Figure 4] Figure 4 shows the rate of specific lysis of CHO-S-HER2 target cells by CARs X4-03 and X4-16 at low and high pH, ​​measured over 30 hours in a real-time killing assay. [Figure 5] Figure 5 shows a graph of the MFI of CD69 on CD3+eTAG+ CAR-T cells after co-culture with MCF7 targets for 1 day at low and high pH, ​​as measured by flow cytometry. [Figure 6] Figure 6 shows a graph of the percentage of CD3+eTAG+ CAR-T cells staining positive for intracellular IFN-G after co-culture with MCF7 targets for 1 day at low and high pH, ​​as measured by flow cytometry. [Figure 7]Figure 7 shows a graph of the percentage of CD3+eTAG+ CAR-T cells that are CD107a+ after co-culture with MCF7 targets for 5 hours at low and high pH, ​​as measured by flow cytometry. [Figure 8] Figure 8 shows histograms of Celltrace Violet abundance in WT1 and Candidate 2 CAR-T cells after 5 days of co-culture with MCF7 targets at low and high pH, ​​as measured by flow cytometry of CD3+ gated live cells. [Figure 9] Figure 9 shows the mean SK-OV-3 tumor volume in mice after treatment with DPBS, CAB-CAR cells, or WT CAR cells. [Figures 10A-10B] Figures 10A and 10B show the results of in vivo imaging of mice using IVIS to observe forced hepatic expression of human HER2-luciferase and bioluminescence in the livers of SK-OV-3 tumor-bearing mice after treatment with CAB-CAR cells, WT CAR cells, or DPB. Figure 10A shows an image of the mouse. Figure 10B shows the average total luminous flux. [Figure 11] Figure 11 shows the mean NCI-87 tumor volume in mice after treatment with DPBS, trastuzumab (low dose), trastuzumab (high dose) followed by CAB-CAR administration, CAB-CAR cells, or WT CAR cells on day 42. DETAILED DESCRIPTION OF THE INVENTION

[0012] definition As used herein, the term "chimeric antigen receptor" or "CAR" or "CARs" refers to an engineered receptor that transfers antigen specificity to cells, such as T cells, NK cells, macrophages, and stem cells. The CAR of the present invention comprises at least one antigen-specific targeting region (ASTR), a transmembrane domain (TM), and an intracellular activation domain (IAD), and may include a stalk and one or more costimulatory domains (CSDs). In another embodiment, the CAR is a bispecific CAR specific for two different antigens or epitopes. After the ASTR specifically binds to the target antigen, the IAD activates intracellular signaling. For example, the IAD can utilize the antigen-binding properties of antibodies to redirect the specificity and reactivity of T cells toward a selected target in an MHC-unrestricted manner. MHC-unrestricted antigen recognition confers on CAR-expressing T cells the ability to recognize antigens independently of antigen processing, thereby bypassing a major mechanism of tumor escape. Furthermore, when expressed in T cells, CARs advantageously do not dimerize with the endogenous T cell receptor (TCR) alpha and beta chains.

[0013] As used herein, the term "constitutive T cell or NK cell promoter" refers to a promoter that, when operably linked to a polynucleotide that encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.

[0014] As used herein, the term "inducible promoter" or "activatable promoter" refers to a promoter that, when operably linked to a polynucleotide encoding or specifying a gene product, causes a gene product to be produced in a cell only when a promoter-specific inducer is substantially present in the cell. Inducible promoters have no or low levels of basal transcriptional activity, but transcriptional activity increases, sometimes greatly, in the presence of an inducing signal.

[0015] As used herein, the term "microenvironment" refers to any part or region of a tissue or body that has a constant or temporary physical or chemical difference from other regions of the tissue or body. For example, as used herein, "tumor microenvironment" (TME) refers to the environment in which a tumor resides, which is the acellular area within the tumor and the area immediately outside the tumor tissue, but does not relate to the intracellular compartments of the cancer cells themselves. The TME can refer to any and all conditions in the tumor environment, including conditions that create a structural and / or functional environment for malignant processes to survive and / or expand and / or spread. For example, the TME can include, but is not limited to, changes in conditions such as pressure, temperature, pH, ionic strength, osmolality, osmolality, oxidative stress, the concentration of one or more solutes, the concentration of electrolytes, the concentration of glucose, the concentration of hyaluronan, the concentration of lactate or lactate, the concentration of albumin, the level of adenosine, the level of R-2-hydroxyglutarate, the concentration of pyruvate, the concentration of oxygen, and / or the presence of oxidizing agents, reducing agents, or cofactors, as well as other conditions understood by those skilled in the art. With respect to pH, the TME is believed to have a more acidic pH than normal physiological pH.

[0016] As used interchangeably herein, the terms "polynucleotide" and "nucleic acid" refer to polymeric forms of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. Thus, this term includes, but is not limited to, single-stranded, double-stranded, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or polymers containing purine and pyrimidine bases, or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.

[0017] As used herein, the term "antibody" includes polyclonal and monoclonal antibodies, including intact antibodies and fragments of antibodies that retain specific binding to an antigen. Antibody fragments may be, but are not limited to, fragment antigen-binding (Fab) fragments, Fab' fragments, F(ab')2 fragments, Fv fragments, Fab'-SH fragments, (Fab')2Fv fragments, Fd fragments, recombinant IgG (rIgG) fragments, single-chain antibody fragments including single-chain variable fragments (scFv), bivalent scFv, trivalent scFv, and single-domain antibody fragments (e.g., sdAb, sdFv, nanobody). The term includes genetically engineered and / or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, single-chain antibodies, fully human antibodies, humanized antibodies, fusion proteins comprising antigen-specific targeting regions of antibodies and non-antibody proteins, heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFvs, and tandem tri-scFvs. Unless otherwise specified, the term "antibody" should be understood to include functional antibody fragments thereof. The term also includes intact or full-length antibodies, including antibodies of any class or subclass, including IgG and its subclasses, IgM, IgE, IgA, and IgD.

[0018] As used herein, the term "antibody fragment" includes a portion of an intact antibody, such as the antigen-binding or variable region of an intact antibody. Examples of antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10):1057-1062(1995)); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab" fragments (each fragment containing a single antigen-binding site) and a residual "Fe" fragment (a name reflecting its ability to readily crystallize). Pepsin treatment yields an F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.

[0019] As used interchangeably herein, the terms "single-chain Fv," "scFv," or "sFv" antibody fragment refer to the V of an antibody. H and V L In some embodiments, the Fv polypeptide comprises V domains, and these domains are present in a single polypeptide chain. H Domains and V L The sFv may further comprise a polypeptide linker or spacer between the domains, which enables the sFv to form the desired structure for antigen binding. For a review of sFvs, see Pluckthun, The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).

[0020] As used herein, "naturally occurring" VH and VL domains refer to VH and VL domains that have been isolated from a host without further molecular evolution to alter their affinity when produced in an scFv format under specific conditions.

[0021] As used herein, the term "affinity" refers to the equilibrium constant for the reversible binding of two agents, expressed as the dissociation constant (Kd). The affinity may be at least 1-fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1000-fold greater, or more, than the affinity of the antibody for an unrelated amino acid sequence. The affinity of the antibody for the target protein may be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM), or more. As used herein, the term "avidity" refers to the resistance of a complex of two or more agents to dissociation after dilution. The terms "immunoreactive" and "preferentially bind" are used interchangeably herein with respect to antibodies and / or antigen-binding fragments.

[0022] As used herein, the term "binding" refers to a direct association between two molecules by covalent, electrostatic, hydrophobic, and ionic and / or hydrogen-bonding interactions, including, for example, interactions such as salt bridges and water bridges. Nonspecific binding is defined as binding that occurs between two molecules with a specific binding strength of about 10 -7 Binding with an affinity less than M, e.g., 10 -6 M, 10 -5 M, 10 -4 It refers to binding with an affinity such as M.

[0023] As used herein, a "cell surface expression system" or "cell surface display system" refers to the display or expression of a protein or a portion thereof on the surface of a cell. Typically, a cell is generated that expresses a protein of interest fused to a cell surface protein. For example, the protein is expressed as a fusion protein with a transmembrane domain.

[0024] As used herein, the term "element" includes fusions of polypeptides, polypeptides comprising regions of polypeptides, polynucleotides, and functional variants or fragments thereof.

[0025] As used herein, the term "region" is any segment of a polypeptide or polynucleotide.

[0026] As used herein, a "domain" is a region of a polypeptide or polynucleotide that has functional and / or structural properties.

[0027] As used herein, the term "stalk" or "stalk domain" refers to a flexible polypeptide connector region that provides structural flexibility and spacing between adjacent polypeptide regions and can be composed of natural or synthetic polypeptides. The stalk can be derived from the hinge or hinge region of an immunoglobulin (e.g., IgG1), which is generally defined as extending from Glu216 to Pro230 of human IgG1 (Burton (1985) Molec. Immunol., 22:161-206). Hinge regions of other IgG isotypes can be aligned with the IgG1 sequence by placing the first and last cysteine ​​residues that form inter-heavy chain disulfide (SS) bonds in the same positions. The stalk can be naturally occurring or non-naturally occurring, including, but not limited to, altered hinge regions. The stalk can comprise a complete hinge region from an antibody of any class or subclass. The stalk can also comprise regions from CD8, CD28, or other receptors that provide similar functions in providing flexibility and spacing to adjacent regions.

[0028] As used herein, the term "isolated" means that a material is removed from its original environment (e.g., the natural environment if it occurs naturally). For example, a naturally occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide separated from some or all of the coexisting materials in the natural system is isolated. Such a polynucleotide may be part of a vector, and / or such a polynucleotide or polypeptide may be part of a composition, and still be isolated in that such a vector or composition is not part of its natural environment.

[0029] As used herein, a "polypeptide" is a single chain of amino acid residues linked by peptide bonds. A polypeptide does not fold into a fixed structure and does not have any post-translational modifications. A "protein" is a polypeptide that folds into a fixed structure. "Polypeptide" and "protein" are used interchangeably herein.

[0030] As used herein, a polypeptide can be "purified" to remove contaminating components of the polypeptide's natural environment, e.g., materials that would interfere with diagnostic or therapeutic uses of the polypeptide, such as enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. The polypeptide can be purified (1) to greater than 90%, 95%, or 98%, e.g., greater than 99%, by weight of the antibody as determined by the Lowry method, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) under reducing or non-reducing conditions using Coomassie blue or silver staining.

[0031] As used herein, the term "immune cells" generally includes leukocytes derived from hematopoietic stem cells (HSCs) produced in the bone marrow. "Immune cells" include, for example, lymphocytes (T cells, B cells, natural killer (NK) cells) and bone marrow-derived cells (neutrophils, eosinophils, basophils, monocytes, macrophages, dendritic cells).

[0032] As used herein, "T cells" refers to T helper cells (CD4 + cells), cytotoxic T cells (CD8 + NKT cells include all types of immune cells that express CD3, including T cells (regulatory T cells), regulatory T cells (Tregs), and gamma-delta T cells. NKT cells are a subset of T cells that express CD3 and typically co-express the αβ T cell receptor, but also express various molecular markers typically associated with NK cells (such as NK1.1 or CD56).

[0033] As used herein, "cytotoxic cells" include CD8 + T cells, natural killer (NK) cells, NK-T cells, γδT cells, CD4 + These include neutrophils, a subpopulation of cells that are capable of mediating cytotoxic responses, and neutrophils, which are cells that can mediate cytotoxic responses.

[0034] As used herein, the term "stem cells" generally includes pluripotent or multipotent stem cells, including, for example, embryonic stem cells (ES), mesenchymal stem cells (MSC), induced pluripotent stem cells (iPS), and committed progenitor cells (hematopoietic stem cells (HSC), bone marrow-derived cells, etc.).

[0035] As used herein, the terms "treatment," "treating," and the like refer to obtaining a desired pharmacological and / or physiological effect. The effect may be prophylactic, in that a disease or its symptoms are completely or partially prevented, and / or therapeutic, in that a disease and / or adverse effects resulting from the disease are partially or completely cured. As used herein, "treatment" covers any treatment of a disease in a mammal, e.g., a human, and includes: (a) preventing the disease from occurring in a subject who may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., preventing its development; and (c) palliating the disease, i.e., causing regression of the disease.

[0036] As used interchangeably herein, the terms "individual," "subject," "host," and "patient" refer to mammals, including, but not limited to, humans, murines (e.g., rats, mice), lagomorphs (e.g., rabbits), non-human primates, humans, dogs, cats, ungulates (e.g., horses, cattle, sheep, pigs, goats), and the like.

[0037] As used herein, the term "therapeutically effective amount" or "effective amount" refers to the amount of a drug, or the combined amount of two drugs, that, when administered to a mammal or other subject for treating a disease, is sufficient to affect such treatment for the disease. The "therapeutically effective amount" will vary depending on the drug, the disease and its severity, and the age, weight, etc., of the subject being treated.

[0038] As used herein, the term "evolution" or "evolving" refers to the use of one or more methods of mutagenesis to generate different polynucleotides encoding different polypeptides that are themselves improved biomolecules and / or contribute to the generation of another improved biomolecule. "Physiological" or "normal" or "normal physiological" conditions include, but are not limited to, pressure, temperature, pH, ionic strength, osmolality, osmolality, oxidative stress, the concentration of one or more solutes, electrolytes, glucose, hyaluronan, lactate or lactate, albumin, adenosine, R-2-hydroxyglutarate, pyruvate, oxygen, and / or the presence of oxidizing agents, reducing agents, or cofactors, as well as other conditions considered to be within the normal range in the tissue or organ at the site of administration or action in a subject.

[0039] As used herein, a "transduced cell" or "stably transduced cell" is a cell containing an exogenous nucleic acid integrated into the cell's genome. As used herein, a "genetically modified cell" is a cell containing an exogenous nucleic acid, regardless of whether the exogenous nucleic acid is integrated into the cell's genome and regardless of the method used to introduce the exogenous nucleic acid into the cell. An exogenous nucleic acid in a cell that is not integrated into the cell's genome may be referred to herein as "extrachromosomal." As used herein, a "modified cell" is a cell associated with a recombinant nucleic acid vector containing an exogenous nucleic acid, in an exemplary embodiment, a replication-incompetent recombinant retroviral particle, or a cell genetically modified with an exogenous nucleic acid. Typically, in compositions and methods involving replication-incompetent recombinant retroviral particles, the modified cell associates with the replication-incompetent recombinant retroviral particle through an interaction between a protein on the surface of the cell and a protein on the surface of the replication-incompetent recombinant retroviral particle that contains a pseudotyping element and / or a T cell activation element. In compositions and methods involving transfection of nucleic acids within lipid-based reagents, such as liposome reagents, the lipid-based reagent containing the nucleic acid, a type of recombinant nucleic acid vector, associates with the lipid bilayer of the modified cells before fusing with or being internalized by the modified cells. Similarly, in compositions and methods involving chemical-based transfection of nucleic acids, such as polyethyleneimine (PEI)- or calcium phosphate-based transfection, the nucleic acid typically associates with a positively charged transfection reagent to form a recombinant nucleic acid vector that associates with the negatively charged membrane of the modified cells before being internalized by the modified cells. Other means or methods for stably transfecting or genetically modifying cells include electroporation, ballistic delivery, and microinjection. As used herein, "polypeptide" may include a portion or the entire protein molecule, as well as any post-translational or other modifications.

[0040] As used herein, a pseudotyping element may include a "binding polypeptide," which includes one or more polypeptides, typically glycoproteins, that identify and bind to target host cells, and one or more "fusogenic polypeptides" that mediate fusion of retroviral and target host cell membranes, thereby allowing the retroviral genome to enter the target host cell. As used herein, a "binding polypeptide" may also be referred to as a "T cell and / or NK cell binding polypeptide" or "target-engaging element," and a "fusogenic polypeptide" may also be referred to as a "fusogenic element."

[0041] "Resting" lymphocytes, such as resting T cells, are lymphocytes in the G0 phase of the cell cycle that do not express activation markers such as Ki-67. Resting lymphocytes can include naive T cells that have never encountered a particular antigen, and memory T cells that have been altered by previous encounter with an antigen. "Resting" lymphocytes can also be referred to as "resting" lymphocytes.

[0042] As used herein, "lymphodepletion" includes methods of reducing the number of lymphocytes in a subject, for example, by administering a lymphodepleting agent. Lymphodepletion can also be achieved by fractionated radiation therapy of a portion of the body or the whole body. A lymphodepleting agent may be a compound or composition that, when administered to a mammal, can reduce the number of functional lymphocytes in the mammal. An example of such an agent is one or more chemotherapeutic agents. Such agents and dosages are known and can be selected by the treating physician depending on the subject being treated. Examples of lymphodepleting agents include, but are not limited to, fludarabine, cyclophosphamide, cladribine, denileukin diftitox, alemtizumab, or combinations thereof.

[0043] As used herein, "recombinant retrovirus" refers to a replication-incompetent or "replication-defective" retrovirus unless explicitly described as a replication-competent retrovirus. The terms "recombinant retrovirus" and "recombinant retroviral particle" are used interchangeably herein. Such retroviruses / retroviral particles can be any type of retroviral particle, including, for example, gammaretroviruses and, in exemplary embodiments, lentiviruses. As is known, such retroviral particles, e.g., lentiviral particles, are typically formed in packaging cells by transfecting the packaging cells with a plasmid containing packaging components such as Gag, Pol, and Rev, an envelope or pseudotyping plasmid encoding a pseudotyping element, and a transfer, genome, or retroviral (e.g., lentiviral) expression vector (which is typically a plasmid encoding a gene of interest or other coding sequence). Thus, retroviral (e.g., lentiviral) expression vectors contain sequences (e.g., 5'LTR and 3'LTR flanking the psi packaging element and the target heterologous coding sequence) that facilitate expression and packaging after transfection into cells. The terms "lentivirus" and "lentiviral particle" are used interchangeably herein.

[0044] As used herein, the term "construct" refers to an isolated polypeptide or an isolated polynucleotide encoding a polypeptide. Those skilled in the art will understand whether a construct refers to an isolated polynucleotide or an isolated polypeptide, depending on the context.

[0045] As used herein, "MOI" refers to the multiplicity of infection ratio, and MOI is equal to the ratio of the number of virus particles used for infection per number of cells.As a non-limiting example, FACS and reporter expression can be used to carry out functional titration of virus particle number.

[0046] "Peripheral blood mononuclear cells" (PBMCs) include peripheral blood cells with round nuclei, including lymphocytes (e.g., T cells, NK cells, and B cells) and monocytes. Some blood cell types that are not PBMCs include erythrocytes, platelets, and granulocytes (i.e., neutrophils, eosinophils, and basophils).

[0047] It is to be understood that the present disclosure, and the aspects and embodiments provided herein, are not limited to particular examples disclosed, which may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of disclosing particular examples and embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.

[0048] Where a range of values ​​is provided, it is understood that each intervening value between the upper and lower limits of that range, and any other stated or intervening value within that stated range, to the tenth of the unit of the lower limit, is encompassed within the disclosure unless the context clearly dictates otherwise. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the invention, subject to any specifically excluded limits in the stated range. Where a stated range includes one or both of the limits, ranges excluding either or both of those included limits are also encompassed within the invention. When multiple lower values ​​and multiple upper values ​​are provided in overlapping ranges, one of ordinary skill in the art will recognize that the selected range includes the lower value(s) that are smaller than the upper value(s). All headings in this application are for the convenience of the reader and are not limiting.

[0049] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by those skilled in the art to which this invention belongs.Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of this invention, preferred methods and materials are described herein.All publications mentioned herein are incorporated by reference to disclose and describe the methods and / or materials for which the publications are cited.

[0050] It must be noted that as used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, a reference to "a chimeric antigen receptor" includes a plurality of such chimeric antigen receptors and equivalents thereof known to those skilled in the art, and so forth. It is further noted that the claims may be drafted to exclude any optional element. Accordingly, this statement is intended to serve as a predicate for using exclusive terminology such as "solely," "only," or a "negative" limitation in connection with the recitation of claim elements.

[0051] It is understood that certain features of the invention that are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, for brevity, various features of the invention that are described in the context of a single embodiment may also be provided separately or in any suitable subcombination. All combinations of the embodiments related to the present invention are specifically embraced by the present invention and are disclosed herein as if each and every combination were individually and explicitly disclosed. Furthermore, all subcombinations of the various embodiments and elements thereof are also specifically embraced by the present invention and are disclosed herein as if each and every such subcombination were individually and explicitly disclosed herein. Any section headings used herein are merely organizational and should not be construed as limiting the subject matter described.

[0052] Detailed Description The aspects and embodiments disclosed herein overcome the problems of on-target, off-tumor effects of current cancer therapies, and in particular cancer therapies that target HER2, by providing new chimeric antigen receptors (CARs) for binding HER2 in a specific manner. In exemplary embodiments, the CARs for binding HER2 provided herein are conditionally active biological CARs (i.e., anti-HER2 CAB CARs) used to generate the CAB CAR-T cells and NK cells provided herein, which are active in the tumor environment but not in normal physiological tissues / organs. Such CAB CARs, and in particular T cells and NK cells expressing such CAB CARs, as well as delivery suspensions provided herein comprising such CAB CAR T cells and NK cells, are expected to be used in therapy and in the manufacture of therapeutics, particularly for the treatment of solid tumors, particularly solid tumors that express HER2 and / or are classified as HER2+ tumors. In proof-of-concept experiments disclosed herein, using such T cells and / or NK cells expressing such CAB CARs, it has been shown that the exemplary CAB CAR T cells and / or NK cells provided herein can more effectively kill target cells expressing HER2 at a low pH, such as the TME, compared to normal physiological pH. Furthermore, in such proof-of-concept experiments, the exemplary example CAR-T cells expressing the anti-HER2 CAB CARs provided herein can kill tumor cells expressing HER2 in an in vivo mouse model, yet do not kill cells expressing HER2 outside of the TME.

[0053] In addition to various embodiments of CARs that bind to HER2, nucleic acid embodiments are provided herein that include a nucleotide sequence encoding any of the CARs provided herein, or a nucleotide sequence encoding an antigen-specific targeting region (ASTR) that can be used in such CARs. Additionally, expression vectors for expressing such CARs, such as viral constructs and retroviral particles for expressing any of the CARs, are provided. The CARs of the present disclosure can be used in various methods, and these methods are also provided, along with methods for infecting T cells and other cytotoxic cells with expression vectors, such as recombinant viral vectors, that encode the CARs of the present disclosure.

[0054] Conditionally active biological anti-HER2 CAR (anti-HER2 CAB-CAR) The present disclosure provides chimeric antigen receptors, referred to herein as "CARs" for brevity. In exemplary embodiments, the CARs of the present disclosure are polypeptides that bind to HER2, and in further exemplary embodiments, the CARs bind to HER2 in a conditionally active manner. Exemplary anti-HER2 CARs provided herein typically include an antigen-specific targeting region (ASTR) that binds to HER2, linked to other CAR domains, which in exemplary embodiments are covalently linked. These other CAR domains typically include a stalk domain connecting the anti-HER2 ASTR to a transmembrane domain linked to an intracellular signaling domain. These other CAR domains can further include one or more regulatory domains, as well as any CAR domain known in the art, some of which are expressly provided herein. The ASTR typically includes separate heavy and light chain variable regions, which in exemplary embodiments are on the same polypeptide chain separated by a linker.

[0055] In one aspect, a CAR provided herein comprises: a) at least one conditionally active antigen-specific targeting region (ASTR) that exhibits increased binding to HER2 at pH 6.7 compared to pH 7.4; b) a transmembrane domain; and c) an intracellular activation domain. In an exemplary embodiment, the antigen-specific targeting region of the CAR is a conditionally active scFv portion of an anti-HER2 antibody. Furthermore, in an exemplary embodiment, the ASTR exhibits increased activity in a tumor environment compared to a normal physiological environment.

[0056] In exemplary embodiments, the CARs of the present disclosure are conditionally active. This property is typically a result of the conditionally active nature of the anti-HER2 ASTR domain of the CAR, manifested as increased binding to HER2 at low pH compared to the physiological pH of normal tissue, in exemplary embodiments, increased binding at pH 6.7 relative to pH 7.4. Without being limited by theory, this conditional binding of the anti-HER2 ASTRs provided herein can confer conditional anti-HER2 CAR activity to CARs comprising such conditionally active anti-HER2 ASTRs. In certain embodiments, the conditional anti-HER2 activity of the CARs provided herein is increased CAR activity at pH 6.5-6.9, in exemplary embodiments, 6.7, relative to pH 7.4, upon exposure of cells expressing the CAR to HER2-expressing target cells. In some embodiments, this anti-HER2 CAR activity is activation of T cells upon incubation with HER2-expressing target cells. In some embodiments, T cell activation is determined by analyzing one or more of increased expression of T cell activation biomarkers by the T cells, cytokine production by the T cells, T cell proliferation, and target cell killing by the T cells. As discussed in more detail herein and illustrated in the Examples herein, anti-HER2 CAR activity can be measured in an in vitro assay, in which target cells expressing HER2 and test CAR-T cells transduced with a nucleic acid encoding the on-test CAR are incubated together in an assay medium for an effective time period before detecting and / or measuring T cell activation.

[0057] In certain exemplary embodiments, a CAB-CAR of the present disclosure has a higher binding affinity to HER2 under TME conditions than under non-TME conditions. In some embodiments, both the TME and non-TME conditions are pH. Thus, a CAB-CAR can selectively bind to HER2 in a conditionally active manner because it typically has a higher binding affinity to HER2 at a pH of about 6.0 to 6.8, the pH encountered in the TME, compared to a pH of 7.2 to 7.8, the pH encountered in a normal physiological environment. For example, an exemplary CAB-CAR provided herein may have a higher binding affinity to HER2 at pH 6.7 than at pH 7.4. Additionally or alternatively, an exemplary CAB-CAR provided herein may have a higher binding affinity to HER2 at pH 6.0 than at pH 7.4. Such conditions can be tested, for example, in an in vitro tumor surrogate assay that tests antigen binding and / or CAR activity (e.g., cytolysis) under one or more conditions found in an in vivo tumor environment that differ from corresponding conditions in normal physiological tissue, as described in more detail below. For example, the in vitro tumor surrogate assay conditions can be a lower pH (e.g., 6.0-6.8) compared to physiological pH (7.2-7.8). In an exemplary example, the tumor surrogate assay conditions are a pH of 6.7, while the corresponding physiological pH is 7.4.

[0058] Conditionally active ASTR targeting HER2 As discussed herein, the conditional anti-HER2 CAR activity of exemplary CARs provided herein is believed to be the result of increased binding of the ASTR of those CARs to HER2 at a pH lower than normal physiological pH, compared to binding at normal physiological pH. Accordingly, exemplary embodiments of any of the various aspects provided herein include CARs with conditionally active ASTRs that have increased binding to HER2 protein at pH 5.0-6.8, or pH 6.5-6.8, or pH 6.7, compared to pH 7.4. Examples of such ASTRs and CARs comprising such ASTRs are provided in the Examples section of the present specification. Without being limited by theory, it is noteworthy that the inventors believe that a CAR can be created using any of the ASTRs disclosed herein, including heavy and / or light chain variable regions that, when present in an antibody, confer increased binding to the antibody at pH 6.7 compared to pH 7.4, and that the CAR will have anti-HER2 CAB-CAR activity with increased activity at pH 6.7 compared to pH 7.4. Anti-HER2 CAB killing activity, or even pH-independent killing activity, was not detected in all of the CAR constructs tested in the Examples herein that contained such CAR variable light and / or heavy chains tested, and further testing will likely clarify the anti-HER2 CAB-CAR nature of any of these CARs, particularly when compared to ASTRs made with heavy and light chain variable regions not found in CAB antibodies.

[0059] In some embodiments, an ASTR or antibody or antibody fragment thereof comprising such an ASTR heavy chain and light chain may have a ratio of binding affinity to a HER2 protein at a pH in the TME, such as a pH of 5.0 to 6.8 or a pH of 6.0 to 6.7, to binding affinity to a HER2 protein at a different pH in a non-TME, such as a pH of 7.4, of at least about 1.5:1, at least about 2:1, at least about 3:1, at least about 4:1, at least about 5:1, at least about 6:1, at least about 7:1, at least about 8:1, at least about 9:1, at least about 10:1, at least about 20:1, at least about 30:1, at least about 50:1, at least about 70:1, or at least about 100:1.

[0060] In certain embodiments, the ASTR binds to the same epitope of HER2 as an antibody comprising a heavy chain of SEQ ID NO: 119 and a light chain of SEQ ID NO: 122. In exemplary embodiments, the ASTR binds to the same epitope of HER2 as a single-chain variable antibody fragment comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122, typically separated by a linker. In exemplary embodiments, the heavy chain variable region may be any of SEQ ID NOs: 123-125, and the light chain variable region may be SEQ ID NO: 122. In exemplary aspects, a CAR having such an ASTR is a conditionally active anti-HER2 CAR (i.e., an anti-HER2 CAB CAR). Non-limiting examples of such anti-HER2 CAB CARs are provided in the Examples herein. In some embodiments, a CAR or isolated nucleic acid encoding a CAR may comprise any of the ASTRs of SEQ ID NOs: 153-236, or 157-236, which were tested in the Examples herein and showed increased killing activity compared to a control CAR. In some embodiments, the CAR or isolated nucleic acid encoding a CAR may comprise any of the ASTRs identified in the Examples herein that exhibited CAB activity in the presence of HER2-expressing target cells at pH 6.7 compared to pH 7.4. Antibodies comprising the heavy and light chain variable regions of these ASTRs and the corresponding CARs have been found to have higher binding affinity for HER2 at pH 6.0 than at pH 7.4 (see, e.g., Figures 4 and 8 of U.S. Provisional Patent Application No. 62 / 964,747, which is incorporated herein by reference in its entirety).

[0061] In exemplary embodiments, the light chain variable region may be any of SEQ ID NOS: 126-130, and the heavy chain variable region may be SEQ ID NO: 119. These combinations of heavy and light chain variable regions have demonstrated CAB-CAR activity in the Examples herein. In experiments conducted by at least one of the inventors, antibodies comprising the heavy and light chain variable regions of these ASTRs have been found to have higher binding affinity for HER2 at pH 6.0 than at pH 7.4 (see, e.g., Figures 4 and 8 of U.S. Provisional Patent Application No. 62 / 964,747, incorporated herein by reference in its entirety).

[0062] The combination of the heavy chain variable region and light chain variable region of SEQ ID NO: 119 and 122, respectively, is referred to herein as "Benchmark." The CDRs of the benchmark are as follows: HCDR1 GFNIKDTYIH (SEQ ID NO: 131), corresponding to amino acids 26 to 35 of SEQ ID NO: 119; HCDR2 RIYPTNGYTRYADSVKG (SEQ ID NO: 132), corresponding to amino acids 50 to 66 of SEQ ID NO: 119; HCDR3 WGGDGFYAMDY (SEQ ID NO: 133), corresponding to amino acids 99 to 109 of SEQ ID NO: 119; LCDR1 RASQDVNTAVA (SEQ ID NO: 134), corresponding to amino acids 24 to 34 of SEQ ID NO: 122; LCDR2 SASFLYS (SEQ ID NO: 135), corresponding to amino acids 50 to 56 of SEQ ID NO: 122; and LCDR3 QQHYTTPPT (SEQ ID NO: 136), corresponding to amino acids 89 to 97 of SEQ ID NO: 122. These CDRs include amino acids based on the sequence definition of a CDR (Kabat et al. (1987) Sequences of Proteins of Immunological Interest (Natl. Inst. Health, Bethesda, MD) and the structural definition of a CDR (Chothia and Lesk (1987) J. Mol. Biol. 196:901-917). The CDRs of the anti-HER2 ASTRs of the CARs provided herein are similarly defined. Non-limiting exemplary ASTRs including benchmark heavy and light chains separated by exemplary linkers are provided in SEQ ID NOs: 153-156.

[0063] In exemplary embodiments herein, the anti-HER2 ASTRs provided herein confer increased CAR activity to CARs containing them at a pH of 6.7 compared to pH 7.4. The anti-HER2 ASTRs of these CARs, in exemplary embodiments, bind to the same epitope of HER2 as an antibody or single-chain variable antibody fragment comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122. In exemplary embodiments, such anti-HER2 ASTRs provided herein have greater binding to HER2 at a pH of 6.7 compared to 7.4.

[0064] ASTR binds to HER2 and, in exemplary embodiments, binds to the same epitope of HER2 as an antibody or single chain variable antibody fragment comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122. In some embodiments, the ASTR typically comprises a heavy chain variable region comprising three complementarity determining regions, the CDRs having the sequences HCDR1, HCDR2, and HCDR3, The HCDR1 sequence is GFNIKDTYIH (SEQ ID NO: 131), The HCDR2 sequence is X1IYPTNGYTX2YADSVKG (SEQ ID NO: 137), The HCDR3 sequence is WGGDGFYAMDY (SEQ ID NO: 133), ASTRs typically comprise a light chain variable region comprising three CDRs, said CDRs having the sequences LCDR1, LCDR2, and LCDR3; The LCDR1 sequence is RASQDVNTX3VA (SEQ ID NO: 142); The LCDR2 sequence is SASFLYS (SEQ ID NO: 135), The LCDR3 sequence is QQX4YTTPPT (SEQ ID NO: 143); wherein X1 is R or K, X2 is R or E, X3 is A or D, and X4 is H, D, or E.

[0065] In exemplary embodiments, the combination of heavy and light chain variable regions does not include a benchmark heavy and light chain CDR combination. In exemplary embodiments, the ASTR includes a 5-50 (e.g., 10-40, 15-30) amino acid linker between the heavy and light chain variable regions. In some embodiments, the ASTR has heavy and light chain variable region sequences that are at least 70%, 80%, 85%, 90%, 95, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 119 and SEQ ID NO: 122, respectively, and includes one, two, three, or all four of X1 as K, X2 as E, X3 as D, and X4 as D or E. In some embodiments, the ASTR has heavy and light chain variable region sequences that are each identical to SEQ ID NO: 119 and SEQ ID NO: 122, respectively, except for one, two, three, or all four of X1 as K, X2 as E, X3 as D, and X4 as D or E. Exemplary ASTRs comprising benchmark heavy and light chains containing benchmark CDRs and separated by exemplary linkers are provided in SEQ ID NOs: 153-156.

[0066] In some embodiments, X1, X2, X3, and X4 in the ASTR are R, R, A, and H, respectively. However, in exemplary embodiments, when the CDRs of the above aspects do not include a benchmark heavy chain variable region and light chain variable region combination, X1, X2, X3, and X4 of the ASTR are R, R, A, and H, respectively. 1、X 2 、The combination of X3 and X4 is other than R, R, A, and H, respectively. Thus, for example, the heavy and light chains are other than SEQ ID NO: 119 and SEQ ID NO: 122, respectively. In exemplary embodiments, an ASTR does not include both the sequences (i.e., the combination) of SEQ ID NOs: 119 and 122. In some embodiments, an ASTR does not include the CDR combination where X1 is R and X2 is R in the heavy chain variable region, and X3 is A and X4 is H in the light chain variable region. In exemplary embodiments, the remainder of the ASTR comprises the heavy chain variable region of SEQ ID NO: 119 excluding the CDRs (framework regions of the heavy chain variable region), and the light chain variable region of SEQ ID NO: 122 excluding the CDRs (framework regions of the light chain variable region).

[0067] In some embodiments, X1, X2, X3, and X4 of the heavy and light chain variable regions can be R, R, D, and H (A032D), R, R, A, and D (H091D), R, R, A, and E (H091E), K, R, A, and H (R050K), or R, E, and H (R059E). Each of these benchmark variants was identified in an antibody as conferring increased binding to HER2 at a pH below 7.4, as illustrated in the Examples herein. As shown in the Examples herein, each of these single heavy and light chain variable region variants from the benchmark conferred CAB-CAR activity when included in the ASTR of an anti-HER2 CAR.

[0068] In Examples 2 and 3, CARs with ASTRs containing these sequences as CDRs lysed HER2-expressing cells (Tables 2-4). CARs with a ratio of activity at pH 6.7 (typical TME) to pH 7.4 (typical non-TME) greater than 112, i.e., CARs showing higher activity at lower pH, were identified as CABs (constructs classified as "CAB" in Table 3). CARs were tested with either a heavy or light chain at the N-terminus of the other ASTR, and with a linker between the heavy and light chains. In any of these embodiments, the light chain can be N-terminal to the heavy chain, or the heavy chain can be N-terminal to the light chain. In exemplary embodiments, the CAR can include the CDRs and, in exemplary embodiments, the ASTRs of any one of F1-4-37, F1-4-26, F1-4-27, F1-4-28, F1-4-74, F1-4-75, F1-4-77, F1-4-81, and F1-4-85 (SEQ ID NOs: 154, 156, 159-162, 172-173, 175-176, 199, or 224) in Table 3, all of which had CAB-CAR activity as shown in Example 2. Table 3 shows the CDR mutations and whether the heavy or light chain is N-terminal to the other. The CAR contained the FRs of SEQ ID NOs: 119 and 122 for the heavy and light chains, respectively. It is noteworthy that F1-4-31 is classified as wild-type in Example 2 because its CAB activity was not greater than the benchmark, but the lysis rate ratio was greater than 1 and therefore may have CAB activity.

[0069] In some embodiments, any of the CARs provided herein can have an ASTR comprising a heavy chain of SEQ ID NO: 119 and a light chain of any of SEQ ID NOs: 126-128. In some embodiments, the ASTR can comprise a heavy chain of SEQ ID NO: 123 or SEQ ID NO: 124 and a light chain of SEQ ID NO: 122.

[0070] ASTR binds to HER2 and, in an exemplary embodiment, binds to the same epitope of HER2 as a single chain variable antibody fragment comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122. In some embodiments, the heavy chain variable region can comprise three complementarity determining regions, wherein the CDRs have the sequences HCDR1, HCDR2, and HCDR3; The HCDR1 sequence is GFX1IKDTYIH (SEQ ID NO: 138), The HCDR2 sequence is RIX2PTX3X4YX5RYADSVKG (SEQ ID NO: 139), The HCDR3 sequence is WGGDGFYX6MDY (SEQ ID NO: 140), The ASTR can comprise a light chain variable region comprising three CDRs, said CDRs having the sequences LCDR1, LCDR2, and LCDR3; The LCDR1 sequence is RASQDVNTAVA (SEQ ID NO: 134), The LCDR2 sequence is SASFLYS (SEQ ID NO: 135), The LCDR3 sequence is QQHYTTPPT (SEQ ID NO: 136), wherein X1 is N or W, X2 is Y, D, or K, X3 is N or A, X4 is G or K, X5 is T or D, and X6 is A or E; The combination of heavy and light chain variable regions does not include the combination of benchmark heavy and light chain CDRs.

[0071] Because the CDRs of the above aspects do not include combinations of benchmark heavy and light chain variable regions, the combination of X1, X2, X3, X4, X5, and X6 of the ASTR is other than N, Y, N, G, T, and A, respectively. Thus, for example, the heavy and light chains are other than SEQ ID NO: 119 and SEQ ID NO: 122, respectively. In an exemplary embodiment, the ASTR does not include both SEQ ID NOs: 119 and 122 (i.e., the combination). In an exemplary embodiment, the remainder of the ASTR includes the heavy chain variable region of SEQ ID NO: 119 (framework regions of the heavy chain variable region) excluding the CDRs, and the light chain variable region of SEQ ID NO: 122 (framework regions of the light chain variable region) excluding the CDRs.

[0072] In some embodiments, X1, X2, X3, X4, X5, and X6 of the heavy and light chain variable regions can be W, Y, N, G, T, and A, respectively (N028W), N, D, N, G, T, and A, respectively (Y052D), N, K, N, G, T, and A, respectively (Y052K), N, Y, A, G, T, and A, respectively (N055A), N, Y, N, K, T, and A, respectively (G056K), N, Y, N, G, D, and A, respectively (T058D), or N, Y, N, G, T, and E, respectively (A106E). In some embodiments, the heavy chain can comprise the mutation S119E. These mutations were shown to have CAB activity when tested as anti-HER2 antibodies (see, e.g., Example 1 and U.S. Provisional Application No. 62 / 964,747, incorporated herein by reference).

[0073] ASTR binds to HER2 and, in an exemplary embodiment, binds to the same epitope of HER2 as a single chain variable antibody fragment comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122. In some embodiments, the heavy chain variable region can comprise three complementarity determining regions, wherein the CDRs have the sequences HCDR1, HCDR2, and HCDR3; The HCDR1 sequence is GFX1IKDTYIH (SEQ ID NO: 138), the HCDR2 sequence is X2IX3PTX4X5YX6X7YADSVKG (SEQ ID NO: 141); The HCDR3 sequence is WGGDGFYX8MDY (SEQ ID NO: 140), The ASTR can comprise a light chain variable region comprising three CDRs, said CDRs having the sequences LCDR1, LCDR2, and LCDR3; The LCDR1 sequence is RASQDVNTX9VA (SEQ ID NO: 142); The LCDR2 sequence is SASFLYS (SEQ ID NO: 135), The LCDR3 sequence is QQX 10 YTTPPT (SEQ ID NO: 143), wherein X1 is N or W, X2 is R or K, X3 is Y, D, or K, X4 is N or A, X5 is G or K, X6 is T or D, X7 is R or E, X8 is A or E, X9 is A or D, and X 10 is H, D, or E, The combination of heavy and light chain variable regions does not include the combination of benchmark heavy and light chain CDRs.

[0074] Since the CDRs of the above-described aspects do not include combinations of benchmark heavy and light chain variable regions, in exemplary embodiments, X1, X2, X3, X4, X5, X6, X7, X8, X9, and X10 of ASTR are used. 10 is other than N, R, Y, N, G, T, R, A, A, and H, respectively. Thus, for example, the heavy and light chains are other than SEQ ID NO: 119 and SEQ ID NO: 122, respectively. In an exemplary embodiment, the ASTR does not comprise both the sequences of SEQ ID NOs: 119 and 122 (i.e., the combination thereof). In an exemplary embodiment, the remainder of the ASTR comprises the heavy chain variable region of SEQ ID NO: 119 excluding the CDRs (framework regions of the heavy chain variable region), and the light chain variable region of SEQ ID NO: 122 excluding the CDRs (framework regions of the light chain variable region).

[0075] In some embodiments, X1, X2, X3, X4, X5, X6, X7, X8, X9, and X10 of the heavy and light chain variable regions are 10 are W, R, Y, N, G, T, R, A, A, and H (N028W), respectively, N, K, Y, N, G, T, R, A, A, and H (R050K), respectively, N, R, D, N, G, T, R, A, A, and H (Y052D), respectively, N, R, K, N, G, T, R, A, A, and H (Y052K), respectively, N, R, Y, A, G, T, R, A, A, and H (N055A), respectively N, R, Y, N, K, T, R, A, A, and H (G056K), respectively N, R, Y, N, G, D, R, A, A, and H (T058D), respectively N, R, Y, N, G, T, E, A, A, and H (R059E), respectively N, R, Y, N, G, T ,R,E,A, and H(A106E), respectively N,R,Y,N,G,T,R,R,D, and H(A032D), respectively N,R,Y,N,G,T,R,A,A, and D(H091D), respectively N,R,Y,N,G,T,R,A,A, and E(H091E), respectively N,R,K,N,G,T,R,R,D, and and H (Y052K / A032D), respectively; N,R,Y,N,K,T,R,R,D, and H (G056K / A032D); N,R,Y,N,G,D,R,D,A, and H, respectively (T058D / A032D); or N,R,Y,N,G,T,R,E,D, and H (A106E / A032D), respectively. In some embodiments, the heavy chain may comprise the mutation S119E. These mutations have been shown to have CAB activity when tested as anti-HER2 antibodies in experiments performed by at least one of the inventors (see, e.g., Figures 4 and 8 of U.S. Provisional Application No. 62 / 964,747, incorporated herein by reference).

[0076] In any of the embodiments disclosed herein, the ASTR can be a single-chain antibody, a Fab fragment, a Fab' fragment, a (Fab')2 fragment, an Fv fragment (e.g., an scFv fragment), a bivalent single-chain antibody, or a diabody. In an exemplary embodiment, the conditionally active ASTR that binds to HER2 is a single-chain variable fragment comprising a heavy chain and a light chain.

[0077] An exemplary conditionally active CAR (CAB-CAR) with increased binding to HER2 at pH 6.7 compared to pH 7.4 is found in the Examples herein. In exemplary embodiments, the CAR or ASTR binds to the same epitope of HER2 as an antibody or single-chain variable antibody fragment comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122. In further embodiments of such exemplary embodiments, the anti-HER2 CAR or ASTR comprises or is a single-chain variable fragment (scFv). In further exemplary examples, the anti-HER2 scFv comprises either a heavy chain that is N-terminal to the light chain or a light chain that is N-terminal to the heavy chain. In any of the embodiments herein, including CARs, and in exemplary embodiments, the CAR binds to the same epitope of HER2 as an antibody comprising the antibody heavy chain variable region of SEQ ID NO: 119 and the antibody light chain variable region of SEQ ID NO: 122, and the CAR can comprise any of SEQ ID NOs: 119, 122-124, or 126-28, and in exemplary embodiments, comprises one heavy chain and one light chain other than the combination of SEQ ID NO: 119 and SEQ ID NO: 122. Furthermore, the anti-HER2 CAR of any of the embodiments herein can comprise any of the CAR components provided herein. In exemplary embodiments, anti-HER2 CARs, and particularly CARs including anti-HER2 CAB-CARs, in non-limiting exemplary embodiments, comprise any of the anti-HER2 CAB-CARs that exhibit conditional cytotoxic activity ("CAB") in Tables 3-4.

[0078] The heavy and light chain variable region polypeptides disclosed herein were identified from a parent antibody heavy chain variable region (SEQ ID NO: 119) and a parent antibody light chain variable region (SEQ ID NO: 122).

[0079] The CAR can also include an ASTR, which is a variant of the heavy and light chain variable regions of the sequences of SEQ ID NOs: 119 and 122 that can specifically bind to HER2. In an exemplary embodiment, it can include the CDRs of the heavy chain variable region (HCDR1-HCDR3) and the CDRs of the light chain variable region (LCDR1-LCDR3). These variants of the heavy and light chain variable regions can be prepared by introducing appropriate modifications into the nucleotide sequences encoding the heavy and light chain variable regions or by peptide synthesis. Such modifications include, for example, deletions from, and / or insertions and / or substitutions of residues within the amino acid sequence of the antibody or antibody fragment. Any combination of deletion(single or multiple), insertion(single or multiple), and substitution(single or multiple) can be performed to arrive at the final construct, provided that the final construct has at least one desired property, such as antigen binding.

[0080] Testing for conditional activity As shown, the anti-HER2 CARs provided herein are typically CAB-CARs (i.e., conditionally active CARs) that exhibit increased CAR activity at pH 5-6.7 compared to pH 7.4 (e.g., CAB-CAR activity at pH 6.7 compared to pH 7.4), and this CAR activity can be detected or measured by activation of T cells expressing the CARs provided herein upon incubation with HER2-expressing target cells. In some embodiments, T cell activation is determined by analyzing one or more of the following: increased expression of T cell activation biomarkers by the T cells, cytokine production by the T cells (intracellular or extracellular), T cell proliferation, and / or target cell killing by the T cells. As illustrated in the Examples herein, CAR activity can be measured in an in vitro assay, in which HER2-expressing target cells and test CAR-T cells transduced with a nucleic acid encoding the test CAR are incubated together in an assay medium for an effective time period for performing the assay. The following paragraphs provide further disclosure regarding such assays. Additionally, the examples herein provide non-limiting examples of CAR activity and CAB-CAR assays, such as luciferase cell killing assays and real-time cell killing assays that measure impedance, as well as several in vitro expression and in vivo assays. It should be noted that a CAR designed using heavy and light antibody chains and shown to bind to HER2 in an initial screen using one type of target cell, but that does not promote CAR killing or exhibit CAB activity, may be a CAB-CAR with a different domain combination or when tested with other HER2-expressing target cells. Because the anti-HER2 CARs disclosed in the exemplary embodiments herein contain ASTRs with CDRs from antibodies experimentally determined to have increased binding to HER2 at pH 5.0-6.7 compared to pH 7.4, these anti-HER2 CARs of the exemplary embodiments herein are considered to be CAB-CARs.This is because they exhibit CAB CAR activity at least under certain conditions, such as the particular cell lines used in any of the CAB-CAR activity screens disclosed herein.

[0081] Typically, CAB-CAR activity at pH 5.0-6.7 versus pH 7.4 is determined using a quantitative assay, examples of which are provided herein, but are not limited to this section. In some embodiments, a particular CAB-CAR activity is based on a statistically significant result. For example, such an assay involves using a statistical test to compare replication results of a control CAR with replication results of a test CAR, or to compare replication results of a test CAR at pH 5.0-6.7 versus pH 7.5, and the activity is determined based on statistical significance (e.g., the mean value of test replicates at 6.7 is at least 1, 2, or 3 standard deviations greater than at 7.4, or the pH 6.7 / 7.4 ratio has such statistical significance compared to the same pH 6.7 / 7.4 ratio of a control CAR with a CAR made with an antibody domain that does not exhibit CAB activity, or the ranges of activity (mean ± 1, 2, or 3 standard deviations) of the control CAR and the test CAR do not overlap), typically based on a significant increase in CAR activity of the test sample relative to the control sample. Such assays can also involve comparing the results of a control CAR with those of a test CAR, for example, using a T-test. Additionally, these tests can compare the test CAR at lower and higher pH values ​​using only the test CAR to determine whether the test CAR has CAB-CAR activity.

[0082] The CAR of the present disclosure can be present in the plasma membrane of a eukaryotic cell, such as a mammalian cell. Suitable mammalian cells include, but are not limited to, cytotoxic cells, T lymphocytes, stem cells, progeny of stem cells, progenitor cells, progeny of progenitor cells, NK cells, NK-T cells, and macrophages. In an exemplary embodiment, the CAR is present in the plasma membrane of a population of T cells and / or NK cells. When present in the cell membrane of a eukaryotic cell, the CAR of the present disclosure is active in the presence of HER2, which binds to ASTR under certain conditions. The anti-HER2 ASTR is the first member of a specific binding pair, and HER2 is the second member of the specific binding pair. The HER2 of the specific binding pair can be soluble (e.g., not bound to a cell), but in an exemplary embodiment, it can be present on the surface of a cell, such as a target cell, displayed on a solid surface, or present in a lipid bilayer.

[0083] In some cases, when a CAR of the present disclosure is present in the plasma membrane of a eukaryotic cell and activated by HER2, it increases the expression of at least one nucleic acid in the cell. For example, in some cases, when a CAR of the present disclosure is present in the plasma membrane of a eukaryotic cell and activated by HER2, it increases the expression of at least one nucleic acid in the cell by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10-fold compared to the transcription level of the nucleic acid in the absence of HER2.

[0084] As an example, a CAR of the present disclosure can include an immunoreceptor tyrosine-based activation motif (ITAM)-containing intracellular signaling polypeptide; in such cases, the CAR of the present disclosure resides in the plasma membrane of a eukaryotic cell and, when activated by HER2, increases nuclear factor of activated T cells (NFAT)-dependent transcription. NFAT-dependent transcription includes transcription induced by any member of the NFAT family, such as NFATel, NFATc2, NFATc3, NFATc4, NFAT5; AP-1; Spl; NKKB; etc.

[0085] A CAR of the present disclosure, when present in the cell membrane of a eukaryotic cell that is activated by binding of the CAR to HER2, can, in some cases, result in increased production of one or more cytokines in the cell. For example, a CAR of the present disclosure, when present in the cell membrane of a eukaryotic cell and activated by HER2, can increase the production by the cell of a cytokine, such as IFN-gamma or IL-2, or a cell surface marker associated with activation, such as CD107a and / or CD69, by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 75%, at least 2-fold, at least 2.5-fold, at least 5-fold, at least 10-fold, or more than 10-fold, compared to the amount of cytokine produced by the cell in the absence of HER2. In some embodiments, a CAR of the present disclosure, when present in the cell membrane of a eukaryotic cell and activated by HER2, can increase cytokine secretion by the cell by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 75%, at least 2-fold, at least 2.5-fold, at least 5-fold, at least 10-fold, or more than 10-fold compared to the amount of cytokine secreted by the cell in the absence of HER2. Cytokines whose production can be increased include, but are not limited to, interferon gamma (IFN-γ), tumor necrosis factor-α (TNF-α), IL-2, IL-15, IL-12, IL-4, IL-5, IL-10; chemokines; growth factors, etc. Thus, as shown in Example 3, CAB-CAR activity can be demonstrated by comparing the expression levels of CD69 or CD107a at different pH values, for example, pH 6.7 and pH 7.4. The general method for these assays is as follows: Her2-expressing mammalian target cells are seeded into wells of tissue culture plates at high and low pH and incubated overnight at 37° C. and 5% CO. The next day, test CAR effector cells, with the pH adjusted appropriately, are added to the wells containing the target cells at a specific effector cell to target cell (E:T) ratio to form a co-culture.Typical E:T ratios used in these assays are 10:1, 5:1, 3:1, 1:1, 1:3, 1:5, or 1:10. In exemplary embodiments, the E:T ratio is 3:1, 1:1, or 1:3. Co-cultures are incubated at 37°C and 5% CO2 for various times depending on the marker being tested. In Example 3, co-cultures of CAR effectors and MCF-7 targets were incubated for 1 day, after which the cells were harvested and stained with antibodies for analysis of CD69 surface expression and intracellular IFNg by flow cytometry. For IFNg staining, the cells were first permeabilized. The general method for CD107a expression is similar, except that brefeldin A and monensin are added at the beginning of stimulation (e.g., when co-culturing target and effector cells), and the co-culture is incubated for approximately 5 hours before the cells are harvested and stained with an antibody against CD107a. To specifically detect surface expression of activation markers on CAR-T cells, cells are typically co-stained with antibodies against CD3, CD4, CD8, and an antibody against the CAR or a cell tag (such as an eTag), and flow cytometry with gating is used to examine live CD3+eTag+ cells for expression of activation markers, for example.

[0086] As shown in Example 3, CAB-CAR activity can also be assessed by comparing the proliferation of CAR-T cells with target cells after stimulation at different pHs, e.g., pH 6.7 vs. pH 7.4. A typical method for a proliferation assay is as follows: target cells, such as Her2-expressing target cells, are treated with mitomycin C and incubated at 37°C and 5% CO2 for approximately 3 hours to inhibit further proliferation. The target cells are washed with PBS and seeded into wells of tissue culture plates at high and low pH. The CAR effector cells to be tested are harvested, labeled with one or more cell tracing dyes (e.g., carboxyfluorescein diacetate succinimidyl ester (CFSE) and Celltrace Violet), and added to the target cells at the corresponding pH in a defined E:T ratio as described above, followed by incubation at 37°C and 5% CO2. After 1 to 14 days of coculture, e.g., approximately 5 days, the cells are harvested and stained for cell tags, such as 7AAD, CD3, CD8, and eTag. As effector cells proliferate, the amount of cell tracing dye decreases, detectable as a distinct peak in the flow cytometry histogram. Gating can be used to specifically examine proliferation of CD3+ Cell Tag+ live cells.

[0087] In some cases, a CAR of the present disclosure, when present in the cell membrane of a eukaryotic cell and activated by HER2, can result in increased transcription of nucleic acids in the cell, increased cytokine production, and increased cytokine secretion by the cell.

[0088] In some cases, a CAR of the present disclosure, when present in the plasma membrane of a eukaryotic cell and activated by HER2, results in cytotoxic activity by the cell against a target cell that expresses on its cell surface an antigen to which the antigen-binding domain of the first polypeptide of the CAR binds. For example, when the eukaryotic cell is a cytotoxic cell (e.g., an NK cell or a cytotoxic T lymphocyte (i.e., a cytotoxic T cell), a CAR of the present disclosure, when present in the plasma membrane of the cell and when activated by HER2, increases the cytotoxic activity of the cell against a target cell that expresses HER2 on its cell surface. For example, when the eukaryotic cell is an NK cell or a T lymphocyte, a CAR of the present disclosure, when present in the plasma membrane of the cell and when activated by HER2, increases the cytotoxic activity of the cell by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10-fold compared to the cytotoxic activity of the cell in the absence of HER2.

[0089] In some cases, the CARs of the present disclosure reside in the plasma membrane of eukaryotic cells and, when activated by HER2, can result in proliferation and other CAR activation-related events, such as increased cell division or an anti-apoptotic response.

[0090] In some cases, the CARs of the present disclosure reside in the plasma membrane of eukaryotic cells and, when activated by HER2, can result in other CAR activation-related events, such as intracellular signaling modulation, cell differentiation, or cell death.

[0091] The CAR of the present disclosure can exist in a eukaryotic cell membrane, where the first and second polypeptides of the CAR are not covalently bound to each other. The CAR of the present disclosure can exist in a eukaryotic cell membrane as a single heterodimer that is not covalently bound to any other polypeptide in the membrane. Alternatively, the first CAR of the present disclosure can exist in a eukaryotic cell membrane as a heterodimer that is covalently or non-covalently bound to the second CAR of the present disclosure. In some cases, the first and second CARs are covalently bound via a disulfide bond formed between cysteines present in the hinge regions present in both the first polypeptide of the first CAR and the first polypeptide of the second CAR.

[0092] In some cases, the CAR of the present disclosure can exist in a eukaryotic cell membrane, where the first polypeptide of the CAR comprises an antibody fragment and the second polypeptide of the CAR comprises a signaling domain derived from a cytokine receptor, thereby forming a heterodimeric signaling body CAR, e.g., a signaling body composed of at least two independent polypeptides, upon dimerization. A "signalobody," as known in the art, is a single chimeric polymer composed of an antibody fragment and a signaling domain derived from a cytokine receptor. In certain cases, the heterodimeric signaling body CAR of the present disclosure, when present in the cell membrane of a eukaryotic cell, can be dimerized by a dimerizer and activated by an antigen, e.g., an oligomerization antigen, to induce oligomerization of the heterodimeric signaling body CAR. Ligand-induced oligomerization of such a heterodimeric signaling body CAR can be activated, e.g., increased, or perpetuated, e.g., maintained. Signal transduction, e.g., ligand-induced oligomerization of heterodimeric signalobody CARs, can transmit a signal that elicits a cellular response. In some cases, multiple heterodimeric signalobody CARs can be used in combination to elicit a desired cellular response.

[0093] Further ASTR Structural Considerations The CARs of the present disclosure comprise a member of a specific binding pair with HER2 (i.e., capable of binding to HER2 under at least certain conditions), which is typically an anti-HER2 ASTR. An anti-HER2 ASTR suitable for use in the CARs of the present disclosure can be any antigen-binding polypeptide, typically capable of binding, effective to bind, or adapted to bind to HER2. In certain embodiments, the ASTR is a single-chain antibody, a Fab fragment, a Fab' fragment, a (Fab')2 fragment, an Fv fragment (e.g., scFv), a bivalent single-chain antibody or diabody, or an antigen-binding variable region (V H Or V L), and antibodies such as a light chain constant domain (CL), and a heavy chain constant domain CH1 (a "full-length" antibody in which CH2 and CH3 are omitted). The anti-HER2 ASTRs provided herein, in exemplary embodiments, comprise two antibody chains: a heavy chain (VH) and a light chain (VL). Each of the VH and VL typically comprises three variable regions and four framework regions. As used herein, the term "variable region" or "variable domain" refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to an antigen. The heavy and light chains (VH and VL, respectively) of natural antibodies and the variable domains of the exemplary anti-HER2 ASTRs herein generally have similar structures, with each domain comprising four conserved framework regions (FR) and three hypervariable complementarity-determining regions (CDRs) (HCDR1, HCDR2, and HCDR3 of the VH chain, and LCDR1, LCDR2, and LCDR3 of the VL chain). See, for example, Kindt et al., Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007). A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind to a specific antigen may be isolated using a VH or VL domain from an antibody that binds the antigen, followed by screening a library of complementary VL or VH domains, respectively. See, for example, Portolano et al., J. Immunol., vol. 150, pp. 880-887, 1993; or Clarkson et al., Nature, vol. 352, pp. 624-628, 1991. As used herein, the term "framework" or "framework region" or "FR" typically refers to variable domain residues other than CDRs (HCDRs 1-3 of the heavy chain and LCDRs 1-3 of the light chain). The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4.Thus, the CDR and FR sequences generally appear in the following sequence in VH (or VL): FR1-HCDR1 / LCDR1-FR2-HCDR2 / LCDR2-FR3-HCDR3 / LCDR3-FR4. The boundaries of FRs and CDRs can be precisely defined by methodologies known in the art, such as the Kabat definition, the Chothia definition, the AbM definition, and / or the contact definition, all of which are well known in the art. See, e.g., Kabat, EA, et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, US Department of Health and Human Services, NIH Publication No. 91-3242, Chothia et al. (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al. (1997) J. Mol. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17:132-143 (2004), which are incorporated herein by reference in their entireties.

[0094] In exemplary embodiments, the anti-HER2 ASTRs provided herein are "humanized." The terms "humanized antibody" and "humanized ASTR" typically refer to non-human antibodies or ASTRs, respectively, in which FRs have been replaced with sequences found in human antibodies. Generally, in a humanized antibody, the entire antibody, excluding the CDRs, is encoded by a polynucleotide or isolated nucleic acid of human origin or is identical to such an antibody, except within its CDRs. In a humanized ASTR, the ASTR is encoded by a polynucleotide or isolated nucleic acid that is identical to the corresponding portion of a human antibody, except within its CDRs. Preferably, a humanized antibody or ASTR has the same or substantially the same affinity for the antigen as the non-humanized mouse antibody from which it was derived. CDRs, some or all of which are encoded by nucleic acid from a non-human organism, are grafted into the beta-sheet framework of a human antibody variable region to generate an antibody whose specificity is determined by the grafted CDRs. In exemplary embodiments, the CARs described herein comprise a humanized ASTR that recognizes HER2, and in further exemplary embodiments, have CAB-CAR activity. In some embodiments, the heavy chain variable region of an ASTR of the present disclosure can comprise the FR of SEQ ID NO: 119 in combination with any of the HCDR1, HCDR2, and HCDR3 disclosed herein (e.g., SEQ ID NOs: 131-133 and 137-141). In some embodiments, the light chain variable region of an ASTR can comprise the FR of SEQ ID NO: 122 in combination with any of the LCDR1, LCDR2, and LCDR3 disclosed herein (e.g., SEQ ID NOs: 134-136 and 142-143). Such heavy and light chain combinations are other than (i.e., do not include) the combination of SEQ ID NO: 119 and SEQ ID NO: 122.

[0095] Various techniques and methods for modifying, humanizing, and reshaping non-human antibodies are well known in the art (see Lu, RM., Hwang, YC., Liu, IJ. et al. "Development of therapeutic antibodies for the treatment of diseases," J Biomed Sci 27, 1 (2020) Lu et al. (incorporated herein by reference in its entirety)). Humanization or other methods for reducing the immunogenicity of non-human antibody variable regions may include resurfacing methods known in the art. In one embodiment, the parent antibody is affinity matured as known in the art. Structure-based methods may be used for humanization and affinity maturation as known in the art. Selection-based methods may be used to humanize and / or affinity mature antibody variable regions as known in the art. Other humanization methods may involve grafting only portions of CDRs, as known in the art.

[0096] Human framework regions that may be used in humanizing the anti-HER2 ASTRs provided herein include framework regions selected using the "best fit" method (see, e.g., Sims et al. J. Immunol., vol. 151, p. 2296, 1993); framework regions derived from consensus sequences of human antibodies of a particular subpopulation of light chain variable regions or heavy chain variable regions, for example, any of the sequences found in 4D5-1, 4D5-2, 4D5-3, 4D5-4, 4D5-5, 4D5-6, 4D5-7, or 4D5-8 disclosed by Carter et al., may be used with the mutations disclosed in the exemplary embodiments section herein (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, vol. 89, p. 4285, 1992; and Presta et al. J. Immunol., vol. 151, p. 2623, 1993); human mature (somatically mutated) framework regions or human germline framework regions (see, for example, Almagro and Fransson, Front. Biosci., vol. 13, pp. 1619-1633, 2008); and framework regions derived from a screening FR library (see, for example, Baca et al., J. Biol. Chem., vol. 272, pp. 10678-10684, 1997 and Rosok et al., J. Biol. Chem., vol. 271, pp. 22611-22618, 1996). The VH and VL variable regions of the parent non-human antibody can be subjected to three-dimensional molecular modeling analysis according to methods known in the art. Framework amino acid residues predicted to be important for the formation of correct CDR structures can then be identified using the same molecular modeling analysis. In parallel, human VH and VL chains with amino acid sequences homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent VH and VL sequences as search queries, and human VH and VL acceptor genes are then selected.

[0097] In some embodiments, the anti-HER2 ASTRs provided herein can be human or humanized antibodies. In any of the embodiments provided herein, the ASTR can have any of the sequence changes provided herein relative to the anti-HER2 ASTR, as described in more detail in the exemplary embodiments. For example, a phage display screen identified potential mutations in the 4D5-8 background at various residues that may improve binding of anti-HER2 antibodies to HER2 (Gerstner et al., 2002, J Mol Biol 321(5):851-862). In some embodiments, any of the CAR embodiments provided herein can include different phage display screen mutations. Further embodiments are provided in the exemplary embodiments section herein. In some embodiments, the anti-HER2 ASTRs provided herein can include an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or framework region sequence of SEQ ID NO: 119. In some embodiments, the ASTR may comprise an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or framework region sequence of SEQ ID NO: 122. In some embodiments, the CDRs of the light chain variable region and heavy chain variable region of an antibody are grafted onto human FRs or consensus human FRs. To create consensus human FRs, FRs from several human heavy or light chain amino acid sequences are aligned to identify a consensus amino acid sequence. CDR grafting is described, for example, in U.S. Patent No. 7,022,500 (Queen) and is known in the art.In any of the aspects and embodiments provided herein that include an ASTR, the anti-HER2 ASTRs provided herein can include immunoglobulin heavy chain variable regions directed to various antigens, comprising an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework region sequences of SEQ ID NOs: 252-254, where amino acids in the framework regions have been replaced with consensus human amino acids to form humanized antibodies. In some embodiments, the ASTRs can include immunoglobulin heavy chain variable regions directed to various antigens, comprising an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework region sequences of SEQ ID NOs: 255-257, where amino acids in the framework regions have been replaced with murine or consensus human amino acids to form humanized antibodies.

[0098] The framework regions (FRs) of the heavy and light chains of antibodies with any of the mutations disclosed herein can be used in the anti-HER2 ASTRs provided herein. The FRs of SEQ ID NO: 119 include residues 1-25, 36-49, 67-98, and 110-120. The FRs of SEQ ID NO: 122 include residues 1-23, 35-49, 57-88, and 98-107. Those skilled in the art will be able to identify the FRs of the heavy and light chains. In some embodiments, the heavy chain variable region of ASTR can include the FRs of SEQ ID NO: 119. In some embodiments, the light chain variable region of ASTR can include the FRs of SEQ ID NO: 122.

[0099] Conditionally active anti-HER2 ASTRs (i.e., ASTRs that target HER2) can include sequences from antibodies and antibody fragments known to target HER2. For example, the ASTR can include sequences from a humanized version of the mouse monoclonal antibody mumAb4D5 (Carter et al. Proc. Natl. Acad. Sci. USA 89:4285-4289), and the ASTR retains the ability to bind to HER2 and is conditionally active, e.g., binds better at a pH of 6.7 compared to a pH of 7.4. In some exemplary embodiments, the heavy chain variable region of the ASTR can include SEQ ID NO: 119. In some embodiments, the light chain variable region of the ASTR can include SEQ ID NO: 122.

[0100] It is contemplated herein that the immunoglobulin heavy chain variable region sequence and / or light chain variable region sequence may contain amino acid alterations (e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the heavy chain variable region and / or light chain variable region. In some embodiments, an ASTR containing one or more amino acid substitutions is provided. In any of the embodiments disclosed herein, the ASTR may contain an S to E mutation at position 119 of the heavy chain based on the numbering of SEQ ID NO: 119. In an exemplary embodiment, the ASTR may contain an A to D mutation at position 32 of the light chain based on the numbering of SEQ ID NO: 122. This mutation, when present in an anti-HER2 antibody, exhibited CAB activity. This mutation is in the FR, and antibodies containing this mutation exhibit CAB activity when used as antibodies (results not shown). This FR mutation can be combined with any of the other mutations in the heavy or light chain CDRs disclosed herein.

[0101] In an approach called "SUPERHUMANIATION™," as known in the art, human CDR sequences are selected from human germline genes based on the structural similarity of the human CDRs to the mouse antibody being humanized. Framework sequences can be obtained from public DNA databases or published references.

[0102] Other methods of reducing immunogenicity include "reshaping," "hyperchimerization," and "veneering / resurfacing." In some embodiments provided herein, the veneering / resurfacing approach is used to replace surface-accessible amino acid residues of a murine anti-HER2 antibody, or fragment thereof, used in an ASTR herein with amino acid residues more frequently found at the same positions in human antibodies. Any of these humanized antibodies can be used to generate a humanized ASTR.

[0103] In some embodiments, the ASTR of the anti-HER2 CAR provided herein is a single-chain Fv (scFv). In some embodiments, in the ASTR of the anti-HER2 CAR provided herein, the heavy chain is located at the N-terminus of the light chain of the ASTR of the CAR provided herein. In other embodiments, the light chain is located at the N-terminus of the heavy chain of the ASTR of the CAR provided herein. In any of the disclosed embodiments, the heavy and light chains can be separated by a linker, as discussed in more detail herein. In any of the disclosed embodiments, the heavy or light chain can be at the N-terminus of the CAR, typically at the C-terminus of another domain, such as a signal sequence or peptide.

[0104] Other antibody-based recognition domains (cAB VHH (camelized antibody variable domains) and humanized versions, IgNAR VH (shark antibody variable domains) and humanized versions, sdAb VH (single domain antibody variable domains) and "camelized" antibody variable domains are suitable for use in CARs and methods using the CARs of the disclosure. In some cases, T cell receptor (TCR)-based recognition domains, such as single chain TCRs (scTvs, VαVβ-containing single chain two-domain TCRs), are also suitable for use.

[0105] Certain embodiments of any aspect or embodiment herein involving a CAR include a CAR with an extracellular domain engineered to incorporate the endogenous TCR signaling complex and CD3Z signaling pathway. In one embodiment, a chimeric antigen receptor ASTR is fused to one of the endogenous TCR complex chains (e.g., TCR alpha, CD3E, etc.) to promote incorporation into the TCR complex and signaling through the endogenous CD3Z chain. In other embodiments, the CAR contains a first scFv or protein that binds to the TCR complex and a second scFv or protein that binds to a target antigen (e.g., a tumor antigen). In another embodiment, the TCR may be a single-chain TCR (scTv, a single-chain two-domain TCR containing VαVβ). Finally, scFvs can also be generated to recognize specific MHC / peptide complexes, thereby functioning as surrogate TCRs. Such peptide / MHC scFv binders can be used in many configurations similar to CARs.

[0106] In certain embodiments of any of the aspects provided herein that include an ASTR, the ASTR may be directed to an intermediate protein that links the ASTR to HER-2 expressed on HER-2-expressing cells in exemplary split-CAR constructs. The intermediate polypeptide or protein may be endogenously expressed or exogenously introduced, and may be natural, engineered, or chemically modified. In certain embodiments, the ASTR may be an anti-tag ASTR, in which at least one tagged intermediate, typically an antibody-tag conjugate, is included between the tag recognized by the ASTR and a target molecule, typically the HER2 protein target, expressed on HER2-expressing target cells. Thus, in such embodiments, the ASTR binds to a tag, which is conjugated to a CAB antibody provided herein that is directed against HER2 on target cells, such as cancer cells. Other split-CAR constructs are provided herein. Non-limiting examples of tags include fluorescein isothiocyanate (FITC), streptavidin, biotin, histidine, dinitrophenol, peridinin chlorophyll protein complex, green fluorescent protein, phycoerythrin (PE), horseradish peroxidase, palmitoylation, nitrosylation, alkaline phosphatase, glucose oxidase, and maltose binding protein. Thus, an ASTR includes a molecule that binds to a tag.

[0107] Substitution, insertion, and deletion variants In some embodiments, the ASTR of any of the CARs disclosed herein can include variants with one or more amino acid substitutions. Sites of interest for substitutional mutagenesis include the CDRs and framework regions (FRs). Conservative substitutions are shown in Table 1 under the heading "Conservative Substitutions." Additional modifications are provided in Table 1 under the heading "Exemplary Substitutions" and are further described below with reference to classes of amino acid side chains. Amino acid substitutions can be introduced into the subject ASTR and the products screened for desired activity, e.g., retained / improved antigen binding, conditional activity, and / or reduced immunogenicity. [Table 1]

[0108] Amino acids may be grouped according to common side chain properties: (1) hydrophobic: Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro, and (6) aromatic: Trp, Tyr, Phe. Non-conservative substitutions entail exchanging a member of one of these classes for another.

[0109] One type of substitutional variant involves substituting one or more CDR residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected will have altered (e.g., improved) certain biological properties (e.g., increased affinity, improved conditional activity or selectivity, reduced immunogenicity) compared to the parent antibody and / or will substantially retain certain biological properties of the parent antibody. In exemplary embodiments, the resulting variant will have improved conditional activity.

[0110] Alterations (e.g., substitutions) may be made in CDRs, for example, to improve antibody affinity. Such alterations may be made in CDR "hot spots," i.e., residues encoded by codons that undergo frequent mutation during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol., vol. 207, pp. 179-196, 2008), and / or in SDRs (a-CDRs), and the resulting variant VH or VL are tested for binding affinity. Affinity maturation by construction and reselection from secondary libraries is described, for example, in Hoogenboom et al. in Methods in Molecular Biology, vol. 178, pp. 1-37, 2001). In some affinity maturation embodiments, diversity is introduced into the variable genes selected for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then generated. The library is then screened to identify any antibody variants with the desired affinity. Another method for introducing diversity involves a CDR-directed approach, in which several CDR residues (e.g., 4-6 residues at a time) are randomized. CDR residues involved in antigen binding can be specifically identified, for example, using alanine scanning mutagenesis or modeling. CDR-HCDR3 and CDR-LCDR3 are often targeted.

[0111] In some embodiments, substitutions, insertions, or deletions can occur within one or more CDRs, as long as such changes do not substantially reduce the ability of ASTR to bind to HER2 antigen.For example, conservative changes (such as those provided herein) that do not substantially reduce binding affinity can be made in CDRs.Such changes can be outside the CDR "hotspots" or SDRs.In certain embodiments of the variant VH and VL sequences provided above, each CDR is unchanged or contains no more than one, two, or three amino acid substitutions.

[0112] Amino acid sequence modification(s) of the ASTR described herein are contemplated. For example, it may be desirable to improve the binding affinity and / or other biological properties of the ASTR. It is known that when a humanized antibody is produced by simply grafting only the CDRs of the VH and VL of an antibody derived from a non-human animal into the FRs of the VH and VL of a human antibody, the antigen-binding activity is reduced compared to that of the original antibody derived from the non-human animal. Some amino acid residues in the VH and VL of a non-human antibody, not only in the CDRs but also in the FRs, are thought to be directly or indirectly involved in antigen-binding activity. Therefore, replacing these amino acid residues with different amino acid residues from the FRs of the VH and VL of a human antibody will result in reduced binding activity. To solve this problem, in an antibody grafted with human CDRs, attempts must be made to identify amino acid residues in the amino acid sequences of the FRs of the VH and VL of the human antibody that are directly involved in binding to the antibody, or that interact with the amino acid residues in the CDRs, or that maintain the three-dimensional structure of the antibody and are directly involved in binding to the antigen. The decreased antigen-binding activity can be increased by substituting the specified amino acids with amino acid residues of the original antibody derived from a non-human animal.

[0113] Modifications and variations can be made to the structure of the antibodies of the present invention, and the DNA sequences that encode them, and still obtain functional molecules that encode CARs having ASTRs with desired properties.

[0114] When making changes to an amino acid sequence, the hydropathic index of amino acids may be taken into consideration. The importance of the hydropathic amino acid index in conferring interactive biological function to a protein is generally understood in the art. It is accepted that the relative hydrophobicity of amino acids contributes to the secondary structure of the resulting protein, which in turn defines the interaction of the protein with other molecules, such as enzymes, substrates, receptors, DNA, antibodies, antigens, etc. Each amino acid has been assigned a hydrophobicity index based on its hydrophobicity and charge properties, and these are isoleucine (+4.5), valine (+4.2), leucine (+3.8), phenylalanine (+2.8), cysteine / cystine (+2.5), methionine (+1.9), alanine (+1.8), glycine (-0.4), threonine (-0.7), serine (-0.8), tryptophan (-0.9), tyrosine (-1.3), proline (-1.6), histidine (-3.2), glutamic acid (-3.5), glutamine (-3.5), aspartic acid (-3.5), aspartate (-3.5), lysine (-3.9), and arginine (-4.5).

[0115] The present invention also encompasses function-conservative variants of the antibodies and antibody fragments of the present invention.

[0116] Two amino acid sequences are "substantially homologous" or "substantially similar" if more than 80%, more than 85%, or preferably more than 90%, or more preferably more than 95% or more than 98% of the amino acids are identical. In some embodiments, at least 90% or more than 95% of the amino acids are similar (functionally identical) over the entire length of the sequence. Similar or homologous sequences are preferably identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program, or any sequence comparison algorithm such as BLAST or FASTA.

[0117] For example, certain amino acids may be substituted by other amino acids in a protein structure without the expectation of appreciable loss of activity (see, e.g., Table 1 above). Because the interactive capabilities and properties of a protein define its biological functional activity, certain amino acid substitutions may be made in the protein sequence, and of course, its DNA coding sequence, and still obtain a protein with similar properties. Thus, it is contemplated that various changes may be made in the sequence of an antibody or antibody fragment of the present invention, or the corresponding DNA sequence encoding said antibody or antibody fragment, without appreciable loss of its biological activity.

[0118] It is known in the art that certain amino acids can be substituted by other amino acids with similar hydrophobicity indexes or scores and still result in proteins with similar biological activity, i.e., biologically functional equivalent proteins can still be obtained.

[0119] As outlined above, amino acid substitutions may be based on the relative similarity of the amino acid side-chain substituents, e.g., their hydrophobicity, hydrophilicity, charge, size, etc. Exemplary substitutions that take into consideration the various characteristics discussed above will be well known to those of skill in the art and include substitutions with the following pairs: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.

[0120] Glycosylation variants In some embodiments, the ASTRs provided herein have been altered to increase or decrease the extent to which the ASTR is glycosylated. Addition or deletion of glycosylation sites to antibodies, and the corresponding scFvs of ASTRs, can be conveniently accomplished by altering the amino acid sequence to create or remove one or more glycosylation sites.

[0121] Stoke In some embodiments, the CAR comprises a stalk located on the outside of the cell, in the portion of the CAR interposed between the ASTR and the transmembrane domain. In some embodiments, the stalk has at least 85, 90, 95, 96, 97, 98, 99, or 100% identity to the wild-type CD8 alpha stalk region (TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 16)), or has at least 85, 90, 95, 96, 97, 98, 99, or 100% identity to the wild-type CD28 stalk region (FCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 3)), or has at least 85, 90, 95, 96, 97, 98, 99, or 100% identity to the wild-type immunoglobulin heavy chain stalk region. In a CAR, the stalk used enables the antigen-specific targeting region, and typically the entire CAR, to retain increased binding to the target antigen.

[0122] The stalk region can have a length of about 4 amino acids to about 50 amino acids, for example, about 4 aa to about 10 aa, about 10 aa to about 15 aa, about 15 aa to about 20 aa, about 20 aa to about 25 aa, about 25 aa to about 30 aa, about 30 aa to about 40 aa, or about 40 aa to about 50 aa.

[0123] In some embodiments, the stalk of a CAR comprises at least one cysteine. For example, in some embodiments, the stalk may comprise the sequence Cys-Pro-Pro-Cys (SEQ ID NO: 4). If present, the cysteine ​​in the stalk of a first CAR is available to form a disulfide bond with the stalk of a second CAR.

[0124] The stalk can comprise an immunoglobulin hinge region amino acid sequence known in the art. See, e.g., Tan et al. (1990) Proc. Natl. Acad. Sci. USA 87:162, and Huck et al. (1986) Nucl. Acids Res. 14:1779. By way of non-limiting example, an immunoglobulin hinge region can comprise a domain having at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% sequence identity to at least 10, 15, 20, or all of a stretch of amino acids of any of the following amino acid sequences: CPPC (SEQ ID NO: 4), DKTHT (SEQ ID NO: 5), CPEPKSCDTPPPCPR (SEQ ID NO: 6) (see, e.g., Glaser et al. (see, e.g., E. et al. (2005) J. Biol. Chem. 280:41494), ELKTPLGDTTHT (SEQ ID NO: 7), KSCDKTHTCP (SEQ ID NO: 8), KCCVDCP (SEQ ID NO: 9), KYGPPCP (SEQ ID NO: 10), EPKSCDKTHTCPPCP (SEQ ID NO: 11) (human IgG1 hinge), ERKCCVECPPCP (SEQ ID NO: 12) (human IgG2 hinge), ELKTPLGDTTHTCPRCP (SEQ ID NO: 13) (human IgG3 hinge), SPNMVPHAHHAQ (SEQ ID NO: 14) (human IgG4 hinge), etc. The stalk may comprise a hinge region having the amino acid sequence of a human IgG1, IgG2, IgG3, or IgG4 hinge region. The stalk may comprise one or more amino acid substitutions and / or insertions and / or deletions compared to a wild-type (naturally occurring) hinge region. For example, His229 of the human IgG1 hinge can be substituted with Tyr such that the stalk comprises the sequence EPKSCDKTYTCPPCP (SEQ ID NO: 15) (see, e.g., Yan et al. (2012) J. Biol. Chem. 287:5891).

[0125] In some embodiments, the CAR comprises one or more additional extracellular polypeptide domains. Such additional extracellular polypeptide domains include, but are not limited to, affinity domains, which are polypeptides whose presence or activity can be detected (detectable markers), for example, by antibody assay or because they are polypeptides that generate a detectable signal, and recognition or removal domains, each of which is described in more detail in other sections herein. In some embodiments, such additional extracellular polypeptide domains are N-terminal to the stalk. In some embodiments, such additional extracellular polypeptide domains are C-terminal to the stalk. In some embodiments, such additional extracellular polypeptides are fused directly to the stalk. In some embodiments, a polypeptide linker connects the additional extracellular polypeptide to the stalk.

[0126] Transmembrane domain The CAR of the present disclosure may include a transmembrane domain for insertion into a eukaryotic cell membrane. The transmembrane domain may be interposed between the ASTR and the costimulatory domain. The transmembrane domain may be interposed between the stalk and the costimulatory domain so that the chimeric antigen receptor comprises, from the amino terminus (N-terminus) to the carboxyl terminus (C-terminus), an ASTR, a stalk, a transmembrane domain, and an activation domain.

[0127] Any transmembrane (TM) domain that provides for insertion of a polypeptide into the cell membrane of a eukaryotic (e.g., mammalian) cell is suitable for use in the aspects and embodiments disclosed herein.

[0128] In certain embodiments provided herein, the TM domain of any aspect provided herein, including a CAR, is selected from the group consisting of a CD8 alpha TM domain, a CD8 beta TM domain, a CD4 TM domain, a C3Z TM domain, a C134 TM domain, a CD7 TM domain, a CD8 TM domain, a CD28 TM domain, an alpha chain of the T cell receptor TM domain, a beta chain of the T cell receptor CD3 TM domain, a zeta chain of the T cell receptor TM domain, a CD3 epsilon TM domain, a CD45 TM domain, a CD5 TM domain, a CD9 TM domain, a CD16 TM domain, a CD22 TM domain, a CD33 TM domain, a CD37 TM domain, a CD64 TM domain, a CD80 TM domain, a CD86 TM domain, a CD137 TM domain, a CD154 TM domain, a KIRDS2 TM domain, a CD2 TM domain, a CD27 TM domain, an LFA-1 (CD11a, CD18) TM domain, an ICOS (CD278) TM domain, a GITR TM domain, a ... TM domain, CD40 TM domain, BAFFR TM domain, HVEM (LIGHTR) TM domain, SLAMF7 TM domain, NKp80 (KLRF1) TM domain, CD160 TM domain, CD19 TM domain, IL2R beta TM domain, IL2R gamma TM domain, IL7Ra TM domain, VLA1 TM domain, CD49a TM domain, ITGA1 TM domain, ITGA4 TM domain, ITGA6 TM domain, ITGAD TM domain, ITGAE TM domain, ITGAL TM domain, ITGAM TM domain, ITGAX TM domain, ITGB2 TM domain, ITGB7 TM domain, IA4 TM domain, CD49D TM domain, VLA-6 TM domain, CD49f TM domain, CD11d TM domain, CD103 TM domain, CD11a TM domain, CD11b TM domain, CD11c TM domain, ITGB1, CD29 TM domain, CD18 TM domain, TNFR2 TM domain, DNAM1 (CD226) TM domain, SLAMF4 (CD244, 2B4) TM domain, CD84 TM domain, CD96 (Tactile) TM domain, TM domain CEACAM1TM domain, CRTAM TM domain, Ly9 (CD229) TM domain, CD160 (BY55) TM domain, PSGL1 TM domain, CD100 (SEMA4D) TM domain, SLAMF6 (NTB-A, Ly108) TM domain, SLAM (SLAMF1, CD150, IPO-3) TM domain, BLAME (SLAMF8) TM domain, SELPLG (CD162) TM domain, LTBR TM domain, or PAG / Cbp TM domain. Exemplary embodiments of the CARs provided herein comprise a CD8 alpha TM domain or a CD28 TM domain. Non-limiting examples of TM domains suitable for any of the aspects or embodiments provided herein include domains having at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% sequence identity to at least 10, 15, 20, or all stretches of amino acids of any of the following TM domains or combined stalk and TM domains: a) CD8 alpha TM (SEQ ID NO: 17), b) CD8 beta TM (SEQ ID NO: 18), c) CD4 TM (SEQ ID NO: 19), d) CD3Z TM (SEQ ID NO: 20), e) CD28 TM (SEQ ID NO: 21), f) CD134 (OX40) TM: (SEQ ID NO: 22), g) CD7 TM (SEQ ID NO: 23), h) CD8 stalk and TM (SEQ ID NO: 24), and i) CD28 stalk and TM (SEQ ID NO: 25).

[0129] As a non-limiting example, a transmembrane domain of one embodiment of the present invention may have at least 80%, 90%, or 95% sequence identity to the transmembrane domain of SEQ ID NO: 17, or may have 100% sequence identity to any of the transmembrane domains from each of the following genes: CD8 alpha transmembrane domain, CD8 beta transmembrane domain, CD4 transmembrane domain, CD3 zeta transmembrane domain, CD28 transmembrane domain, CD134 transmembrane domain, or CD7 transmembrane domain.

[0130] Intracellular activation domain Upon activation, intracellular activation domains suitable for use in the CARs of the present disclosure typically induce the production of one or more cytokines, increase cell death, and / or enhance CD8 + T cells, CD4 + Increase the proliferation of T cells, NKT cells, γδT cells, and / or neutrophils. The activation domain may also be referred to herein as an activation domain. The activation domain may be used in the CAR provided herein.

[0131] In some embodiments, the intracellular activation domain comprises at least one (e.g., one, two, three, four, five, six, etc.) ITAM motifs described below. Intracellular activation domains for use in CARs can include several types of intracellular signaling domains of immune signaling receptors, including intracellular signaling proteins such as CD3, B7 family costimulatory molecules, and tumor necrosis factor receptor (TNFR) superfamily receptors; signaling domains used by NK and NKT cells, such as NKp30 (B7-H6), DAP12, NKG2D, NKp44, NKp46, DAP10, and CD3Z; and signaling domains of human immunoglobulin receptors containing immunoreceptor tyrosine-based activation motifs (ITAMs), such as FcR gamma (FCER1G), FcR beta (FCER1B), FcγRI, FcγRIIA, FcγRIIC, FcγRIIIA, and FcRL5. Thus, in certain embodiments of the CAR for any aspect of the present disclosure, the intracellular activation domain is a signaling domain derived from NKp30 (B7-H6), DAP12, NKG2D, NKp44, NKp46, DAP10, CD3z, FcγRI, FcγRIIA, FcγRIIC, FcγRIIIA, or FcRL5. These are referred to herein as the NKp30 (B7-H6) activation domain, the DAP12 activation domain, the NKG2D activation domain, the NKp44 activation domain, the NKp46 activation domain, the DAP10 activation domain, the CD3Z activation domain, the FcγRI activation domain, the FcγRIIA activation domain, the FcγRIIC activation domain, the FcγRIIIA activation domain, or the FcRL5 activation domain, respectively. In some embodiments, the intracellular activation domain comprises a DAP10 / CD28-type signaling chain. As non-limiting examples, the intracellular activation domain of any embodiment of the invention comprising the CAR can be a CD3Z activation domain, a CD3D activation domain, a CD3E activation domain, a CD3G activation domain, a CD79A activation domain, a DAP12 activation domain, a FCERlG activation domain, a DAP10 / CD28 activation domain, or a ZAP70 activation domain.In some embodiments, the intracellular activation domain of one aspect of the invention may have at least 80%, 90%, or 95% sequence identity, or may have 100% sequence identity, to a CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP12, FCERlG, FCGR2A, FCGR2C, DAP10 / CD28, or ZAP70 domain, as described below.

[0132] Intracellular activation domains suitable for use in the CARs of the present disclosure include immunoreceptor tyrosine-based activation motif (ITAM)-containing intracellular signaling polypeptides. The ITAM motif is YX1X2L / I, where X1 and X2 are independently any amino acid. In some embodiments, the intracellular activation domain of a CAR comprises 1, 2, 3, 4, or 5 ITAM motifs. In some embodiments, the ITAM motif is repeated twice in the intracellular activation domain, with the first and second instances of the ITAM motif separated from each other by 6 to 8 amino acids, e.g., (YX1X2L / I)(X3). n (YX1X2L / I), where n is an integer from 6 to 8, and each of the 6 to 8 X3 can be any amino acid. In some embodiments, the intracellular activation domain of the CAR comprises three ITAM motifs.

[0133] A suitable intracellular activation domain may be an ITAM motif-containing portion derived from a polypeptide containing an ITAM motif. For example, a suitable intracellular activation domain may be an ITAM motif-containing domain from any ITAM motif-containing protein. Thus, a suitable intracellular activation domain does not need to contain the entire sequence of the protein from which it is derived. Examples of suitable ITAM motif-containing polypeptides include, but are not limited to, CD3Z (CD3 zeta), CD3D (CD3 delta), CD3E (CD3 epsilon), CD3G (CD3 gamma), CD79A (antigen receptor complex-associated protein alpha chain), CD79B (antigen receptor complex-associated protein beta chain), DAP12, and FCERlG (Fc epsilon receptor I gamma chain).

[0134] In some embodiments, the intracellular activation domain is derived from the T cell surface glycoprotein CD3 zeta chain (CD3Z, also known as T cell receptor T3 zeta chain, CD247, CD3-ZETA, CD3H, CD3Q, T3Z, TCRZ, etc.). For example, a suitable intracellular activation domain can comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence, or to a stretch of about 100 to about 110 amino acids (aa), about 110 aa to about 115 aa, about 115 aa to about 120 aa, about 120 aa to about 130 aa, about 130 aa to about 140 aa, about 140 aa to about 150 aa, or about 150 aa to about 160 aa of either of the following amino acid sequences (two isoforms): MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQL[YNELNLGRREEYDVL]DKRRGRDPEMGGKPRRKNPQEGL[YNELQKDKMAEAYSEI]GMKGERRRGKGHDGL[YQGLSTATKDTYDAL]HMQALPPR(SEQ ID NO:26) or MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQL[YNELNLGRREEYDVL]DKRRGRDPEMGGKPQRRKNPQEGL[YNELQKDKMAEAYSEI]GMKGERRRGKGHDGL[YQGLSTATKDTYDAL]HMQALPPR (SEQ ID NO:27) (ITAM motifs are indicated in square brackets).

[0135] Similarly, a suitable intracellular activation domain polypeptide can comprise an ITAM motif-containing portion of the full-length CD3 zeta amino acid sequence. Thus, a suitable intracellular activation domain can comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least 10, 15, 20, or all amino acids in the following sequence, or to a stretch of about 100 to about 110 amino acids (aa), about 110 to about 115, about 115 to about 120, about 120 to about 130, about 130 to about 140, about 140 to about 150, or about 150 to about 160 aa of any of the following amino acid sequences: RVKFSRSADAPAYQQGQNQL[YNELNLGRREEYDVL]DKRRGRDPEMGGKPRRKNPQEGL[YNELQKDKMAEAYSEI]GMKGERRRGKGHDGL[YQGLSTATKDTYDAL]HMQALPPR (SEQ ID NO: 28), RVKFSRSADAPAYQQGQNQL[YNELNLGRREEYDVL]DKRRGRDPEMGGKPQRRKNPQEG L[YNELQKDKMAEAYSEI]GMKGERRRGKGHDGL[YQGLSTATKDTYDAL]HMQALPPR (SEQ ID NO: 29), NQL[YNELNLGRREEYDVL]DKR (SEQ ID NO: 30), EGL[YNELQKDKMAEAYSEI]GMK (SEQ ID NO: 31), or DGL[YQGLSTATKDTYDAL]HMQ (SEQ ID NO: 32) (ITAM motifs are shown in square brackets).

[0136] In some embodiments, the intracellular activation domain is derived from the T cell surface glycoprotein CD3 delta chain (also known as CD3D; CD3-delta; T3D; CD3 antigen, delta subunit; CD3 delta; CD3d antigen, delta polypeptide (TiT3 complex); OKT3, delta chain; T cell receptor T3 delta chain; T cell surface glycoprotein CD3 delta chain, etc.). Thus, a suitable intracellular activation domain may comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence, or to a stretch of about 100 to about 110 amino acids (aa), about 110 aa to about 115 aa, about 115 aa to about 120 aa, about 120 aa to about 130 aa, about 130 aa to about 140 aa, about 140 aa to about 150 aa, or about 150 aa to about 160 aa of any of the following amino acid sequences: MEHSTFLSGLVLATLLSQVSPFKIPIEELED RVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQV[YQPLRDRDDAQYSHL]GGNWARNK (SEQ ID NO: 33) or MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRTADTQALLRNDQV[YQPLRDRDDAQYSHL]GGNWARNK (SEQ ID NO: 34) (ITAM motifs are shown in square brackets).

[0137] Similarly, a suitable intracellular activation domain polypeptide can comprise an ITAM motif-containing portion of the full-length CD3 delta amino acid sequence. Thus, a suitable intracellular activation domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: DQV[YQPLRDRDDAQYSHL]GGN (SEQ ID NO: 35) (the ITAM motif is shown in square brackets).

[0138] In some embodiments, the intracellular activation domain is derived from T cell surface glycoprotein CD3 epsilon chain (also known as CD3e, T cell surface antigen T3 / Leu-4 epsilon chain, T cell surface glycoprotein CD3 epsilon chain, AI504783, CD3, CD3 epsilon, T3e, etc.). Thus, a suitable intracellular activation domain may be at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of a stretch of at least 10, 15, 20, or all amino acids in the following sequence, or a stretch of about 100 to about 110 amino acids (aa), about 110 aa to about 115 aa, about 115 aa to about 120 aa, about 120 aa to about 130 aa, about 130 aa to about 140 aa, about 140 aa to about 150 aa, or about 150 aa to about 160 aa in the following amino acid sequence: It may include a domain with sequence identity: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPD[YEPIRKGQRDLYSGL]NQRRI (SEQ ID NO: 36) (ITAM motif is shown in square brackets).

[0139] Similarly, a suitable intracellular activation domain polypeptide may comprise an ITAM motif-containing portion of the full-length CD3 epsilon amino acid sequence. Thus, a suitable intracellular activation domain may comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: NPD[YEPIRKGQRDLYSGL]NQR (SEQ ID NO: 37) (the ITAM motif is shown in square brackets).

[0140] In some embodiments, the intracellular activation domain is derived from the T cell surface glycoprotein CD3 gamma chain (also known as CD3G, T cell receptor T3 gamma chain, CD3-gamma, T3G, gamma polypeptide (TiT3 complex), etc.). Accordingly, a suitable intracellular activation domain may be at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 210%, 220%, 230%, 240%, 250%, 260%, 270%, 280%, 290%, 300%, 310%, 320%, 330%, 340%, 350%, 360%, 370%, 380%, 390%, 400%, 410%, 420%, 430%, 440%, 450%, 460%, 470%, 480%, 490%, 500%, 510%, 520%, 530%, 540%, 550%, 560%, 570%, 580%, 590%, 610%, 620%, 630%, 640%, 650%, 660%, 670%, 680%, 690%, 700%, 710%, 720%, 730%, 740%, 750%, 760%, 770%, 780%, 790%, 800%, 810%, 820%, 830%, 840%, 850%, 860%, 870%, 880%, 8 It may include a domain with 99%, or 100% sequence identity: MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQL[YQPLKDREDDQYSHL]QGNQLRRN (SEQ ID NO: 38) (ITAM motifs are shown in square brackets).

[0141] Similarly, a suitable intracellular activation domain polypeptide can comprise an ITAM motif-containing portion of the full-length CD3 gamma amino acid sequence. Thus, a suitable intracellular activation domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: DQL[YQPLKDREDDQYSHL]QGN (SEQ ID NO: 39) (the ITAM motif is shown in square brackets).

[0142] In some embodiments, the intracellular activation domain is derived from CD79A (also known as B-cell antigen receptor complex-associated protein alpha chain; CD79a antigen (immunoglobulin-associated alpha); MB-1 membrane glycoprotein; Ig-alpha; membrane-bound immunoglobulin-associated protein; surface IgM-associated protein, etc.). Accordingly, a suitable intracellular activation domain may be derived from at least 10, 15, 20, or all of the amino acids in the following sequence, or from about 100 to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 100 to about 110 amino acids (aa) of any of the following amino acid sequences: For 50 aa to about 160 aa, the domain may include at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity: MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNG TLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENL[YEGLNLDDCSMYEDI]SRGLQGTYQDVGSLNIGDVQLEKP (SEQ ID NO: 40) or MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNEPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENL[YEGLNLDDCSMYEDI]SRGLQGTYQDVGSLNIGDVQLEKP (SEQ ID NO: 41) (ITAM motif is shown in square brackets).

[0143] Similarly, a suitable intracellular activation domain polypeptide can comprise an ITAM motif-containing portion of the full-length CD79A amino acid sequence. Thus, a suitable intracellular activation domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: ENL[YEGLNLDDCSMYEDI]SRG (SEQ ID NO: 42) (the ITAM motif is shown in square brackets).

[0144] In some embodiments, the intracellular activation domain is derived from DAP12 (also known as TYROBP; TYRO protein tyrosine kinase binding protein; KARAP; PLOSL; DNAX activating protein 12; KAR-associated protein; TYRO protein tyrosine kinase binding protein; killer activating receptor-associated protein; killer activating receptor-associated protein, etc.). For example, a suitable intracellular activation domain may be derived from at least 10, 15, 20, or all of the amino acids in the following sequence, or from a stretch of about 100 to about 110 amino acids (aa), about 110 aa to about 115 aa, about 115 aa to about 120 aa, about 120 aa to about 130 aa, about 130 aa to about 140 aa, about 140 aa to about 150 aa, or about 100 to about 110 amino acids (aa) of any of the following amino acid sequences (four isoforms): It may comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity over 50 aa to about 160 aa: MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESP[YQELQGQRS DVYSDL]NTQRPYYK (SEQ ID NO: 43), MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEATRKQRITETESP[YQELQGQRSDVYSDL]NTQ (SEQ ID NO: 44), MGGLEPCSRLLLLPLLLAVSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESP[YQELQGQRSDVYSDL]NTQRPYYK (SEQ ID NO: 45), or MGGLEPCSRLLLLPLLLAVSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEATRKQRITETESP[YQELQGQRSDVYSDL]NTQRPYYK (SEQ ID NO: 46) (ITAM motifs are shown in square brackets).

[0145] Similarly, a suitable intracellular activation domain polypeptide can comprise an ITAM motif-containing portion of the full-length DAP12 amino acid sequence. Thus, a suitable intracellular activation domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: ESP[YQELQGQRSDVYSDL]NTQ (SEQ ID NO:47) (the ITAM motif is shown in square brackets).

[0146] In some embodiments, the intracellular activation domain is derived from FCERlG (also known as FCRG; Fc epsilon receptor I gamma chain; Fc receptor gamma chain; fc-epsilon RI-gamma; fcR gamma; fceRI gamma; high affinity immunoglobulin epsilon receptor subunit gamma; immunoglobulin E receptor, high affinity, gamma chain, etc.). For example, a suitable intracellular activation domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence, or to a stretch of about 50 to about 60 amino acids (aa), about 60 to about 70 aa, about 70 to about 80 aa, or about 80 to about 88 aa of the following amino acid sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGV[YTGLSTRNQETYETL]KHEKPPQ (SEQ ID NO: 48) (ITAM motifs are shown in square brackets).

[0147] Similarly, a suitable intracellular activation domain polypeptide can comprise an ITAM motif-containing portion of the full-length FCER1G amino acid sequence. Thus, a suitable intracellular activation domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: DGV[YTGLSTRNQETYETL]KHE (SEQ ID NO:49) (the ITAM motif is shown in square brackets).

[0148] Intracellular activation domains suitable for use in the CARs of the present disclosure include DAP10 / CD28-type signaling chains. An example of a DAP10 signaling chain is amino acid SEQ ID NO: 50. In some embodiments, suitable intracellular activation domains include domains having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in SEQ ID NO: 50.

[0149] An example of a CD28 signaling chain is the amino acid sequence of SEQ ID NO: 51. In some embodiments, a suitable intracellular domain comprises a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids of SEQ ID NO: 51.

[0150] Intracellular activation domains suitable for use in the CARs of the present disclosure include ZAP70 polypeptides. For example, suitable intracellular activation domains can include domains having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence, or to a contiguous stretch of about 300 to about 400 amino acids, about 400 to about 500 amino acids, or about 500 to 619 amino acids of SEQ ID NO:52:

[0151] Split CAR In exemplary embodiments, the CAR is expressed as a single full-length fusion polypeptide comprising the ASTR (i.e., ligand-binding domain), the transmembrane domain, and the intracellular activation domain. In other embodiments, the ASTR domain, the transmembrane domain, and the activation domain are non-covalently connected in a split-CAR design. In some embodiments, the CAR is expressed as two non-covalently associated polypeptides. In some embodiments, the CAR is expressed as three or more non-covalently associated polypeptides.

[0152] In some embodiments of the split CAR, the ASTR that recognizes HER2 is not covalently linked to the transmembrane domain. In some embodiments, the ASTR that recognizes HER2 is fused to a polypeptide interaction domain that can associate with a cognate interaction domain in the extracellular domain of a fusion polypeptide that includes a transmembrane domain and an intracellular activation domain. In some embodiments, the interaction between these fusion polypeptides is direct. In some embodiments, the interaction is mediated by a leucine zipper motif. In some embodiments, the interaction between these two polypeptides is mediated by a third polypeptide or small molecule.

[0153] In some embodiments of the split CAR, the first polypeptide comprises an ASTR and a transmembrane domain, and the second polypeptide comprises an intracellular activation domain. In some embodiments, the first polypeptide comprises an intracellular domain that lacks a covalently linked intracellular activation domain. In some embodiments, the second polypeptide is membrane-bound. In some embodiments, the second polypeptide is diffused in the cytoplasm. In some embodiments, the first and second polypeptides are non-covalently associated via their transmembrane domains. In some embodiments, the second polypeptide is diffused in the cytoplasm and associated with the intracellular domain of the first polypeptide.

[0154] Regulatory domain The regulatory domain can change the effect of the intracellular activation domain in CAR, including strengthening or weakening the downstream effect of the activation domain or changing the nature of the response.One, two, three, four or more different regulatory domains, or one, two, three, four or more copies of the same regulatory domain can be included in the CAR provided herein.The regulatory domain suitable for use in the CAR of the present disclosure comprises a costimulatory domain, which is an optional CAR domain included in certain exemplary CAR embodiments provided herein. A regulatory domain suitable for inclusion in a CAR can have a length of about 30 to about 70 amino acids (aa), for example, a regulatory domain can have a length of about 30 to about 35 aa, about 35 to about 40 aa, about 40 to about 45 aa, about 45 to about 50 aa, about 50 to about 55 aa, about 55 to about 60 aa, about 60 to about 65 aa, or about 65 to about 70 aa. In other cases, a regulatory domain can have a length of about 70 to about 100 aa, about 100 to about 200 aa, or more than 200 aa.

[0155] The costimulatory domain typically enhances and / or alters the nature of the response to the activation domain. Costimulatory domains suitable for use in the CARs of the present disclosure are typically receptor-derived polypeptides. In some embodiments, the costimulatory domain homodimerizes. A costimulatory domain of interest may be the intracellular portion of a transmembrane protein (i.e., the costimulatory domain may be derived from a transmembrane protein). In some embodiments, any of the CARs provided herein may comprise a costimulatory domain. In some embodiments, the costimulatory domain may be a ligand that specifically binds to 4-1BB (CD137), B7-HCDR3, CD2, CD7, CD27, CD28, CD28 deleted for Lck binding (ICΔ), CD30, CD40, ICOS, OX40, BTLA, GITR, HVEM, ICAM-1, LFA-1 (CD11a / CD18), LIGHT, NKG2C, B7-H3, or CD83. BAND, CDS, BAFFR, SLAMf7, NKP80 (KLRF1), CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7Ra, ITGA4, ITGA6, ITGAD, ITGAE, ITGAL, ITGAM, ITGAX, ITGB1, ITGB2, ITGB7, IA4, VLA1, VLA-6, C49f, CD11a, CD11b, CD11c, CD11d, CD1 8, CD19, CD29, CD49a, CD49D, CD69, CD84, CD96(Tactile), CD103, CD160(BY55), CRLF2, CSF2RB, CSF2RA, CSF3 R, EPOR, LFA-1, TNFR2, TRANCE / RANKL, DNAM1(CD226), FCGRA2, GHR, SLAMF4(C244, 2B4), CEACAM1, CRTAM, Ly9( CD229), PD-1, PSGL1, C100 (SEMA4D), SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, PAG / Cbp, SLP-76, TILR2, TILR4, TILR7, TILR9, Fc receptor gamma chain, Fc receptor epsilon chain, IFNAR1IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2RA, IL2RB, IL2RG, IL3RA, IL4R, IL5RA, IL6R, IL6ST, IL9R, IL10RA, I L10RB, IL11RA, IL12RB1, IL12RB2, IL13RA1, IL13RA2, IL15RA, IL17RA, IL17RB, IL17RC, IL17RD, IL17RE, IL18R1, IL18RAP, IL20RA, IL20RB , IL21R, IL22RA1, IL23R, IL27RA, IL31RA, LEPR, LIFR, LMP1, MPL, MYD88, OSMR, or PRLR, or a functional variant and / or fragment thereof, or a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, 25, 30, 35, 40, 45 or 50 amino acids or a costimulatory domain of LMP1, MPL, MYD88, OSMR, or PRLR, or a functional variant and / or fragment thereof.

[0156] A costimulatory domain suitable for inclusion in a CAR can have a length of about 30 to about 70 amino acids (aa), for example, a costimulatory domain can have a length of about 30 to about 35 aa, about 35 to about 40 aa, about 40 to about 45 aa, about 45 to about 50 aa, about 50 to about 55 aa, about 55 to about 60 aa, about 60 to about 65 aa, or about 65 to about 70 aa. In other cases, a costimulatory domain can have a length of about 70 to about 100 aa, about 100 to about 200 aa, or more than 200 aa.

[0157] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein CD137 (also known as TNFRSF9; CD137; 4-1BB; CDwLCDR37; ILA, etc.). For example, a suitable costimulatory domain may include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in SEQ ID NO:53. In some of these embodiments, the costimulatory domain has a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, about 45 aa to about 50 aa, about 50 aa to about 55 aa, about 55 aa to about 60 aa, about 60 aa to about 65 aa, or about 65 aa to about 70 aa.

[0158] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein CD28 (also known as Tp44). For example, a suitable costimulatory domain may include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least 10, 15, 20, or all stretches of amino acids in SEQ ID NO: 54. In some of these embodiments, the costimulatory domain has a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, about 45 aa to about 50 aa, about 50 aa to about 55 aa, about 55 aa to about 60 aa, about 60 aa to about 65 aa, or about 65 aa to about 70 aa.

[0159] In some embodiments, the costimulatory domain is derived from the intracellular portion of the Lck-binding-deficient transmembrane protein CD28(ICΔ). For example, a suitable costimulatory domain may comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least 10, 15, 20, or all stretches of amino acids in SEQ ID NO: 55. In some of these embodiments, the costimulatory domain has a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, about 45 aa to about 50 aa, about 50 aa to about 55 aa, about 55 aa to about 60 aa, about 60 aa to about 65 aa, or about 65 aa to about 70 aa.

[0160] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein ICOS (also known as AILIM, CD278, and CVID1). For example, a suitable costimulatory domain may include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least 10, 15, 20, or all stretches of amino acids in SEQ ID NO: 56. In some of these embodiments, the costimulatory domain has a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, about 45 aa to about 50 aa, about 50 aa to about 55 aa, about 55 aa to about 60 aa, about 60 aa to about 65 aa, or about 65 aa to about 70 aa.

[0161] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein OX40 (also known as TNFRSF4, RP5-902P8.3, ACT35, CD134, OX-40, TXGPlL). OX40 contains a p85 PI3K-binding motif at residues 34-57 and a TRAF-binding motif at residues 76-102, each of SEQ ID NO: 84 (Table 1). In some embodiments, the costimulatory domain can include the p85 PI3K-binding motif of OX40. In some embodiments, the costimulatory domain can include the TRAF-binding motif of OX40. The lysines corresponding to amino acids 17 and 41 of SEQ ID NO: 84 are potential negative regulatory sites that function as part of a ubiquitin-targeting motif. In some embodiments, one or both of these lysines in the costimulatory domain of OX40 are mutated to arginine or another amino acid. In some embodiments, a suitable costimulatory domain may comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least 10, 15, 20, or all stretches of amino acids in SEQ ID NO: 57. In some of these embodiments, the costimulatory domain has a length of about 20 aa to about 25 aa, about 25 aa to about 30 aa, 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, or about 45 aa to about 50 aa. In exemplary embodiments, the costimulatory domain has a length of about 20 aa to about 50 aa, e.g., 20 aa to 45 aa, or 20 aa to 42 aa.

[0162] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein CD27 (also known as S152, T14, TNFRSF7, and Tp55). For example, a suitable costimulatory domain may include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least 10, 15, 20, or all stretches of amino acids in SEQ ID NO: 58. In some of these embodiments, the costimulatory domain has a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, or about 45 aa to about 50 aa.

[0163] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein BTLA (also known as BTLA1 and CD272). For example, a suitable costimulatory domain can include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in SEQ ID NO:59.

[0164] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein CD30 (also known as TNFRSF8, DlS166E, and Ki-1). For example, a suitable costimulatory domain may comprise a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of about 100 to about 110 amino acids (aa), about 110 to about 115 aa, about 115 to about 120 aa, about 120 to about 130 aa, about 130 to about 140 aa, about 140 to about 150 aa, about 150 to about 160 aa, or about 160 to about 185 aa of SEQ ID NO:60.

[0165] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein GITR (also known as TNFRSF18, RP5-902P8.2, AITR, CD357, and GITR-D). For example, a suitable costimulatory domain may include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in SEQ ID NO:61. In some of these embodiments, the costimulatory domain has a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, about 45 aa to about 50 aa, about 50 aa to about 55 aa, about 55 aa to about 60 aa, about 60 aa to about 65 aa, or about 65 aa to about 70 aa.

[0166] In some embodiments, the costimulatory domain is derived from the intracellular portion of the transmembrane protein HVEM (also known as TNFRSF14, RP3-395M20.6, ATAR, CD270, HVEA, HVEM, LIGHTR, and TR2). For example, a suitable costimulatory domain may include a domain having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in SEQ ID NO:62. In some of these embodiments, the costimulatory domains of both the first and second polypeptides have a length of about 30 aa to about 35 aa, about 35 aa to about 40 aa, about 40 aa to about 45 aa, about 45 aa to about 50 aa, about 50 aa to about 55 aa, about 55 aa to about 60 aa, about 60 aa to about 65 aa, or about 65 aa to about 70 aa.

[0167] Linker In some embodiments, the CAR comprises a linker between any two adjacent domains. For example, the linker may be between the transmembrane domain and the first costimulatory domain. As another example, the ASTR may be an antibody, and the linker may be between the heavy chain and the light chain. As another example, the linker may be between the ASTR, the transmembrane domain, and the costimulatory domain. As another example, the linker may be between the costimulatory domain and the intracellular activation domain of the second polypeptide. As another example, the linker may be between the ASTR and the intracellular signaling domain.

[0168] The linker peptide can have any of a variety of amino acid sequences. Proteins can be linked by a spacer peptide, which is generally flexible in nature, although other chemical bonds are not excluded. The linker can be a peptide about 1 to about 100 amino acids in length, or about 1 to about 25 amino acids in length. These linkers can be produced by linking proteins using oligonucleotides encoding synthetic linkers. Peptide linkers with some degree of flexibility can be used. The linking peptide can have virtually any amino acid sequence, provided that suitable linkers generally have sequences that result in flexible peptides. The use of small amino acids such as glycine and alanine facilitates the formation of flexible peptides. The creation of such sequences is routine for those skilled in the art.

[0169] Suitable linkers can be readily selected and may be of any of different suitable lengths, such as from 1 amino acid (e.g., Gly) to 50 amino acids, 2 to 35 amino acids, 5 to 30 amino acids, 15 to 30 amino acids, 2 to 15 amino acids, 3 to 12 amino acids, 4 to 10 amino acids, 5 to 9 amino acids, 6 to 8 amino acids, or 7 to 8 amino acids, or may be 1, 2, 3, 4, 5, 6, or 7 amino acids.

[0170] An exemplary flexible linker is a glycine polymer (G) n , glycine-serine polymers (e.g., (GS) n, G.S.G.S.G.S. n ,GGGS n , and GGGGS n Including, n (wherein n is an integer of at least 1), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are of interest because both of these amino acids are relatively unstructured and can therefore function as neutral tethers between components. Glycine polymers are of particular interest because glycine has access to much more phi-psi space than alanine and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). Exemplary flexible linkers include, but are not limited to, GSTSGSGKPGSGEGS (SEQ ID NO: 1), RTGSTSGSGKPGSGEGS (SEQ ID NO: 249), GSTSGSGKPGSGEGSTKG (SEQ ID NO: 144), GGGGSGGGGSGGGGGS (SEQ ID NO: 63), GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 64), GGGGSGGGSGGGGS (SEQ ID NO: 65), GGSG (SEQ ID NO: 66), GGSGG (SEQ ID NO: 67), GSGSG (SEQ ID NO: 68), GSGGG (SEQ ID NO: 69), GGGSG (SEQ ID NO: 70), GSSSG (SEQ ID NO: 71), GS, GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 152), and the like. In certain exemplary embodiments, the linker between the heavy chain variable region of ASTR and the antibody light chain variable region is 5-50, 5-30, 5-20, 10-20, 10-30, 15-30, or 5-15 amino acids and includes GGGS repeats. Those skilled in the art will recognize that the design of peptides conjugated to any of the above elements can include linkers that are fully or partially flexible, such that the linker can include flexible linkers as well as one or more moieties that confer a less flexible structure.

[0171] nucleic acid Nucleic acids are disclosed herein for use in various methods.In addition, the isolated nucleic acid encoding any of the CARs disclosed herein is a separate aspect and embodiment provided herein.For example, in one aspect, the isolated nucleic acid encoding a chimeric antigen receptor (CAR) for binding HER2 is provided herein, wherein the CAR is a) an antigen-specific targeting region (ASTR) that specifically binds to the HER2 protein; b) a transmembrane domain, and c) an intracellular activation domain, wherein the transmembrane domain is located between the ASTR and the intracellular activation domain, and the ASTR comprises a heavy chain variable region comprising three complementarity determining regions (CDRs), the CDRs having the sequences HCDR1, HCDR2, and HCDR3, wherein the HCDR1 sequence is GFNIKDTYIH (SEQ ID NO: 131), the HCDR2 sequence is X1IYPTNGYTX2YADSVKG (SEQ ID NO: 137), and the HCDR3 sequence is WGGDGFYAMDY (SEQ ID NO: 133), and ASTR comprises a light chain variable region comprising three CDRs having the sequences LCDR1, LCDR2, and LCDR3, wherein the LCDR1 sequence is RASQDVNTX3VA (SEQ ID NO: 142), the LCDR2 sequence is SASFLYS (SEQ ID NO: 135), and the LCDR3 sequence is QQX4YTTPPT (SEQ ID NO: 143), wherein X1 is R or K, X2 is R or E, X3 is A or D, and X4 is H, D, or E.

[0172] Many other nucleic acid aspects and embodiments are contemplated for encoding any of the CARs provided herein.Further non-limiting examples are provided, for example, in the exemplary embodiment section of this specification.Those skilled in the art will understand that the nucleic acid encoding any of the CAR polypeptides provided herein can be designed using genetic code.

[0173] In any of the embodiments disclosed herein, nucleic acids encoding CARs, including but not limited to the ASTRs of such CARs, can be optimized for expression in human cells through nucleic acid sequence modifications, including codon optimization, and removal of splice donor and acceptor sites. In exemplary embodiments herein, a benchmark antibody heavy chain variable region (SEQ ID NO: 119) is encoded by nucleic acid sequence SEQ ID NO: 145, where HCDR1 is encoded by nucleotides 76-105, HCDR2 is encoded by nucleotides 148-198, and HCDR3 is encoded by nucleotides 295-327. In exemplary embodiments herein, the antibody heavy chain variable region is mutant R050K (SEQ ID NO: 124) and encoded by nucleic acid sequence SEQ ID NO: 146. In exemplary embodiments herein, the antibody heavy chain variable region is mutant R059E (SEQ ID NO: 123) and encoded by nucleic acid sequence SEQ ID NO: 147. In exemplary embodiments herein, the antibody heavy chain variable region has the mutant R050K / R059E (SEQ ID NO: 125). In exemplary embodiments herein, the benchmark antibody light chain variable region (SEQ ID NO: 122) is encoded by the nucleic acid sequence SEQ ID NO: 148, where LCDR1 is encoded by nucleotides 70-102, LCDR2 is encoded by nucleotides 148-168, and LCDR3 is encoded by nucleotides 265-291. In exemplary embodiments herein, the antibody light chain variable region is variant A032D (SEQ ID NO: 128) and is encoded by the nucleic acid sequence SEQ ID NO: 149. In exemplary embodiments herein, the antibody light chain variable region is variant H091D (SEQ ID NO: 127) and is encoded by the nucleic acid sequence SEQ ID NO: 150. In exemplary embodiments herein, the antibody light chain variable region is variant H091E (SEQ ID NO: 126) and is encoded by the nucleic acid sequence SEQ ID NO: 151. In exemplary embodiments herein, the antibody heavy chain variable region has variant A032 / H091D (SEQ ID NO: 129). In an exemplary embodiment herein, the antibody heavy chain variable region has the mutation A032 / H091E (SEQ ID NO: 130).In an exemplary embodiment, for the nucleic acids encoding the heavy chain variable region variants provided herein above, the light chain variable region is SEQ ID NO: 148. In an exemplary embodiment, for the nucleic acids encoding the light chain variable region variants provided herein above, the heavy chain variable region is SEQ ID NO: 145.

[0174] In some embodiments, the nucleic acid is DNA, such as a recombinant expression vector encoding any of the anti-HER2 CARs, and in exemplary embodiments, a CAB-CAR provided herein, for example, in isolated form or as all or part of the genome of a T cell or NK cell. In some embodiments, the nucleic acid is RNA encoding any of the anti-HER2 CARs, and in exemplary embodiments, a CAB-CAR provided herein, for example, in isolated form, or as a retroviral genome, or as an expressed transcript in a packaging cell line, T cell, or NK. In some embodiments, the nucleic acid may be isolated. As used herein, the term "isolated" means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring). For example, a naturally occurring polynucleotide present in a living animal, or in other embodiments, a polypeptide, is not isolated, but the same polynucleotide or polypeptide separated from some or all of the coexisting materials in the natural system is isolated. Such a polynucleotide may be part of a vector, and / or such a polynucleotide or polypeptide may be part of a composition and still be isolated in that such a vector or composition is not part of its natural environment. For example, the isolated nucleic acid may be part of an expression vector, or in an exemplary embodiment, may be a replication-incompetent recombinant retroviral particle.

[0175] The nucleotide sequence encoding the polypeptide can be, for example, a CAR of the present disclosure, and can be operably linked to transcriptional control elements, such as a promoter and enhancer.

[0176] In such a construct, the transcriptional control element induces and / or regulates the expression of an operably linked polypeptide (e.g., CAR). For example, for expression in eukaryotic cells, such as packaging cell lines for producing recombinant retroviral particles, suitable promoters include, but are not limited to, light and / or heavy chain immunoglobulin gene promoters and enhancer elements; cytomegalovirus immediate early promoter; herpes simplex virus thymidine kinase promoter; early and late SV40 promoter; promoters present in long terminal repeats from retroviruses; mouse metallothionein-I promoter; and various tissue-specific promoters known in the art. In some embodiments, the promoter is a CD8 cell-specific promoter, a CD4 cell-specific promoter, a neutrophil-specific promoter, or an NK cell-specific promoter. The promoter may be constitutively active or inducible in target cells. For example, the CD4 gene promoter may be used. See, for example, Salmon et al. (1993) Proc. Natl. Acad. Sci. USA 90:7739 and Marodon et al. (2003) Blood 101:3416. As another example, the CD8 gene promoter can be used. For example, for expression in T cells, the promoter can be the EF1a promoter or the murine stem cell virus (MSCV) promoter (Jones et al., Human Gene Therapy (2009) 20:630-40). In an exemplary embodiment, the promoter is the T cell-specific CD3 zeta promoter. NK cell-specific expression can be achieved by using the Neri (p46) promoter. See, for example, Eckelhart et al. (2011) Blood 117:1565. Suitable reversible promoters, including reversibly inducible promoters, are known in the art. Such reversible promoters can be isolated and derived from many organisms, including eukaryotes and prokaryotes.Modification of a reversible promoter from a first organism for use in a second organism, such as a first prokaryote and a second eukaryote, or a first eukaryote and a second prokaryote, is well known in the art. Such reversible promoters and systems based on such reversible promoters but also containing additional regulatory proteins include, but are not limited to, alcohol-regulated promoters (e.g., alcohol dehydrogenase I (alcA) gene promoter, promoters responsive to alcohol transactivator protein (AlcR), etc.), tetracycline-regulated promoters (e.g., promoter systems including TetActivators, TetON, TetOFF, etc.), steroid-regulated promoters (e.g., rat glucocorticoid receptor promoter system, human estrogen receptor promoter system, retinoid promoter system, steroid-regulated promoters, etc.), and the like. Examples of suitable promoters include: a thyroid gland promoter system, an ecdysone promoter system, a mifepristone promoter system, and the like), metal-regulated promoters (e.g., a metallothionein promoter system, and the like), pathogenesis-related regulated promoters (e.g., salicylic acid-regulated promoters, ethylene-regulated promoters, benzothiadiazole-regulated promoters, and the like), temperature-regulated promoters (e.g., heat shock-inducible promoters (e.g., HSP-70, HSP-90, soybean heat shock promoter, and the like), light-regulated promoters, synthetic inducible promoters, and the like. Further discussion of suitable promoters for use in various methods and in separate embodiments is provided herein.

[0177] The isolated nucleotide sequence encoding the CAR of the present disclosure can be present in a eukaryotic cell expression vector.The expression vector can include a selectable marker, a replication origin, and other features that provide replication and / or maintenance of the vector and expression of the transgene.For example, the expression vector typically includes a promoter operably linked to the transgene.Suitable expression vectors are known in the art and include, for example, plasmids and viral vectors.In some embodiments, the expression vector is a recombinant retroviral particle, as disclosed in detail herein.

[0178] Various aspects and embodiments, including polynucleotides, nucleic acid sequences, and / or transcription units, and / or vectors comprising them, further comprise one or more of a Kozak-type sequence (also referred to herein as a Kozak-related sequence), a woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and a double or triple stop codon, wherein the one or more stop codons of the double or triple stop codon define the end of reading from at least one of the one or more transcription units. In certain embodiments, the polynucleotides, nucleic acid sequences, and / or transcription units, and / or vectors comprising them, further comprise a Kozak-type sequence having a 5' nucleotide within 10 nucleotides upstream of the start codon of at least one of the one or more transcription units. Kozak determined the Kozak consensus sequence (GCC) GCCRCCATG (SEQ ID NO: 107) for 699 vertebrate mRNAs, where R is a purine (A or G) (Kozak. Nucleic Acids Res. 1987 Oct 26;15(20):8125-48). In one embodiment, the Kozak-type sequence is or includes CCACCAT / UG(G) (SEQ ID NO: 108), CCGCCAT / UG(G) (SEQ ID NO: 109), GCCGCCGCCAT / UG(G) (SEQ ID NO: 110), or GCCGCCACCAT / UG(G) (SEQ ID NO: 111) (nucleotides in parentheses represent optional nucleotides, and nucleotides separated by slashes indicate different possible nucleotides at that position depending, for example, on whether the nucleic acid is DNA or RNA. In these embodiments that include an AU / TG start codon, In certain exemplary embodiments, the -3 and +4 nucleotides are identical, e.g., the -3 and +4 nucleotides may be G. In another embodiment, the Kozak sequence comprises an A or G at the third position upstream of the ATG, which is the start codon. In another embodiment, the Kozak sequence comprises an A or G at the third position upstream of the AUG, which is the start codon. In an exemplary embodiment, the Kozak sequence is (GCC)GCCRCCATG (SEQ ID NO: 107), where R is a purine (A or G).In an exemplary embodiment, the Kozak sequence is GCCGCCACCAUG (SEQ ID NO: 112). In another embodiment, which may be combined with the preceding embodiment including a Kozak sequence and / or the following embodiment including a triple stop codon, the polynucleotide includes a WPRE element. WPREs have been characterized in the art (see, e.g., Higashimoto et al., Gene Ther. 2007;14:1298) and are as exemplified in WO2019 / 055946. In some embodiments, the WPRE element is located 3' of the stop codon of one or more transcription units and 5' of the 3'LTR of the polynucleotide. In another embodiment, which may be combined with one or both of the preceding embodiments (i.e., embodiments in which the polynucleotide comprises a Kozak sequence and / or embodiments in which the polynucleotide comprises a WPRE), one or more transcription units terminate with one or more stop codons of a double stop codon or a triple stop codon, where a double stop codon comprises a first stop codon in a first reading frame and a second stop codon in a second reading frame, or a first stop codon in-frame with the second stop codon, and a triple stop codon comprises a first stop codon in a first reading frame, a second stop codon in a second reading frame, and a third stop codon in a third reading frame, or a first stop codon in-frame with the second stop codon and the third stop codon.

[0179] A triple stop codon herein includes three stop codons, one in each reading frame, within 10 nucleotides of each other, preferably with an overlapping sequence, or three stop codons in the same reading frame, preferably in consecutive codons. A double stop codon means two stop codons, each in a different reading frame, within 10 nucleotides of each other, preferably with an overlapping sequence, or two stop codons in the same reading frame, preferably in consecutive codons.

[0180] In some of the methods and compositions disclosed herein, the introduction of DNA into PBMCs, B cells, T cells, and / or NK cells, and optionally, the integration of the DNA into the host cell genome, is performed using methods that do not utilize replication-incompetent recombinant retroviral particles. For example, by way of non-limiting example, adenovirus, adeno-associated virus, or other viral vectors, such as those derived from herpes simplex virus-1, may be utilized.

[0181] In some embodiments, the methods provided herein may include transfecting target cells with a non-viral vector. In any of the embodiments disclosed herein, non-viral vectors can be used to transfect target cells. Non-viral vectors, including naked DNA, can be introduced into target cells, such as PBMCs, B cells, T cells, and / or NK cells, using methods such as electroporation, nucleofection, liposome formulations, lipids, dendrimers, cationic polymers such as poly(ethylenimine) (PEI) and poly(l-lysine) (PLL), nanoparticles, cell membrane-permeable peptides, microinjection, and / or non-integrating lentiviral vectors. In some embodiments, DNA can be introduced into target cells, such as PBMCs, B cells, T cells, and / or NK cells, in a complex with liposomes and protamine. Other methods for transfecting T cells and / or NK cells ex vivo that can be used in embodiments of the methods provided herein are known in the art (see, e.g., Morgan and Boyerinas, Biomedicines. 2016 Apr 20;4(2).pii:E9, which is incorporated herein by reference in its entirety).

[0182] In some embodiments of the methods provided herein, DNA can be integrated into the genome using a transposon-based carrier system by co-transfection, co-nucleofection, or co-electroporation of target DNA as a plasmid containing transposon ITR fragments at the 5' and 3' ends of the gene of interest and DNA or mRNA or protein or a site-specific serine recombinase, such as phiC31, which integrates the gene of interest into a pseudo attP site in the human genome; in this case, the DNA vector contains a 34-40 bp attB site, which is the recognition sequence for the recombinase enzyme (Bhaskar Thyagarajan et al. Site-Specific Genomic Integration in Mammalian Cells Mediated by Phage phiC31 Integrase, Mol Cell Biol. 2001 Jun;21(12):3926-3934), and is co-transfected with the recombinase. In the case of T cells and / or NK cells, transposon-based systems that may be used in certain methods provided herein utilize the Sleeping Beauty DNA carrier system (see, e.g., U.S. Pat. No. 6,489,458 and U.S. Patent Application No. 15 / 434,595, which are incorporated by reference in their entireties), the PiggyBac DNA carrier system (see, e.g., Manuri et al., Hum Gene Ther. 2010 Apr;21(4):427-37, which are incorporated by reference in their entireties), or the ToLCDR2 transposon system in DNA, mRNA, or protein form (see, e.g., Tsukahara et al., Gene Ther. 2015 Feb;22(2):209-215, which are incorporated by reference in their entireties).In some embodiments, the transposon and / or transposase of a transposon-based vector system can be produced as a minicircle DNA vector before being introduced into T cells and / or NK cells (see, e.g., Hudecek et al., Recent Results Cancer Res. 2016;209:37-50 and Monjezi et al., Leukemia. 2017 Jan;31(1):186-194, which are incorporated by reference in their entireties). However, in some situations, a transposase-based carrier system is not a preferred method of introducing exogenous nucleic acids. Thus, in some embodiments, the polynucleotide of any of the aspects or embodiments disclosed herein does not comprise a transposon ITR fragment. In some embodiments, the modified, genetically modified, and / or transduced cells of any of the aspects or embodiments disclosed herein do not comprise the transposase carrier system as DNA, mRNA, or protein. CARs can also be integrated into defined and specific sites within the genome using CRISPR- or TALEN-mediated integration by adding 50-1000 bp homology arms 5' and 3' of the target site (Jae Seong Lee et al. Scientific Reports 5, Article number: 8572 (2015) Site-specific integration in CHO cells mediated by CRISPR / Cas9 and homology-directed DNA repair pathway). CRISPR or TALEN provides specificity and genome-targeted cleavage, and the construct integrates via homology-mediated end joining (Yao X et al. Cell Res. 2017 Jun;27(6):801-814. doi:10.1038 / cr.2017.76. Epub 2017 May 19). CRISPR or TALEN can be co-transfected with the target plasmid as DNA, mRNA, or protein.

[0183] In some embodiments, the isolated nucleic acids herein are synthetic RNA, such as a synthetic mRNA, encoding a CAR. The CAR may be any CAR composition disclosed herein.

[0184] Recombinant retroviral particles For example, recombinant retroviral particles are disclosed in the methods and compositions provided herein for transducing T cells and / or NK cells to generate genetically modified T cells and / or NK cells, and as isolated expression vectors.Recombinant retroviral particles are themselves an aspect of the present invention.Typically, the recombinant retroviral particles included in the aspects provided herein are replication-incompetent, which means that the recombinant retroviral particles cannot replicate after leaving the packaging cell.In an exemplary embodiment, the recombinant retroviral particles are lentiviral particles.

[0185] In some aspects, provided herein are replication-incompetent recombinant retroviral particles for use in transducing cells, typically lymphocytes, and in exemplary embodiments, T cells and / or NK cells. The replication-incompetent recombinant retroviral particles may include any of the pseudotyping elements discussed elsewhere herein. In one aspect, provided herein is a replication-incompetent recombinant retroviral particle comprising a polynucleotide comprising: one or more transcription units operably linked to a promoter active in A T cells and / or NK cells, the one or more transcription units encoding a chimeric antigen receptor (CAR), and a B. pseudotyping element. In another aspect, provided herein is a replication-incompetent recombinant retroviral particle comprising a polypeptide comprising one or more transcription units operably linked to a promoter active in T cells and / or NK cells, the one or more transcription units encoding a first polypeptide comprising a chimeric antigen receptor (CAR), and a second polypeptide.

[0186] In some aspects, provided herein are recombinant retroviral particles comprising a polynucleotide having (i) a pseudotyping element capable of binding to T cells and / or NK cells and promoting membrane fusion of the recombinant retroviral particle, and (ii) one or more transcription units operably linked to a promoter active in T cells and / or NK cells, wherein the one or more transcription units encode a first polypeptide having a chimeric antigen receptor comprising an antigen-specific targeting region, a transmembrane domain, and an intracellular activation domain. In some embodiments, the promoter active in T cells and / or NK cells is not active in a packaging cell line or is active in a packaging cell line only in an inducible manner.

[0187] Various elements and combinations of elements contained in replication-incompetent recombinant retroviral particles, such as pseudotyping elements, and nucleic acid sequences contained in the genome of replication-incompetent recombinant retroviral particles, such as, but not limited to, nucleic acids encoding CARs, nucleic acids encoding regulatory elements, and promoters, particularly promoters that are constitutively active or inducible in T cells and / or NK cells, are provided throughout the present disclosure. Furthermore, various embodiments provided herein, such as methods for producing recombinant retroviral particles, methods for performing adoptive cell therapy, and methods for transducing T cells, produce and / or include replication-incompetent recombinant retroviral particles. The replication-incompetent recombinant retrovirus itself produced and / or included in such methods forms a separate aspect of the present invention, as a replication-incompetent recombinant retroviral particle composition, which may be in isolated form. Such compositions may be in a dry (e.g., lyophilized) form, or may be in a suitable solution or medium known in the art for storing and using retroviral particles.

[0188] The necessary elements of recombinant retroviral vectors, such as lentiviral vectors, are known in the art. These elements are included in the packaging cell line section, and details for generating replication-incompetent recombinant retroviral particles are provided in the Examples. For example, lentiviral particles typically contain packaging elements REV, GAG, and POL, which can be delivered to a packaging cell line via one or more packaging plasmids, a pseudotyping element (various examples of which are provided herein) that can be delivered to a packaging cell line via a pseudotyping plasmid, and a genome produced by a polynucleotide delivered to a host cell via a transfer plasmid. This polynucleotide typically contains a viral LTR and a psi packaging signal. The 5'LTR may also be a chimeric 5'LTR fused to a heterologous promoter, including a 5'LTR that is independent of Tat transactivation. The transfer plasmid may be self-inactivating, for example, by deleting the U3 region of the 3'LTR.

[0189] Retroviral particles (e.g., lentiviral particles) included in various aspects of the present invention are, in exemplary embodiments, replication-incompetent for safety reasons, particularly for embodiments involving the introduction of cells transduced with such retroviral particles into a subject. When replication-incompetent retroviral particles are used to transduce cells, no retroviral particles are produced from the transduced cells. Modifications to retroviral genomes to ensure that retroviral particles containing the genome are replication-incompetent are known in the art. However, it will be understood that replication-competent recombinant retroviral particles may be used in some embodiments of any of the aspects provided herein.

[0190] Those skilled in the art will recognize that the functional elements discussed herein can be delivered to packaging cells and / or T cells using different types of vectors, such as expression vectors. Exemplary aspects of the present invention utilize retroviral vectors, and in some particularly exemplary embodiments, lentiviral vectors. Other suitable expression vectors can be used to achieve certain embodiments of the present invention. Such expression vectors include viral vectors (e.g., vaccinia virus-based viral vectors, poliovirus, adenovirus (see, e.g., Li et al., Invest Opthalmol Vis Sci 35:2543 2549, 1994; Borras et al., Gene Ther 6:515 524, 1999; Li and Davidson, PNAS 92:7700 7704, 1995; Sakamoto et al., H Gene Ther 5:1088 1097, 1999; WO94 / 12649; WO93 / 03769; WO93 / 19191; WO94 / 28938; WO95 / 11984; and WO95 / 00655); adeno-associated virus (see, e.g., Ali et al., Hum Gene Ther 9:81 86,1998, Flannery et al.,PNAS 94:6916 6921,1997,Bennett et al.,Invest Opthalmol Vis Sci 38:2857 2863,1997,Jomary et al.,Gene Ther 4:683 690,1997,Rolling et al.,Hum Gene Ther 10:641 648,1999, Ali et al., Hum Mol Genet 5:591 594,1996, WO 93 / 09239 by Srivastava, Samulski et al., J. Vir. (1989) 63:3822-3828, Mendelson et al., Virol. (1988) 166:154-165, and Flotte et al. al., PNAS (1993) 90:10613-10617); SV40; herpes simplex virus; or retroviral vectors (e.g., vectors derived from murine leukemia virus, spleen necrosis virus, and retroviruses such as Rous sarcoma virus, Harvey sarcoma virus, avian leukosis virus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus), such as gammaretroviruses; or human immunodeficiency virus (e.g., see Miyoshi et al., PNAS 94:10319 23, 1997; Takahashi et al., J Virol 73:7812 7816, 1999).

[0191] As disclosed herein, replication-incompetent recombinant retroviral particles are a common tool for gene delivery (Miller, Nature (1992) 357:455-460). The ability of replication-incompetent recombinant retroviral particles to deliver unrearranged nucleic acid sequences to a wide range of rodent, primate, and human somatic cells makes them well suited for introducing genes into cells. In some embodiments, the replication-incompetent recombinant retroviral particles can be derived from the alpharetrovirus, betaretrovirus, gammaretrovirus, deltaretrovirus, epsilonretrovirus, lentivirus, or spumavirus genera. Many retroviruses are suitable for use in the methods disclosed herein. For example, murine leukemia virus (MLV), human immunodeficiency virus (HIV), equine infectious anemia virus (EIAV), mouse mammary tumor virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), avian myelocytomatosis virus-29 (MC29), and avian erythroblastosis virus (AEV) can be used. A detailed list of retroviruses can be found in Coffin et al. ("Retroviruses" 1997 Cold Spring Harbor Laboratory Press Eds: JM Coffin, SM Hughes, HE Varmus pp 758-763). Details of the genome structure of some retroviruses can be found in the art. As an example, details of HIV can be found in NCBI Genbank (ie, genome accession number AF033819).

[0192] In exemplary embodiments, the replication-incompetent recombinant retroviral particle may be derived from the lentivirus genus. In some embodiments, the replication-incompetent recombinant retroviral particle may be derived from HIV, SIV, or FIV. In further exemplary embodiments, the replication-incompetent recombinant retroviral particle may be derived from human immunodeficiency virus (HIV), also of the lentivirus genus. Lentiviruses are complex retroviruses that contain the common retroviral genes gag, pol, and env, as well as other genes with regulatory or structural functions. This increased complexity allows lentiviruses to adjust their life cycle, such as during latent infection. A typical lentivirus is the human immunodeficiency virus (HIV), the causative agent of AIDS. In vivo, HIV can infect terminally differentiated cells that rarely divide, such as lymphocytes and macrophages.

[0193] In some embodiments, DNA-containing viral particles are utilized instead of recombinant retroviral particles. Such viral particles may be adenovirus, adeno-associated virus, herpesvirus, cytomegalovirus, poxvirus, avipoxvirus, influenza virus, vesicular stomatitis virus (VSV), or Sindbis virus. Those skilled in the art will understand how to modify the methods disclosed herein for use with different viruses and retroviruses or retroviral particles. When viral particles containing a DNA genome are used, those skilled in the art will understand that such genomes can contain functional units to induce integration of all or part of the DNA genome of the viral particle into the genome of T cells transduced with such viruses.

[0194] In some embodiments, the polynucleotide regions encoding HIV RRE and HIV Rev can be replaced with a polynucleotide region encoding an N-terminal RGG box RNA-binding motif and ICP27. In some embodiments, the polynucleotide region encoding HIV Rev can be replaced with one or more polynucleotide regions encoding adenovirus E1B 55-kDa and E4 Orf6.

[0195] In one aspect, provided herein is a container, such as a commercial container or package, containing isolated replication-incompetent recombinant retroviral particles according to any of the aspects of the replication-incompetent recombinant retroviral particles provided herein, or a kit comprising the same. Additionally, in another aspect, provided herein is a container, e.g., a commercial container or package, containing isolated packaging cells, in exemplary embodiments, isolated packaging cells from a packaging cell line, according to any of the aspects of the packaging cells and / or packaging cell lines provided herein, or a kit comprising the same. In some embodiments, the kit includes additional containers containing additional reagents, such as buffers or reagents, for use in the methods provided herein. Furthermore, in certain aspects, provided herein is the use of any replication-incompetent recombinant retroviral particle provided herein in any aspect in the manufacture of a kit for genetically modifying T cells or NK cells according to any aspect provided herein. Furthermore, in certain aspects, provided herein is the use of any packaging cell or packaging cell line provided herein in any aspect in the manufacture of a kit for producing replication-incompetent recombinant retroviral particles according to any aspect provided herein.

[0196] In one aspect, provided herein is a commercial container containing replication-incompetent recombinant retroviral particles and instructions for their use to treat tumor growth in a subject, wherein the replication-incompetent recombinant retroviral particles have a genome encoding any of the anti-HER2 CARs provided herein. Thus, the recombinant retroviral particle may include in its genome a polynucleotide comprising one or more nucleic acid sequences encoding the anti-HER2 CARs provided herein, operably linked to a promoter active in T cells and / or NK cells. Typically, the nucleic acid sequence of the one or more nucleic acid sequences encodes the anti-HER2 chimeric antigen receptor (CAR) provided herein, which comprises an antigen-specific targeting region (ASTR) capable of binding to HER2, a transmembrane domain, and an intracellular activation domain.

[0197] The container containing the recombinant retroviral particles can be a tube, vial, well of a plate, or other vessel for storing recombinant retroviral particles. The kit can include more than one container, and a second or other container may contain, for example, a solution or medium for transduction of T cells and / or NK cells, and / or a second or other container may contain a pH adjusting agent. Any of these containers may be of industrial strength and grade.

[0198] In another aspect, provided herein is a pharmaceutical composition for treating or preventing cancer or tumor growth, comprising a replication-incompetent recombinant retroviral particle as an active ingredient. In another aspect, provided herein is an injection composition or other delivery solution for treating or preventing cancer or tumor growth, comprising a replication-incompetent recombinant retroviral particle. The replication-incompetent recombinant retroviral particle of the pharmaceutical composition or injection composition may include any of the aspects, embodiments, or subembodiments discussed above or elsewhere herein.

[0199] In one aspect, provided herein is a container, such as a commercial container or package, containing an isolated nucleic acid, in exemplary embodiments, a retroviral particle, according to any of the aspects and embodiments of the replication-incompetent recombinant retroviral particle provided herein, or a kit containing the same. The retroviral particle may contain, in its genome, a polynucleotide comprising one or more nucleic acid sequences operably linked to a promoter active in T cells and / or NK cells. In some embodiments, the nucleic acid sequence of the one or more nucleic acid sequences may encode an anti-HER2 CAB CAR provided herein, comprising an antigen-specific targeting region (ASTR), a transmembrane domain, and an intracellular activation domain.

[0200] The container containing the isolated nucleic acid, or in exemplary embodiments, the recombinant retroviral particle in any aspect or embodiment, includes a commercial container, which may be a component of a kit, and may be a tube, vial, well of a plate, or other vessel for storing nucleic acid, such as, but not limited to, a retroviral particle. Indeed, some aspects provided herein include a container containing a retroviral particle, such retroviral particle comprising any nucleic acid or other component disclosed herein. Such a container in exemplary embodiments contains substantially pure replication-incompetent recombinant retroviral particles, and may be referred to herein, for shorthand, as substantially pure retroviral particles. Typically, preparations and / or containers of substantially pure retroviral particles are sterilized and negative for mycoplasma, replication-competent retroviruses of the same type, and adventitious viruses according to standard protocols (see, e.g., "Viral Vector Characterization: A Look at Analytical Tools"; October 10, 2018 (available at https: / / cellculturedish.com / viral-vector-characterization-analytical-tools / )). Exemplary methods for producing substantially pure retroviral particles can be purified by one or more of the following combinations: depth filtration, TFF, benzonase treatment, diafiltration, and formulation. Such exemplary methods can be used to produce substantially pure viral particles that are free of non-human animal proteins. In certain exemplary embodiments, the substantially pure retroviral particles meet all of the following characteristics based on quality control test results: a. Negative for mycoplasma. b. Less than 25 EU / mL, and in certain further exemplary embodiments, less than 10 EU / mL endotoxin. c. Absence of detected replication-competent retrovirus of the same type as that intentionally detected in the detected container (e.g., lentivirus). d. Absence of detected adventitious viruses. e. Less than 1 pg host cell DNA / viral TU, and in certain further exemplary embodiments, less than 0.3 pg / TU. f. Fewer than 100 residual plasmid copies / viral TU, and in certain further exemplary embodiments, fewer than 10 copies / viral TU of any plasmid used to generate the recombinant retroviral particles. g. Less than 1 ng of HEK protein / TU, and in certain further exemplary embodiments, less than 50 pg of HEK protein / TU. h. Greater than 100 TU / ng of P24 protein, and in certain further exemplary embodiments, greater than 10,000 TU / ng of P24 protein.

[0201] Retroviral particles are typically tested against release specifications, including some or all of those provided above, before being shipped to customers. The titer of each particle may be defined based on measurements of p24 viral capsid protein by ELISA, viral RNA genome copies by q-RT-PCR, and reverse transcriptase activity by a qPCR-based product-enhanced RT (PERT) assay, all of which can be converted to infectious titer by measuring transducing units (TU) of functional gene transfer in a bioassay.

[0202] Determining the infectious titer of purified bulk retroviral material and final product by bioassay and qPCR is an exemplary analytical test method for determining the infectious titer of a retrovirus. An indicator cell bank (such as F1XT) can be grown in serum-free medium, seeded at 150,000 cells per well, and then exposed to serial dilutions of the retroviral product. Dilutions of purified retroviral particles are performed on the indicator cells, e.g., 1:200 to 1:1,600. A reference standard virus can be added to verify system suitability. After incubation with the retrovirus for four days, the cells are harvested, and DNA is extracted and purified. For example, a standard curve of 100 to 10,000,000 copies / well of a human genome and a unique retroviral genome sequence plasmid pDNA amplicon is used, followed by the addition of genomic DNA from the cell sample exposed to the retroviral particles. For each PCR reaction, the Cq values ​​of both the retroviral amplicon and the endogenous control, such as hRNAseP, are extrapolated back to the copy number per reaction. From these values, the integrated genome copy number is calculated. In some cases, indicator cells, such as 293T, are characterized as triploid, so three copies of the single-copy gene per cell should be used for the calculation. Using the initial viable cell count per well, the volume of retrovirus added to the cells, and the genome copy number ratio, the transducing units (TU) per mL of retroviral particles can be determined.

[0203] The potency test can include testing the potency against release standards using purity and specific activity. For example, the release test of the potency of the final product can include measuring the number of transducing units (TU) compared to the amount of viral particles (for example, by performing p24 capsid protein ELISA, for example, by performing ELISA on lentiviral viral proteins, with a cutoff of at least 100, 1,000, 2,000, or 2,500 TU / ng of p24), and CAR functionality, for example, by measuring the release of interferon gamma by a reporter cell line exposed to genetically modified cells.

[0204] In any of the kit or isolated replication-incompetent recombinant retroviral particle embodiments herein (including containers of such retroviral particles), sufficient recombinant retroviral particles are present in the container to achieve an MOI (number of transducing units, or TU applied per cell) in reaction mixtures made with the retroviral particles of 0.1 to 50, 0.5 to 50, 0.5 to 20, 0.5 to 10, 1 to 25, 1 to 15, 1 to 10, 1 to 5, 2 to 15, 2 to 10, 2 to 7, 2 to 3, 3 to 10, 3 to 15, or 5 to 15, or at least 0.1, 0.5, 1, 2, 2.5, 3, 5, 10, or 15, or to achieve an MOI of at least 0.1, 0.5, 1, 2, 2.5, 3, 5, 10, or 15. The transduction units of the viral particles provided in the kit should allow for the use of an MOI that prevents the production of too many integrants in individual cells, an average of less than 3 lentigen copies per cell genome, and more preferably 1 copy per cell. For kit and isolated retroviral particle embodiments, such an MOI is 1 x 10 6 Assuming target cells / mL, for example, 1 x 10 for whole blood. 6 Assuming 1 x 10 PBMCs / mL of blood, the reaction mixture may be based on 1, 2.5, 5, 10, 20, 25, 50, 100, 250, 500, or 1,000 mL. Thus, a container of retroviral particles may contain 1 x 10 5 ~1×10 9 , 1×10 5 ~1×10 8 , 1×10 5 ~5×10 7 , 1×10 5 ~1×10 7 , 1×10 5 ~1×10 6 , 5×10 5 ~1×10 9 , 5×10 5 ~1×10 8 , 5×10 5 ~5×10 7 , 5×10 5 ~1×10 7 , 5×105 ~1×10 6 , or 1 × 10 7 ~1×10 9 , 1×10 7 ~5×10 7 , 1×10 6 ~1×10 7 , and 1 × 10 6 ~5×10 6 In certain exemplary embodiments, the container contains 1 x 10 7 ~1×10 9 , 5×10 6 ~1×10 8 , 1×10 6 ~5×10 7 , 1×10 6 ~5×10 6 , or 5 × 10 7 ~1×10 8 Without being limited by theory, the number of such particles would support 1-100 ml of blood at an MOI of 1-10.

[0205] Each container containing retroviral particles may contain a volume of, for example, 0.05 mL to 5 mL, 0.05 mL to 1 mL, 0.05 mL to 0.5 mL, 0.1 mL to 5 mL, 0.1 mL to 1 mL, 0.1 mL to 0.5 mL, 0.1 to 10 mL, 0.5 to 10 mL, 0.5 mL to 5 mL, 0.5 mL to 1 mL, 1.0 mL to 10.0 mL, 1.0 mL to 5.0 mL, 10 mL to 100 mL, 1 mL to 20 mL, 1 mL to 10 mL, 1 mL to 5 mL, 1 mL to 2 mL, 2 mL to 20 mL, 2 mL to 10 mL, 2 mL to 5 mL, 0.25 mL to 10 mL, 0.25 to 5 mL, or 0.25 to 2 mL.

[0206] In certain embodiments, the retroviral particles in the container are GMP-grade or cGMP-grade retroviral particles (i.e., produced under GMP or current GMP requirements in accordance with a regulatory agency), or are the product of a retroviral manufacturing step performed using a GMP system. Such retroviral particles are typically produced using the Good Manufacturing Practices (GMP) of the US FDA (i.e., US GMP or US cGMP), the EMA (i.e., EMA GMP or EMA cGMP), or the National Medical Products Administration (NMPA) of China (i.e., China FDA) (i.e., NMPA GMP or NMPA cGMP), e.g., using a GMP quality system and GMP procedural controls. These products are typically produced in facilities that meet GMP or cGMP requirements. Such products are typically manufactured under strict quality control systems based on GMP or cGMP regulations. GMP-grade retroviral particles are typically sterilized. This can be achieved, for example, by filtering the retroviral particles, e.g., substantially pure retroviral particles, through a 0.45 μm or 0.22 μm filter. GMP grade retroviral particles are typically substantially pure and prepared using good manufacturing practice testing specifications for potency, quality, and safety.

[0207] In some embodiments, the solution containing retroviral particles in the container does not contain detectable bovine proteins and can be referred to as "bovine-free." For example, bovine proteins, such as bovine serum proteins, are not used to culture packaging cells during retroviral production, so such a solution of retroviral particles can be bovine-free. In some embodiments, the solution of retroviral particles is GMP-grade and bovine-free. Substantially pure nucleic acid solutions are typically bovine-free and are produced in bovine-free broth.

[0208] In some aspects, provided herein are kits for modifying NK cells and / or, in exemplary embodiments, T cells. In certain embodiments, such kits include one or more containers containing a polynucleotide, typically a substantially pure polynucleotide, comprising one or more first transcription units operably linked to a promoter active in T cells and / or NK cells (the one or more first transcription units encode a first chimeric antigen receptor (CAR) (sometimes referred to as a first CAR)), as well as one or more containers of accessory components (also referred to herein as accessory kit components). Polynucleotides (e.g., retroviral particles) can be stored frozen, for example, at -70°C or below (e.g., -80°C).

[0209] Retroviral genome size In the methods and compositions provided herein, recombinant retroviral genomes, including lentiviral genomes in non-limiting illustrative examples, have a limited number of polynucleotides that can be packaged into viral particles. In some embodiments provided herein, the polypeptide encoded by the polynucleotide coding region may be truncated or otherwise deleted to retain functional activity, such that the polynucleotide coding region is encoded by fewer nucleotides than the polynucleotide coding region of a wild-type polypeptide. In some embodiments, the polypeptide encoded by the polynucleotide coding region may be a fusion polypeptide that can be expressed from a single promoter. In some embodiments, the fusion polypeptide may have a cleavage signal to generate two or more functional polypeptides from a single fusion polypeptide and a single promoter. Furthermore, some functions that are not required after the initial ex vivo transduction are not included in the retroviral genome, but rather are present on the surface of the replication-incompetent recombinant retroviral particle via the packaging cell membrane. These various strategies are used herein to maximize the functional elements packaged into replication-incompetent recombinant retroviral particles.

[0210] In some embodiments, the packaged recombinant retroviral genome may be from a lower range of 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, and 8,000 nucleotides to an upper range of 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, and 11,000 nucleotides. The packaged retroviral genome comprises one or more polynucleotide regions encoding first and second polypeptides, as disclosed in detail herein. In some embodiments, the packaged recombinant retroviral genome may be less than 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, or 11,000 nucleotides. Functions discussed elsewhere herein that may be packaged include retroviral sequences necessary for retroviral assembly and packaging, such as the retroviral rev, gag, and pol coding regions, and the 5'LTR and 3'LTR, or active cleaved fragments thereof, nucleic acid sequences encoding retroviral cis-acting RNA packaging elements, and cPPT / CTS elements.

[0211] combination In some embodiments, the polynucleotide provided by the replication-incompetent recombinant retroviral particle has one or more transcription units encoding a particular combination of one or more CARs. In some methods and compositions provided herein, the genetically modified T cells contain a combination of one or more CAR polypeptides after transduction of the T cells with the replication-incompetent recombinant retroviral particle. References to a first polypeptide, a second polypeptide, a third polypeptide, etc. are for convenience, and it will be understood that elements on a "first polypeptide" and an element on a "second polypeptide" mean that the elements are on different polypeptides, typically referred to as first or second only by reference and convention, in further elements or steps relative to that particular polypeptide.

[0212] In one embodiment, one or more CARs are expressed under a T cell-specific promoter or a common promoter under the same transcript, where the nucleic acids encoding the CARs are separated by one or more internal ribosome entry sites (IREs) or nucleic acids encoding one or more protease cleavage peptides.

[0213] In certain embodiments, the polypeptide encodes two CARs, where the first CAR comprises a first extracellular antigen-binding domain capable of binding to a first antigen and a first intracellular signaling domain (e.g., a CD3ζ signaling domain) but does not comprise a costimulatory domain (e.g., CD27, CD28, OX40, ICOS, and 4-1BB), and the second polypeptide comprises a second extracellular antigen-binding domain and a second intracellular signaling domain, such as the signaling domain of a costimulatory molecule. In certain embodiments, the first or second antigen is HER2, and the other antigen is PSCA, PSMA, BCMA, or VEGF. In certain embodiments, the first, second, or both extracellular antigen-binding domains comprise an antibody or fragment thereof (e.g., scFv), e.g., an antibody or fragment thereof specific for PSCA, PSMA, or BCMA. In certain embodiments, the first or second extracellular antigen-binding domain is a receptor, e.g., a receptor for VEGF, i.e., VEGFR.

[0214] Additional arrays A CAR may further comprise one or more additional polypeptide domains, including, but not limited to, a signal sequence; an epitope tag; an affinity domain; and a polypeptide whose presence or activity can be detected, for example, by antibody assay or because it is a polypeptide that generates a detectable signal (a detectable marker). Non-limiting examples of additional domains of any of the aspects or embodiments provided herein include domains having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any of the following sequences described below: a signal sequence, an epitope tag, an affinity domain, or a polypeptide that generates a detectable signal.

[0215] Suitable signal sequences for use in a subject CAR, e.g., in the first polypeptide of a subject CAR, include any eukaryotic signal sequence, including naturally occurring signal sequences, synthetic (e.g., artificial) signal sequences, etc. In some embodiments, for example, the signal sequence may be the CD8 signal sequence (SEQ ID NO: 72).

[0216] Suitable epitope tags include, but are not limited to, hemagglutinin (HA; e.g., YPYDVPDYA; SEQ ID NO: 73), FLAG (e.g., DYKDDDDK; SEQ ID NO: 74), c-myc (e.g., EQKLISEEDL; SEQ ID NO: 75), and the like.

[0217] Affinity domains include peptide sequences that can interact with binding partners, such as those immobilized on a solid support, and are useful for identification or purification. DNA sequences encoding multiple consecutive single amino acids, such as histidine, when fused to an expressed protein, can be used for one-step purification of recombinant proteins by binding with high affinity to a resin column such as nickel sepharose. Exemplary affinity domains include His5 (HHHHH; SEQ ID NO: 76), HisX6 (HHHHHH; SEQ ID NO: 77), c-myc (EQKLISEEDL; SEQ ID NO: 75), Flag (DYKDDDDK; SEQ ID NO: 74), Strep Tag (WSHPQFEK; SEQ ID NO: 78), hemagglutinin, such as HA. Tag (YPYDVPDYA; SEQ ID NO: 73), GST, thioredoxin, cellulose-binding domain, RYIRS (SEQ ID NO: 79), Phe-His-His-Thr (SEQ ID NO: 80), chitin-binding domain, S-peptide, T7 peptide, SHCDR2 domain, C-terminal RNA tag, WEAAAREACCRECCARA (SEQ ID NO: 81), metal-binding domain, e.g., zinc-binding domain, or calcium-binding domain such as those from calcium-binding proteins, e.g., calmodulin, troponin C, calcineurin B, myosin light chain, recoverin, S-modulin, visinin, VILIP, neurocalcin, hippocalcin, flekenin, caltractin, calpain large subunit, S100 protein, parvalbumin, calbindin D9K, calbindin D28K, and calretinin, intein, biotin, streptavidin, MyoD, Id, leucine zipper sequence, and maltose-binding protein.

[0218] Suitable detectable signal-generating proteins include, for example, fluorescent proteins; enzymes that catalyze a reaction that generates a detectable signal as a product; and the like.

[0219] Suitable fluorescent proteins include, but are not limited to, green fluorescent protein (GFP) or variants thereof, blue fluorescent variants of GFP (BFP), cyan fluorescent variants of GFP (CFP), yellow fluorescent variants of GFP (YFP), enhanced GFP (EGFP), enhanced CFP (ECFP), enhanced YFP (EYFP), GFPS65T, Emerald, Topaz (TYFP), Venus, Citrine, mCitrine, GFPuv, destabilized EGFP (dEGFP), destabilized ECFP (dECFP), destabilized EYFP (dEYFP), mCFPm, Cerulean, T-Sapphire, CyPet, YPet, mKO, HcRed, t-HcRed, DsRed, DsRed2, DsRed-monomer, J-Red, dimer2, t-dimer2(12), mRFPl, pocilloporin, Renilla GFP, Monster Phycobiliproteins and phycobiliprotein conjugates, including GFP, paGFP, Kaede protein and kindling protein, B-phycoerythrin, R-phycoerythrin, and allophycocyanin, are also suitable. Other examples of fluorescent proteins include mHoneydew, mBanana, mOrange, dTomato, tdTomato, mTangerine, mStrawberry, mCherry, mGrapel, mRaspberry, mGrape2, and mPlum (Shaner et al. (2005) Nat. Methods 2:905-909). Suitable for use are any of a variety of fluorescent and colored proteins from Anthozoan species, as described, for example, in Matz et al. (1999) Nature Biotechnol. 17:969-973.

[0220] Suitable enzymes include, but are not limited to, horseradish peroxidase (HRP), alkaline phosphatase (AP), beta-galactosidase (GAL), glucose-6-phosphate dehydrogenase, beta-N-acetylglucosaminidase, β-glucuronidase, invertase, xanthine oxidase, firefly luciferase, glucose oxidase (GO), and the like.

[0221] Recognition and / or Elimination Domains Any of the replication-incompetent recombinant retroviral particles provided herein can contain a nucleic acid encoding a recognition or elimination domain, either as part of or separately from the nucleic acid encoding any of the CARs provided herein. Thus, any of the CARs provided herein can contain a recognition or elimination domain. The recognition or elimination domain is expressed on T cells and / or NK cells, but is not expressed on the replication-incompetent recombinant retroviral particle.

[0222] In some embodiments, the recognition or elimination domain may be derived from the herpes simplex virus-derived enzyme thymidine kinase (HSV-tk) or inducible caspase 9. In some embodiments, the recognition or elimination domain may comprise a modified endogenous cell surface molecule, for example, as disclosed in U.S. Pat. No. 8,802,374. The modified endogenous cell surface molecule may be any cell surface receptor, ligand, glycoprotein, cell adhesion molecule, antigen, integrin, or modified cluster of differentiation (CD). In some embodiments, the modified endogenous cell surface molecule is a truncated tyrosine kinase receptor. In one aspect, the truncated tyrosine kinase receptor is a member of the epidermal growth factor receptor (EGFR) family (e.g., ErbB1, ErbB2, ErbB3, and ErbB4). In some embodiments, the recognition domain may be a polypeptide recognized by an antibody that recognizes the extracellular domain of an EGFR member. In some embodiments, the recognition domain may be at least 20 contiguous amino acids of an EGFR family member, or, for example, 20-50 contiguous amino acids of an EGFR family member. For example, SEQ ID NO: 82 is an exemplary polypeptide recognized by, and bound by, antibodies that recognize the extracellular domain of an EGFR member under appropriate conditions. Such extracellular EGFR epitopes are sometimes referred to herein as eTags. In exemplary embodiments, such epitopes are recognized by commercially available anti-EGFR monoclonal antibodies.

[0223] The epidermal growth factor receptor, also known as EGFR, ErbB1, and HER1, is a cell surface receptor for members of the epidermal growth factor family of extracellular ligands. Altered EGFR activity has been implicated in certain cancers. In some embodiments, a gene encoding an EGFR polypeptide, including human epidermal growth factor receptor (EGFR), is constructed by removing the nucleic acid sequence encoding a polypeptide comprising the membrane-distal EGF-binding domain and the cytoplasmic signaling tail, while retaining the extracellular membrane-proximal epitope recognized by anti-EGFR antibodies. Preferably, the antibody is a known, commercially available anti-EGFR monoclonal antibody, such as cetuximab, matuzumab, necitumumab, or panitumumab.

[0224] Other researchers have shown that applying immunomagnetic selection with biotinylated cetuximab in combination with anti-biotin microbeads successfully enriched T cells lentivirally transduced with an EGFRt-containing construct from as low as 2% of the population to greater than 90% purity without observable toxicity to the cell preparation. Furthermore, other researchers have shown that constitutive expression of this inactive EGFR molecule, directed by the coordinately expressed chimeric antigen receptor (CAR), CD19R, does not affect T cell phenotype or effector function. Additionally, other researchers have shown through flow cytometry analysis that EGFR has been successfully used as an in vivo tracking marker for T cell engraftment in mice. Furthermore, EGFR has been demonstrated to have the potential to act as a suicide gene via the Erbitux®-mediated antibody-dependent cellular cytotoxicity (ADCC) pathway. The inventors of the present disclosure successfully expressed eTag in PBMCs using lentiviral vectors and found that in vitro expression of eTag by PBMCs exposed to cetuximab provided an effective mechanism for PBMC elimination. Thus, EGFR can be used as a non-immunogenic selection tool, a tracking marker, and a suicide gene for transduced T cells with immunotherapeutic potential. EGFR nucleic acid can also be detected by means well known in the art.

[0225] In some embodiments, the EGFR is expressed as part of a single polypeptide that also includes the CAR. In some embodiments, the amino acid sequence encoding the EGFR recognition domain can be separated from the amino acid sequence encoding the chimeric antigen receptor by a cleavage signal and / or ribosomal skipping sequence. The ribosomal skipping and / or cleavage signal can be any ribosomal skipping sequence and / or cleavage signal known in the art. Without being limited by theory, the ribosomal skipping sequence can be, for example, T2A (also referred to herein as 2A-1) (SEQ ID NO: 83). Without being limited by theory, other examples of cleavage signals and ribosomal skipping sequences include FMDV 2A (F2A), equine rhinitis A virus 2A (abbreviated as E2A), porcine teschovirus-1 2A (P2A), and Thoseaasigna virus 2A (T2A). In some embodiments, the polynucleotide sequence encoding the recognition domain can be present on the same transcript as the CAR, but can be separated from the polynucleotide sequence encoding the CAR by an internal ribosomal entry site.

[0226] In other embodiments, as demonstrated herein, the recognition domains can be expressed as part of a fusion polypeptide, which offers the advantage of occupying less genomic space on the RNA genome compared to separate polypeptides, particularly in combination with other "space-saving" elements provided herein.

[0227] Sequence recombination In certain cases, the polypeptide sequence of a CAR, for example, a CAR domain, can be rearranged or deleted in a cell by using site-specific recombination technology. In certain embodiments, the cellular activation-associated response to a specific CAR can be changed by site-specific recombination; for example, a first intracellular activation domain of a CAR that induces a first activation-associated response can be replaced with a second intracellular activation domain that induces a second activation-associated response. As will be apparent to those skilled in the art, site-specific recombination can be used in a cell to exchange any domain or sequence of a CAR with any other domain or sequence disclosed herein. As will be apparent to those skilled in the art, site-specific recombination can be used in a cell to delete any domain or sequence of a CAR. Such sequence and domain exchanges and excisions are known in the art, see, for example, domain switching in signalobodies as described in Tone et al. (2013) Biotechnology and Bioengineering, 3219-3226. The disclosure of this document is incorporated herein by reference. The mechanisms and requirements for site-specific recombination in vivo are also well known in the art, see, e.g., Grindley et al. (2006) Annual Review of Biochemistry, 567-605, and Tropp (2012) Molecular Biology (Jones & Bartlett Publishers, Sudbury, Massachusetts), the disclosures of which are incorporated herein by reference.

[0228] CAR is a chimeric protein produced by fusing all the different domains discussed above together to form a fusion protein. CAR is usually produced by an expression vector containing a polynucleotide sequence encoding the different domains of CAR discussed herein. The ASTR of the present invention, which functions to recognize and bind to antigens on target cells, is conditionally active. Specifically, compared with the ASTR of the corresponding wild-type protein, the ASTR is less active or inactive in binding to target antigens under normal physiological conditions, but is active under tumor conditions.

[0229] Tumor microenvironment Cancer cells in solid tumors form a tumor microenvironment (TME) around them that can support cancer cell proliferation and metastasis. The TME is the cellular environment in which tumors reside, including surrounding blood vessels, immune cells, fibroblasts, other cells, soluble factors, signaling molecules, extracellular matrix, and mechanical cues that can promote neoplastic transformation, support tumor growth and invasion, protect tumors from host immunity, promote therapeutic resistance, and provide a microenvironment for the propagation of dormant metastases. Tumor and surrounding microenvironments are closely related and constantly interact. Tumors can influence their microenvironment by releasing extracellular signals, promoting tumor angiogenesis, and inducing peripheral immune tolerance, while immune cells in the microenvironment can influence cancer cell proliferation and evolution. See Swarts et al., “Tumor Microenvironment Complexity: Emerging Roles in Cancer Therapy,” Cancer Res, vol. 72, pages 2473–2480, 2012.

[0230] The TME is often hypoxic. As tumor burden increases, the interior of the tumor grows further away from the existing blood supply, making it difficult to adequately oxygenate the TME. The oxygen tension in the tumor environment is less than 5 mmHg in more than 50% of locally advanced solid tumors, compared with approximately 40 mmHg in plasma. In contrast, the rest of the body is not hypoxic. A hypoxic environment leads to genetic instability, which is associated with cancer progression through downregulation of nucleotide excision repair and mismatch repair pathways. Hypoxia also causes upregulation of hypoxia-inducible factor I alpha (HIF1-α), which induces angiogenesis and is associated with activation of genes associated with poorer prognosis and metastasis. See Weber et al., "The tumor microenvironment," Surgical Oncology, vol. 21, pages 172-177, 2012 and Blagosklonny, "Antiangiogenic therapy and tumor progression," Cancer Cell, vol. 5, pages 13-17, 2004.

[0231] Additionally, tumor cells tend to rely on energy generated from lactic acid fermentation, which does not require oxygen. Therefore, tumor cells are less likely to use normal aerobic respiration, which requires oxygen. The use of lactic acid fermentation results in an acidic TME (pH 6.5–6.9), in contrast to the neutral or slightly alkaline pH of the rest of the body. For example, human plasma has a pH of approximately 7.4. See Estrella et al., “Acidity Generated by the Tumor Microenvironment Drives Local Invasion,” Cancer Research, vol. 73, pages 1524–1535, 2013. Due to the relatively high nutrient demands of proliferating cancer cells, nutrient availability in the TME is also lower compared to cells located in other parts of the body.

[0232] Furthermore, the TME also contains many unique cell types not normally found in other parts of the body, including endothelial cells and their precursors, pericytes, smooth muscle cells, fibroblasts, carcinoma-associated fibroblasts, myofibroblasts, neutrophils, eosinophils, basophils, mast cells, T and B lymphocytes, natural killer cells, and antigen-presenting cells (APCs) such as macrophages and dendritic cells (Lorusso et al., "The tumor microenvironment and its contribution to tumor evolution toward metastasis," Histochem Cell Biol, vol. 130, pages 1091-1103, 2008).

[0233] Thus, the TME has at least some physiological conditions that differ from those in other parts of the body, such as those in plasma. The TME has a lower pH (more acidic) than other parts of the body, particularly plasma (pH 7.4). The TME has a lower oxygen concentration than other parts of the body, such as plasma. The TME also has lower nutrient availability than other parts of the body, particularly plasma. The TME also has some distinct cell types not normally found in other parts of the body, particularly plasma.

[0234] In exemplary embodiments, the CAR of the present invention comprises a conditionally active ASTR generated from a wild-type (i.e., native) biological protein, such as a wild-type or natural antibody, isolated from a mammalian organism that may be a candidate for tumor therapy, e.g., a mouse or a human. In such exemplary embodiments, the conditionally active ASTR has lower activity than the natural or wild-type biological protein under at least one physiological condition in a body part other than the TME, such as plasma, but has higher activity than the natural or wild-type biological protein under at least one physiological condition in the TME. Such conditionally active natural or biological proteins can selectively act on cancer cells in the TME to treat tumors, and are therefore likely to cause less side effects. In embodiments where the natural or natural protein is an antibody against an antigen on the surface of tumor cells and the antigen is exposed to the TME, the conditionally active antibody has a lower affinity for the antigen than natural or wild-type antibodies in other parts of the body (e.g., non-TME), but a higher affinity for the antigen than natural or wild-type antibodies in the TME. Such conditionally active antibodies bind weakly or not at all to antigens in other parts of the body, but have greater or stronger avidity to antigens in the TME.

[0235] Pseudotyping elements Many of the methods and compositions provided herein include a pseudotyping element. Pseudotyping replication-incompetent recombinant retroviral particles with heterologous envelope glycoproteins typically alters the tropism of the virus and promotes transduction of host cells. Pseudotyping elements as used herein may include a "binding polypeptide," which includes one or more polypeptides, typically glycoproteins, that identify and bind to target host cells, and one or more "fusogenic polypeptides," which mediate fusion of the retrovirus and target host cell membranes, thereby allowing the retroviral genome to enter the target host cell. In some embodiments provided herein, pseudotyping elements are provided as polypeptides / proteins or as nucleic acid sequences encoding polypeptides / proteins.

[0236] In some embodiments, the pseudotyping element is feline endogenous virus (RD114) envelope protein, oncoretrovirus amphotropic envelope protein, oncoretrovirus ecotropic envelope protein, vesicular stomatitis virus envelope protein (VSV-G) (SEQ ID NO: 85), baboon retrovirus envelope glycoprotein (BaEV) (SEQ ID NO: 86), murine leukemia envelope protein (MuLV) (SEQ ID NO: 87), influenza glycoprotein HA surface glycoprotein (HA), influenza glycoprotein neurominidase (NA), paramyxovirus measles envelope protein H, paramyxovirus measles envelope protein F, and / or a functional variant or fragment of any of these envelope proteins.

[0237] Packaging cell lines / recombinant retroviral particle production methods The present disclosure provides mammalian packaging cells and packaging cell lines that produce replication-incompetent recombinant retroviral particles. Cell lines that produce replication-incompetent recombinant retroviral particles are also referred to herein as packaging cell lines.

[0238] Exemplary methods for producing retroviral particles are described herein, for example, in the Examples section herein. Such methods include, for example, a four-plasmid packaging system. In an exemplary embodiment, the four-plasmid packaging system includes three packaging plasmids encoding pseudotyping elements such as (i) gag / pol, (ii) rev, and (iii) VSV-G. The fourth plasmid of the four-plasmid packaging system is a genome plasmid. In a further exemplary embodiment, the genome plasmid is a third-generation lentiviral expression vector that contains a deletion in the 3'LTR, resulting in self-inactivation.

[0239] Packaging cell line cells may be adherent or suspension cells. Exemplary cell types are described herein below. In exemplary embodiments, the packaging cell line may be a suspension cell line, i.e., a cell line that does not adhere to a surface during growth. The cells may be grown in chemically defined and / or serum-free medium. In some embodiments, the packaging cell line may be a suspension cell line derived from an adherent cell line; for example, an HEK293 cell line may be grown in conditions to generate a suspension-adapted HEK293 cell line according to methods known in the art. Packaging cell lines are typically grown in chemically defined medium. In some embodiments, the packaging cell line medium may include serum. In some embodiments, the packaging cell line medium may include a serum substitute, as known in the art. In exemplary embodiments, the packaging cell line medium may be serum-free medium. Such medium may be a chemically defined, serum-free formulation manufactured in compliance with U.S. Food and Drug Administration (FDA) Current Good Manufacturing Practice (CGMP) regulations. The packaging cell line medium may be xeno-free and complete. In some embodiments, the packaging cell line medium is approved by a regulatory agency for use in ex vivo cell processing, such as in an FDA 510(k) cleared device.

[0240] Thus, in one aspect, provided herein is a method for producing replication-incompetent recombinant retroviral particles, the method comprising: A. culturing packaging cells in suspension in serum-free medium, wherein the packaging cells comprise nucleic acid sequences encoding a packaging-competent RNA genome, a REV protein, a gag polypeptide, a pol polypeptide, and a pseudotyping element for the replication-incompetent retroviral particles; and B. recovering the replication-incompetent recombinant retroviral particles from the serum-free medium.

[0241] In some embodiments, the polypeptide may comprise a CAR, and the nucleic acid sequence may encode any of the CAR embodiments provided herein. For example, the polypeptide may comprise a first antigen-specific targeting region, a first transmembrane domain, and a first intracellular activation domain. Examples of antigen-specific targeting regions, transmembrane domains, and intracellular activation domains are disclosed elsewhere herein. In some embodiments, the packageable RNA genome may further comprise a nucleic acid sequence encoding a second polypeptide. In some embodiments, where the target cell is a T cell or an NK cell, the promoter active in the target cell is active in a T cell or an NK cell, as disclosed elsewhere herein.

[0242] Some embodiments of the present disclosure include or are cells, illustrative examples mammalian cells, that are used as packaging cells for producing replication-incompetent recombinant retroviral particles, such as lentiviruses, for transduction of T cells and / or NK cells.

[0243] Some aspects of the present disclosure include or are cells, and in exemplary embodiments, the cells are mammalian cells used as packaging cells to produce viruses, such as lentiviruses, for transduction of T cells and / or NK cells. According to the present invention, any of a wide variety of cells can be selected for in vitro production of viruses or viral particles, e.g., pseudotyped recombinant retroviral particles. Eukaryotic cells, particularly mammalian cells, including human, simian, canine, feline, equine, and rodent cells, are typically used. In exemplary embodiments, the cells are human cells. In further exemplary embodiments, the cells replicate indefinitely and are therefore immortal. Examples of cells that can be advantageously used in the present invention include NIH 3T3 cells, COS cells, Madin-Darby canine kidney cells, human fetal 293T cells, and any cells derived from such cells, such as gpnlslacZ φNX cells derived from 293T cells. Highly transfectable cells, such as human fetal kidney 293T cells, can be used. By "highly transfectable" is meant that at least about 50%, more preferably at least about 70%, and most preferably at least about 80% of the cells are capable of expressing the genes of the introduced DNA.

[0244] Suitable mammalian cells include primary cells and immortalized cell lines. Suitable mammalian cell lines include human cell lines, non-human primate cell lines, rodent (e.g., mouse, rat) cell lines, etc. Suitable mammalian cell lines include HeLa cells (e.g., American Type Culture Collection (ATCC) No. CCL-2), CHO cells (e.g., ATCC Nos. CRL9618, CCL61, CRL9096), 293 cells (e.g., ATCC No. CRL-1573), Vero cells, NIH3T3 cells (e.g., ATCC No. CRL-1658), Huh-7 cells, BHK cells (e.g., ATCC No. CCL10), PC1 These include, but are not limited to, mouse L cells (ATCC No. CCLI.3), human embryonic kidney (HEK) cells (ATCC No. CRLCDR1573), HLHepG2 cells, Hut-78, Jurkat, HL-60, and NK cell lines (e.g., NKL, NK92, and YTS).

[0245] Genetically modified T and NK cells In embodiments of the methods and compositions herein, genetically modified lymphocytes are produced, which are themselves a separate aspect of the present invention. Such genetically modified lymphocytes may be genetically modified and / or transduced lymphocytes. In one aspect provided herein, genetically modified T cells or NK cells are produced using a method according to any aspect provided herein for genetically modifying T cells and / or NK cells in blood or a component thereof. For example, in some embodiments, the T cells or NK cells are genetically modified to express a first polypeptide. In exemplary embodiments, the first polypeptide may be a CAR comprising an antigen-specific targeting region (ASTR) that specifically binds to the HER2 protein, a transmembrane domain, and an intracellular activation domain. In some embodiments, the T cells or NK cells may further comprise a second polypeptide that may be a CAR. In some embodiments, the T cells or NK cells may further comprise a pseudotyping element on their surface. The CAR and pseudotyping element of the genetically modified T cells or NK cells may comprise any of the aspects, embodiments, or subembodiments disclosed herein.

[0246] In some embodiments, the genetically modified lymphocytes are lymphocytes, such as T cells or NK cells, genetically modified to express a first polypeptide comprising a chimeric antigen receptor comprising an antigen-specific targeting region (ASTR) that specifically binds to a HER2 protein, a transmembrane domain, and an intracellular activation domain. In some embodiments of any of the aspects herein, the NK cells are NKT cells. NKT cells are a subset of T cells that express CD3 and typically co-express the αβ T cell receptor, but also express various molecular markers typically associated with NK cells (such as NK1.1 or CD56).

[0247] The genetically modified lymphocytes of the present disclosure typically carry a heterologous nucleic acid sequence, which is a nucleic acid encoding an anti-HER2 CAR provided herein, introduced into the lymphocyte by recombinant DNA techniques. For example, in exemplary embodiments, the heterologous sequence is inserted into the lymphocyte during the method for transducing lymphocytes provided herein. The heterologous nucleic acid is found within the lymphocyte and, in some embodiments, may or may not be integrated into the genome of the modified lymphocyte.

[0248] In exemplary embodiments, the heterologous nucleic acid is integrated into the genome of a genetically modified lymphocyte. Such lymphocytes are produced using the methods for transducing lymphocytes provided herein, which, in exemplary embodiments, utilize recombinant retroviral particles. Such recombinant retroviral particles may contain a polynucleotide encoding a chimeric antigen receptor, typically comprising at least an antigen-specific targeting region (ASTR), a transmembrane domain, and an intracellular activation domain. In other sections of this disclosure, various embodiments of replication-incompetent recombinant retroviral particles and polynucleotides encoded in the genome of replication-incompetent retroviral particles are provided herein, which may be used to produce genetically modified lymphocytes, which themselves form another aspect of the present disclosure.

[0249] For example, the genetically modified lymphocytes of the present disclosure, comprising any of the nucleic acids provided herein encoding CAR for binding to HER2, can be isolated outside the body.For example, such lymphocytes can be found in the medium and other solutions used for ex vivo transduction as provided herein.Lymphocytes can be present in a non-genetically modified form in the blood collected from a subject by the method provided herein, and then genetically modified during the transduction method.

[0250] In some aspects, provided herein are delivery suspensions, cell therapy suspensions, infusion suspensions, cell dispersions, or cell suspensions comprising a population of genetically modified T cells and / or NK cells suspended in a solution such as an infusion vessel, in exemplary embodiments, a cryopreservation solution, or other delivery solution, wherein the genetically modified T cells and / or NK cells comprise a nucleic acid encoding a chimeric antigen receptor (CAR) for binding to HER2, as provided herein. In exemplary embodiments, such compositions comprise pharmaceutical or biologic grade delivery solutions for delivery of genetically modified T cells and / or NK cells to a mammalian (e.g., human) subject for cell therapy, typically CAR-T therapy. In some embodiments, the delivery suspension, cell therapy suspension, infusion suspension, cell suspension, or cell dispersion is in a solution comprising an excipient suitable for cell delivery, which in exemplary embodiments is a cryopreservation solution. In some embodiments, the excipients include one or more or all of the following at known concentrations for the dispersion: cell therapy suspension, glucose, sodium chloride, human albumin solution, injectable dextran 40, dimethyl sulfoxide, sodium gluconate, sodium acetate, potassium chloride, magnesium chloride, sodium N-acetyltryptophanate, sodium caprylate, aluminum, or water. The solutions used in such cell suspensions or related compositions typically include a basal medium, such as saline or CSB, and optionally a cryopreservation solution as disclosed herein. In some embodiments, the compositions may include a cryopreservation solution as disclosed elsewhere herein. In an exemplary embodiment, the cryopreservation solution is a cryopreservation infusion solution, in which cells can be frozen and then thawed and infused into a subject. For example, a cryopreserved infusion solution may contain a non-pyrogenic IV crystalloid solution with a composition of 20-40% dextrose, 0.5-2% dextran, 20-60% human serum albumin, 5-15% DMSO, e.g., Plasma-Lyte A (Baxter International), dextrose, and sodium chloride.Each 1000 mL of Plasma-Lyte A, and therefore each 1000 mL of basal medium for the cryopreservation infusion solution herein, can contain 5.26 g (4-6 g) sodium chloride, 370 mg (350-450 mg) potassium chloride, 300 mg (200-400 mg) magnesium chloride, 3.68 g (3-4 g) and 5.02 g (4.5-5.5 g) sodium acetate and sodium gluconate, with ranges in parentheses, corresponding to 140 mmol / L sodium, 5 mmol / L potassium, 1.5 mmol / L magnesium, 98 mmol / L chloride, and 27 mmol / L and 23 mmol / L acetate and gluconate. In some embodiments, the cryopreservation infusion solution is CryoStor freezing medium. Other exemplary cryopreservation infusion solutions in which CAR-T cells may be cryopreserved for thawing and optional delivery to a subject include Cryostor CS5; 31.25% Plasma-Lyte A, 31.25% dextrose, 0.45% NaCl, 7.5% DMSO, 1% Dextran 40, and 5% HSA; 31.25% Plasma-Lyte A, 31.25% dextrose, 0.45% NaCl, 7.5% DMSO, 1% Dextran 40, and 5% HSA; 50% HSA, 40% PlasmaLyte, and 10% DMSO; and Plasma-Lyte A, 5% HSA, and 10% DMSO.

[0251] In some embodiments, the cell therapy suspension, infusion suspension, cell dispersion, or cell suspension is in a sterile container configured or adapted for cell retention, particularly for freezing and thawing cells (i.e., cryocontainer), such as a cryopreservation bag (e.g., Corning Inc., Glendale, Arizona), CryMACS™ (Miltenyl Biotec, San Diego, California), CryStore™ freezing bag (Origen, Austin, Texas), or KryoSure™ cryopreservation bag (Saint Gobain, Gaithersburg, Maryland), which also serves as an infusion bag when the cells are not frozen (e.g., after thawing). In exemplary embodiments, the container, e.g., infusion bag, contains subject-specific information, such as patient identification information. In some embodiments, the bag is an ethylene vinyl acetate (EVA) infusion bag. In some embodiments, the container (e.g., bag) contains a volume of genetically modified cells in a delivery solution, e.g., a cryopreservation infusion solution. Such volumes can be between 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, and 25 ml at the lower end of the range and 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100 ml at the higher end of the range, e.g., 5-100, 10-50, 10-30, 30-50, or 10-25 ml. 4 ~1×10 10 , or 1 × 10 4 ~1×10 9 , or 1 × 10 4 ~1×10 8、 or 1×10 4 ~1×10 10 , or 1 × 10 4 ~1×10 9 , or 1 × 10 4 ~1×10 8 The genetically modified lymphocytes may be found within a subject after they have been genetically modified and then introduced or reintroduced into the subject. Further details regarding the administration of genetically modified cells are provided herein.

[0252] In one aspect, provided herein is a transduced and / or genetically modified T cell or NK cell comprising, in its genome, a recombinant polynucleotide comprising one or more transcription units operably linked to a promoter active in the T cell and / or NK cell. The transcription unit can encode any of the isolated nucleic acids encoding a CAR provided herein.

[0253] In the methods and compositions disclosed herein, expression of the polypeptide may be controlled by a regulatory element.

[0254] Methods for generating conditionally activatable cells The present disclosure provides methods for generating conditionally activatable cells. The methods typically involve genetic modification of mammalian cells with an expression vector (e.g., a plasmid or virus) or RNA (e.g., in vitro transcribed RNA) containing a nucleotide sequence encoding a conditionally active CAR of the present disclosure. The genetically modified cells are conditionally activatable in the presence of HER2. Genetic modification can be performed in vivo, in vitro, or ex vivo. The cells are typically immune cells (e.g., T lymphocytes, T helper cells, or NK cells), stem cells, progenitor cells, etc. In an exemplary embodiment, the cells are T cells.

[0255] In some cases, genetic modification is performed ex vivo. For example, T lymphocytes, stem cells, T helper cells, or NK cells are obtained from an individual, and the cells obtained from the individual are genetically modified to express the CAR of the present disclosure. The genetically modified cells can be conditionally activated in the presence of HER2. In some cases, the genetically modified cells are activated ex vivo. In other cases, the genetically modified cells are introduced into an individual (e.g., the individual from whom the cells were obtained), and the genetically modified cells are activated in vivo. For example, if HER2 is present on the cell surface of the individual, there is no need to administer an antigen. The genetically modified cells are contacted with an antigen present on the cell surface of the individual, and the genetically modified cells are activated. For example, if the genetically modified cells are T lymphocytes, the genetically modified cells may exhibit cytotoxicity against cells expressing HER2 on their surface to which the CAR binds.

[0256]

[0010] In one aspect, provided herein is a method for ex vivo generation of conditionally activatable T cells and / or NK cells comprising a conditionally binding chimeric antigen receptor (CAR) against HER2, said method comprising: a) enriching peripheral blood mononuclear cells (PBMCs) to isolate PBMCs containing T cells and / or NK cells from isolated blood; b) activating T cells and / or NK cells from enriched PBMCs under effective conditions; c) transducing activated T cells and / or NK cells under effective conditions with the replication-incompetent recombinant retroviral particles, thereby producing genetically modified T cells and / or NK cells, wherein the replication-incompetent recombinant retroviral particles each comprise a retroviral genome comprising one or more nucleic acid sequences operably linked to a promoter active in the T cells and / or NK cells, wherein a first nucleic acid sequence of the one or more nucleic acid sequences encodes a CAB-CAR according to any of the embodiments provided herein; and d) expanding the genetically modified T cells and / or NK cells, thereby generating conditionally activatable T cells and / or NK cells.

[0257] In some embodiments of the above aspects, the method further comprises recovering the expanded genetically modified T cells and / or NK cells. In some embodiments of the above aspects, the method further comprises drawing blood from the subject prior to enriching the PBMCs. In further embodiments, the method further comprises introducing the recovered and expanded genetically modified T cells and / or NK cells into the subject. In further embodiments, the genetically modified T cells and / or NK cells are present in the subject for 1, 2, 3, 4, 5, 6, 7, or 14 days after they are introduced into the subject.

[0258]

[0010] In one aspect, provided herein is a method of ex vivo generating conditionally activatable T cells and / or NK cells comprising a conditionally binding chimeric antigen receptor (CAR) against HER2, said method comprising: a) enriching peripheral blood mononuclear cells (PBMCs) to isolate PBMCs containing T cells and / or NK cells from isolated blood; b) transfecting T cells and / or NK cells with a synthetic RNA, thereby producing genetically modified T cells and / or NK cells, wherein the synthetic RNA comprises one or more nucleic acid sequences operably linked to a promoter active in the T cells and / or NK cells, wherein a first nucleic acid sequence of the one or more nucleic acid sequences encodes a CAB-CAR, according to any embodiment provided herein; and c) expanding the genetically modified T cells and / or NK cells, thereby generating conditionally activatable T cells and / or NK cells.

[0259] Blood collection PBMC-containing blood can be collected or obtained from a subject by any suitable method known in the art. For example, blood can be collected by venipuncture or any other blood collection method that collects a sample of blood and / or PBMCs. In some embodiments, PBMCs can be obtained by apheresis, as discussed below.

[0260] PBMC enrichment In ex vivo methods for generating conditionally activatable T cells and / or NK cells, peripheral blood mononuclear cells (PBMCs), including T cells and / or NK cells, are isolated from other components of a blood sample in an enrichment step. Enrichment of PBMCs from other blood components and blood cells can be performed using any method known in the art, for example, apheresis and / or density gradient centrifugation. In some embodiments, Ficoll-Paque (GE Healthcare) can be used. In some embodiments, an automated apheresis separator is used, which draws blood from a subject, passes the blood through a device that selects specific cell types (e.g., PBMCs), and returns the remainder to the subject. Density gradient centrifugation can be performed after apheresis. In some embodiments, PBMCs can be enriched and isolated using a leukocyte reduction filter device. In some embodiments, magnetic bead-activated cell sorting is then used to purify specific cell populations, e.g., T cells and / or NK cells, from the PBMCs according to their phenotype (i.e., positive selection). In some embodiments, monocytes and / or macrophages can be removed from PBMCs using methods known in the art. The cells can be allogeneic and / or autologous with respect to the subject being treated. During the PBMC enrichment process, one or more washes can be performed before the enriched PBMCs are isolated and subsequently activated, as known in the art. The wash solution can be any solution suitable for washing blood and / or PBMCs. According to methods known in the art, the isolated PBMCs can be resuspended in any suitable basal medium used to culture T cells and / or NK cells. In some embodiments, the medium can be supplemented with HSA, human AB+ serum, subject-derived serum, and / or serum replacement.

[0261] Activation of PBMCs The ex vivo methods for generating conditionally activatable T cells and / or NK cells provided herein typically involve activating or stimulating isolated PBMCs with one or more active agents to generate activated T cells and / or NK cells. Activation can be performed on freshly isolated PBMCs or previously cryopreserved PBMCs. If cryopreserved cells are used, the cells can be thawed using a developed protocol prior to use.

[0262] During activation, a medium such as those known in the art for ex vivo processes is typically present (non-limiting examples include X-VIVO15 (Lonza) or CTS medium (Thermo Fisher)). In some embodiments, the medium can be supplemented with HSA, human AB+ serum, subject-derived serum, and / or serum replacement. In exemplary embodiments, the medium can be supplemented with a serum replacement such as CTS Serum Replacement (Thermo Fisher). In some embodiments, the medium can be supplemented with HSA, human AB+ serum, subject-derived serum, and / or serum replacement.

[0263] Any combination of one or more active agents can be added to the culture medium to produce activated T cells and / or NK cells. Typically, a reaction mixture is formed and activation occurs. In some embodiments, the reaction mixture can be formed by adding one or more active agents to the culture medium. In some embodiments disclosed herein, the one or more active agents are used in an effective amount such that activated T cells and / or NK cells are produced.

[0264] In some embodiments, the active agent may be a polypeptide or antibody (e.g., anti-CD2, anti-CD3, and / or anti-CD28) or functional fragment thereof that targets or binds to a T cell stimulatory or costimulatory molecule, a T cell cytokine, or any other suitable mitogen (e.g., tetradecanoylphorbol acetate (TPA), phytohemagglutinin (PHA), concanavalin A (ConA), lipopolysaccharide (LPS), pokeweed mitogen (PWM)), a natural ligand for a T cell stimulatory or costimulatory molecule, a phosphoantigen, or an aminobisphosphonic acid such as zoledronic acid. Various antibodies and functional fragments thereof are known in the art to activate or stimulate T cells and / or NK cells. In some embodiments, one or more antibodies or functional fragments thereof may be immobilized on a solid surface, such as a bead.

[0265] Transduction of T cells and / or NK cells The ex vivo methods for generating conditionally activatable T cells and / or NK cells provided herein typically include transforming or transducing activated T cells and / or NK cells. In some embodiments of such methods, T cells and / or NK cells are contacted ex vivo with an expression vector, such as a replication-incompetent recombinant retroviral particle, to genetically modify the T cells and / or NK cells. Without being bound by theory, during the contact period, the replication-incompetent recombinant retroviral particle binds to the T cells and / or NK cells, at which point the retrovirus and host cell membranes initiate fusion. Subsequently, through the process of transduction, genetic material from the replication-incompetent recombinant retroviral particle enters the T cells and / or NK cells and is typically integrated into the host cell DNA. Thus, such methods involve genetic modification of T cells and / or NK cells by transduction. Methods for transducing T cells and / or NK cells ex vivo with replication-incompetent recombinant retroviral particles, such as replication-incompetent recombinant lentiviral particles, are known in the art. Exemplary methods are described, for example, in Wang et al. (2012) J. Immunother. 35(9): 689-701, Cooper et al. (2003) Blood. 101: 1637-1644, Verhoeyen et al. (2009) Methods Mol Biol. 506: 97-114, and Cavalieri et al. (2003) Blood. 102(2): 497-505. In some embodiments, T cells and / or NK cells can be contacted with replication-incompetent recombinant retroviral particles. In exemplary embodiments, T cells and / or NK cells can be contacted with replication-incompetent recombinant lentiviral particles.

[0266] Expansion of transduced T cells and / or NK cells In exemplary embodiments of the ex vivo methods for generating conditionally activatable T cells and / or NK cells provided herein, the transduced T cells and / or NK cells are expanded prior to harvest. In any of the embodiments disclosed herein, medium for activation and transduction is present, and medium can be further added or replaced after transduction to carry out expansion. In some embodiments, medium can be added to the reaction mixture formed during activation. Medium for expansion typically includes the same basal medium used for activation and transduction, such as those known in the art for ex vivo processes, particularly for T cells and / or NK cells (non-limiting examples include X-VIVO15 (Lonza) or Optimizer CTS medium (Thermo Fisher)). In some embodiments, the medium can be supplemented with HSA, human AB+ serum, subject-derived serum, and / or serum replacement, such as CTS Serum Replacement (Thermo Fisher). Cytokines such as IL-2, IL-7, or IL-15, or those found in HSA, can be added to the medium before, during, and / or after activation, transduction, and expansion. Cell expansion can be carried out for a specific number of days. In some embodiments, expansion can be carried out for 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 days. In some embodiments, expansion can be carried out for between 4, 5, 6, 7, or 8 days at the low end of the range and 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 days at the high end of the range. In certain exemplary embodiments, expansion is carried out for 6-12 days or 8-10 days.

[0267] Cell harvesting The ex vivo methods of generating conditionally activatable T cells and / or NK cells provided herein typically include harvesting the genetically modified T cells and / or NK cells after expansion. In some embodiments, the transduced T cells and / or NK cells can be enriched or collected during harvest using methods known in the art. In some embodiments, the T cells and / or NK cells can be washed one or more times during harvest using any suitable washing solution known in the art. At the end of harvest, the T cells and / or NK cells can be resuspended in any suitable medium known in the art. In any of the embodiments disclosed herein, harvesting the expanded T cells and / or NK cells can be performed based on a proliferation completion criterion. In some embodiments, the proliferation completion criterion can be lactate concentration, cell density, or number of days of expansion.

[0268] In some embodiments, the collected cells can be introduced, back-introduced, re-introduced, infused, or re-infused into a subject. In some embodiments, the collected cells may be cryopreserved as described below before being reintroduced into a subject. In exemplary embodiments, the collected cells may be introduced, back-introduced, re-introduced, infused, or re-infused into a subject without first cryopreserving the cells. The subject is typically the same subject from which the blood was collected.

[0269] Throughout this disclosure, transduced T cells and / or NK cells include progeny of the transduced cells that retain at least one of the nucleic acids incorporated into the cells during ex vivo transduction. In methods herein that recite "reintroducing" transduced cells, it will be understood that such cells are typically not in a transduced state when taken from the subject's blood.

[0270] Cell introduction / reintroduction In certain embodiments of the ex vivo methods of generating conditionally activatable T cells and / or NK cells disclosed herein, the recovered T cells and / or NK cells can be introduced, back-introduced, re-introduced, infused, or re-infused into a subject for therapeutic effect. The number of re-introduced T cells and / or NK cells can be a predetermined dose, which can be a therapeutically effective amount. In some embodiments, the predetermined dose can depend on the CAR expressed on the cells (e.g., the affinity and density of the antigen-specific targeting region on the transduced T cells and / or NK cells), the type of target cell, the nature of the disease or pathological condition being treated, or a combination thereof. In some embodiments, the predetermined dose of recovered cells can be based on the subject's body weight, e.g., the number of cells per kilogram of the subject (cells / kg). Further details of the modified T cells and / or NK cells in the administered pharmaceutical composition are provided herein, including dose ranges and routes of administration.

[0271] Cell cryopreservation In the ex vivo methods of generating conditionally activatable T cells and / or NK cells provided herein, the collected cells produced by the methods described herein can be cryopreserved in predetermined doses in cryocontainers, such as cryopreservation bags (i.e., cryobags), for subsequent use. Cell cryopreservation methods and reagents are well known in the art. Cryopreservation can include one or more washes and / or enrichment steps for any of the T cells and / or NK cells provided in the embodiments herein. The method can also include forming a cryopreservation mixture or suspension containing the T cells and / or NK cells in a dilute solution, which can be a delivery solution and a suitable cryopreservation solution. In some embodiments, the method can include freezing the cryopreservation mixture, as known in the art.

[0272] As a specific, non-limiting example, once the cells have been formulated for freezing in one or more cryobags, the bags are sealed and placed in a cryo-freezer, such as a CryoMed 7455 (Thermo Fisher), and the bags are frozen using a stepwise temperature ramp from 37° C. to 4° C., followed by a stepwise ramp to −80° C. The cells may then be transferred to liquid nitrogen, for example, after 12-36 hours.

[0273] In some embodiments, a suitable cryopreservation solution may contain one or more non-electrolytes, including small molecules such as sugars, glycerol (trehalose and sucrose), and dimethyl sulfoxide (DMSO), as well as large polymeric molecules (e.g., polyvinylpyrrolidone and hydroxyethyl starch). Further details regarding cryopreservation solutions are provided herein.

[0274] Methods for thawing cryopreserved T cells and / or NK cells are known in the art. For autologous cell introduction / infusion, this typically involves verifying the subject's identity using personal identification information provided on the cryocontainer (e.g., cryobag) prior to reintroduction (i.e., infusion). The infusion volume can then be calculated by determining the body weight, dose, and CAR-positive T cell and / or NK cell density (cells / mL). The cells in the cryocontainer (e.g., cryobag) are then thawed, for example, in a 37°C water bath. Any cell clumps present in the cryocontainer can be removed by agitation. The cell suspension can then be delivered, for example, intravenously, using a syringe or syringe pump at any rate provided herein, such as 0.25-5 ml / min or 0.75-1.25 ml / min.

[0275] Characterization and commercial manufacturing methods The present disclosure provides various methods and compositions that can be used as research reagents in scientific experiments and for commercial production. Such scientific experiments can include, for example, methods for characterizing lymphocytes, such as NK cells, and in exemplary embodiments, T cells, using the methods for genetically modifying, e.g., transducing, lymphocytes provided herein. Such methods can be used, for example, to study lymphocyte activation and the detailed molecular mechanisms that enable activation to transduce such cells. Additionally, provided herein are genetically modified lymphocytes that may be useful, for example, as research tools for better understanding factors that affect T cell proliferation and survival. Such genetically modified lymphocytes, such as NK cells and, in exemplary embodiments, T cells, can further be used in commercial production, for example, to produce specific factors, such as growth factors and immunomodulators, which can be collected and tested or used to produce commercial products.

[0276] Scientific experiments and / or characterization of lymphocytes may include any of the aspects, embodiments, or subembodiments provided herein that are useful for analyzing or comparing lymphocytes. In some embodiments, T cells and / or NK cells may be transduced with a replication-incompetent recombinant retroviral particle provided herein that includes a polynucleotide. In some embodiments, the transduced T cells and / or NK cells may include a polynucleotide that includes a polypeptide of the present disclosure, e.g., a polynucleotide encoding a CAR.

[0277] Methods for activating immune cells The present disclosure provides a method for activating immune cells in vitro, in vivo, or ex vivo. The method typically involves contacting immune cells (in vitro, in vivo, or ex vivo) with HER2, where the immune cells are genetically modified to produce (i.e., express) the conditionally active CAR of the present disclosure. In the presence of HER2, the conditionally active CAR activates the immune cells, thereby producing activated immune cells. Immune cells include, for example, cytotoxic T lymphocytes, NK cells, CD4+ These include T cells, regulatory T (Treg) cells, γδ-T cells, NK-T cells, neutrophils, and the like. In exemplary embodiments, the immune cells are T cells or NK cells, and in particularly exemplary embodiments, the immune cells are T cells, which include NK-T cells. In such exemplary embodiments, the activation is typically activation of the cytotoxic activity of T cells or NK cells. Such methods can be performed using multiple immune cells (e.g., T cells or NK cells). In further exemplary embodiments, the contacting comprises contacting a target mammalian cell expressing HER2 with the immune cell. Such methods of activating T cells or NK cells can be detected by detecting cytokine release by the T cells or NK cells, such as release of IFN-γ or IL-2, increased cytotoxic activity of T cells and / or NK cells against cells expressing HER2, increased intracellular expression of IFNγ and / or IL-2 in T cells or NK cells, increased expression of CD107a and / or CD69 by T cells and NK cells as measured by fluorescence-activated cell sorting (FACS) analysis, and increased proliferation of T cells or NK cells. The Examples herein provide details about some of these methods of detecting T cell and / or NK cell activation.

[0278] Further embodiments provided herein include methods for binding immune cells (e.g., T cells or NK cells) to target mammalian cells, the methods comprising contacting the target mammalian cells with immune cells in vitro, in vivo, or ex vivo, wherein the target mammalian cells express HER2 and the immune cells express any of the CARs provided herein that bind to HER2. Such binding can activate the immune cells. Such methods can be performed using multiple immune cells (e.g., T cells or NK cells). Such binding methods, detected by detecting activation of T cells or NK cells by increased cytokine release and cytotoxic activity, are provided in Example 1 herein.

[0279] In exemplary embodiments herein, the contacting in the immune cell binding or activation method includes contacting immune cells (e.g., T cells or NK cells) in a microenvironment with a pH of less than 7.4. For example, the pH can be less than 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, or 6.9, or in the range of 5.8 to 7.0, or in exemplary embodiments, the range of 6.0 to 6.8, the range of 6.1 to 6.9, the range of 6.2 to 6.8, or between the lower end of the range (6.0, 6.1, 6.2, 6.3, 6.4, and 6.5) and the upper end of the range (6.6, 6.7, 6.8, and 6.9). In such exemplary embodiments, the CAR is any of the CAB-CARs disclosed herein that recognize HER2 as provided herein.

[0280] Contacting genetically modified immune cells (e.g., T lymphocytes, NK cells) with HER2 may increase cytokine production by the immune cells by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10-fold compared to the amount of cytokine produced by the immune cells in the absence of HER2. Contacting genetically modified immune cells (e.g., T lymphocytes, NK cells) with HER2 may increase cytokine secretion by the immune cells by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 75%, at least 2-fold, at least 2.5-fold, at least 5-fold, at least 10-fold, or more than 10-fold compared to the amount of cytokine secreted by the immune cells in the absence of HER2. Cytokines whose production may be increased include, but are not limited to, IL-2 and IFN-γ.

[0281] Contacting genetically modified immune cells (e.g., cytotoxic T lymphocytes) with HER2 can increase the cytotoxic activity of the cytotoxic cells by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10-fold compared to the cytotoxic activity of the cytotoxic cells in the absence of HER2.

[0282] Contacting genetically modified immune cells (e.g., T lymphocytes, NK cells) with HER2 can increase the expression of CD107a and / or CD69 on the cells by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10-fold compared to the expression of CD107a and / or CD69 on the immune cells in the absence of HER2.

[0283] In other embodiments, for example, depending on the host immune cells, contacting the genetically modified host cells with an antigen may increase or decrease cell proliferation, cell survival, cell death, etc.

[0284] Treatment method The present disclosure provides various methods for treating disorders involving the anti-HER2 CAB-CARs provided herein. In some embodiments, the methods utilize the fact that the CAB-CARs of the present disclosure, when present in and expressed by T lymphocytes or NK cells, can mediate cytotoxicity against target cells. With respect to the subject to whom the population of CAB-CAR T cells and / or NK cells provided herein is introduced / administered, the cells can be allogeneic or autologous. Under specific target conditions, the CAB-CARs of the present disclosure bind to antigens present on target cells, thereby mediating target cell killing by T lymphocytes or NK cells genetically modified to produce the CAB-CAR. The ASTR of the CAB-CAR typically binds to antigens present on the surface of target cells. Thus, in a further aspect, the present disclosure provides the use of nucleic acids encoding any of the CAB-CARs provided herein in the manufacture or preparation of a pharmaceutical.

[0285] Target cells include, but are not limited to, cancer cells. Thus, the present disclosure provides a method for killing or inhibiting the growth of target cancer cells, comprising contacting cytotoxic immune effector cells (e.g., cytotoxic T cells or NK cells) genetically modified to produce the CAR, thereby allowing the T lymphocytes or NK cells to recognize antigens present on the surface of the target cancer cells and mediate the killing of the target cells. An exemplary embodiment of such a method provides a method for treating cancer. CAB-CARs are not limited to use for treating cancer or targeting tumors or cancer cells, but rather may be suitable for use in one or more indications, including the treatment of circulatory disorders, arthritis, multiple sclerosis, autoimmune disorders, skin diseases, viral diseases and disorders, as well as for use in various diagnostic formats. In certain exemplary embodiments herein, T cells and / or NK cells expressing or capable of expressing the anti-HER2 CAR provided herein are delivered to a subject with a cancer associated with HER2 protein expression or overexpression. Such cancers include, but are not limited to, breast cancer, ovarian cancer, bladder cancer, gallbladder cancer, lung cancer, cervical cancer, intestinal cancer, extrahepatic or intrahepatic bile duct cancer, salivary duct cancer, esophageal cancer, esophagogastric junction cancer, gastric adenocarcinoma, and gastrointestinal stromal tumors, colon cancer, lung cancer including non-small cell lung cancer and small cell lung cancer, pancreatic cancer such as pancreatic adenocarcinoma, penile cancer, pituitary cancer, prostate cancer, soft tissue sarcoma, sarcoma including peritoneal sarcoma and retroperitoneal sarcoma, solitary fibrous tumor, thymic cancer, thyroid cancer, cervical cancer, uterine cancer, testicular cancer, endometrial cancer, glioblastomas such as glioblastoma multiforme, glioma, oligodendroglioma, head and neck cancer, hepatocellular carcinoma, small intestinal malignancies, melanoma, neuroendocrine tumors, or other cancers that express or overexpress the HER2 protein. HER2 is typically overexpressed in malignant tumors of epithelial origin, as well as cancers derived from mesenchymal, neuroendocrine tissues, the central nervous system, and the kidney; therefore, the antibodies or antibody fragments of the invention may be used to treat these types of cancers.Information about various forms of HER2 expression in cancer can be found, for example, in "HER2 expression status in diverse cancers: review of results from 37,992 patients," Yan, Min et al., Cancer Metastasis Rev., (2015) 34:157-164. Diseases associated with HER2 expression or overexpression include vulvar Paget's disease. In some embodiments, the methods of the present disclosure may include anti-HER2 ASTR and / or CAR for use in inhibiting angiogenesis, inhibiting cell proliferation, inhibiting immune function, inhibiting inflammatory cytokine secretion (e.g., from tumor-associated macrophages), inhibiting tumor vasculature (e.g., intratumoral vasculature or tumor-associated vasculature), and / or inhibiting tumor stromal function. In some embodiments, methods of treating these conditions may include, in exemplary embodiments, anti-HER2 ASTR and / or CAR, and in exemplary embodiments, anti-HER2 CAB CAR T cells and / or NK cells are delivered to a mammalian (e.g., human) subject with a HER2-positive cancer to extend the subject's survival, initiate objective remission, control the cancer, or inhibit cancer progression.

[0286] In certain aspects, the present disclosure provides methods for treating cancer in a subject having cancer. Thus, the present disclosure provides methods for adoptive cell therapy for cancer, particularly for cancers that express HER2, using the anti-HER2 CAB-CARs provided herein. Thus, in one aspect, the method includes: A. introducing an expression vector configured to express a polynucleotide sequence encoding a CAB-CAR against HER2 provided herein into peripheral blood cells obtained from the subject to produce genetically modified cytotoxic cells (such as T cells or NK cells); and B. administering the genetically engineered cytotoxic cells to the subject. Detailed methods for treating T cells to activate, transduce, and typically expand the cells are provided herein, providing an exemplary embodiment of step A above.

[0287] Methods of treatment include providing anti-tumor immunity to a mammal, treating a mammal having a disease, disorder, or condition associated with elevated expression of HER2, treating a human with cancer (e.g., breast cancer, gastric cancer, esophageal cancer, ovarian cancer, endometrial cancer, lung cancer, or urothelial bladder cancer), generating a sustained population of genetically modified T cells in a mammal, expanding a genetically modified T cell population in a human, and stimulating a T cell-mediated immune response against a target cell population or tissue in a mammal (e.g., a human) as provided in the Exemplary Embodiments section herein.

[0288] In certain embodiments of any of the aspects of the embodiments provided herein involving a subject, a mammal, and / or a human, the mammalian (e.g., human) subject has previously been treated with trastuzumab therapy as neoadjuvant or adjuvant therapy. In some embodiments, the mammalian (e.g., human) subject has a recurrent cancer (e.g., recurrent breast cancer) that has recurred after, in certain exemplary embodiments, the mammalian subject was treated with trastuzumab therapy (i.e., Herceptin therapy), or a biosimilar thereof.

[0289] In certain embodiments of any of the aspects of the embodiments provided herein, including a subject, mammal, and / or human, and optionally administering cells to the subject, in exemplary embodiments, the mammal has a HER2-positive cancer. In some embodiments, the HER2-positive cancer is a cancer caused by cells that overexpress HER2. In some embodiments, the overexpression may be 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, or 5-fold compared to similar cells that are not cancerous. In one embodiment, the HER2-positive cancer comprises cells with HER2 gene amplification. In some embodiments, the mammalian subject (e.g., a human) has a tumor, and at least 50% of all tumor cells analyzed are HER2-positive. Methods for detecting and measuring HER2 expression in tumors are known in the art. In some embodiments, HER2 positivity is determined by HER2 expression on the cell surface (e.g., immunohistochemistry (IHC)), gene amplification (e.g., FISH or PCR), or HER2 mRNA expression (e.g., qPCR). In some embodiments, HER2 is positive as determined by a HER2 companion diagnostic, such as, for example, Herceptin.In some embodiments, the HER2 companion diagnostic is FoundOne CDx (Foundation Medicine, Inc.), PathVysion HER-2 DNA probe kit (Abbott Molecular Inc.), InSite Her-2 / neu kit (Biogenex Laboratories, Inc.), INFORM HER-2 / neu (Ventana Medical Systems, Inc.), PATHWAY anti-Her2 / neu (4B5) rabbit monoclonal primary antibody (Ventana Medical Systems, Inc.), INFORM HER2 Dual ISH DNA probe cocktail (Ventana Medical Systems, Inc.), VENTANA HER2 Dual ISH DNA probe cocktail (Ventana Medical Systems, Inc.), SPOT-LIGHT HER2 CISH kit (Life Technologies Corp.), Bond Oracle HER2 IHC system (Leica Biosystems), HER2 CISH pharmDx kit (Dako Denmark A / S), HercepTest (Dako Denmark A / S), or HER2 FISH The pharmDx kit (Dako Denmark A / S) is used. In a non-limiting specific example, HER2 expression is analyzed using standard staining of tumor tissue using Roche HER2 antibody (4B5) and interpreted according to the "Guidelines for HER2 Detection in Breast Cancer (2019 Edition)" and "Guidelines for HER2 Detection in Gastric Cancer (2016 Edition)." In certain embodiments, tumor cells account for 50% or more of all tumor cells. For HER2 3+ solid tumors other than gastric cancer and breast cancer, in exemplary embodiments, FISH is performed to confirm HER2 expression. For patients with recurrence after HER2-targeted therapy, in exemplary embodiments, biopsy and IHC are performed again to detect HER2 expression.

[0290] In some embodiments, the human subject has most, or in an exemplary embodiment, all, of the following blood parameters: hemoglobin (HGB) ≧90 g / L, without transfusion within 2 weeks; white blood cells (WBC) ≧2.5×10 / L; absolute neutrophil count (ANC) ≧1.5×10 / L; platelet count (PLT) ≧80×10 / L; total bilirubin (TBIL) ≦3.0 ng / dL or ≦1.5 ULN; aspartate aminotransferase (AST) and alanine aminotransferase (ALT) ≦2.5×ULN; if the liver function abnormality is due to hepatocellular carcinoma or tumor liver metastasis, AST and ALT are ≦5×ULN, and serum creatinine (Cr) ≦1.5×ULN; or creatinine clearance rate (CrCl) ≧50 mL / min.

[0291] The CAR can be any of the CAB-CARs disclosed herein that recognize HER2, particularly those that are cytotoxic to cancer cells expressing these antigens. An expression vector encoding an anti-HER2 CAB-CAR can be introduced into peripheral blood cells by transducing peripheral blood leukocytes, including T cells and / or NK cells, with the vector. In certain exemplary embodiments, the vector is a recombinant virus, e.g., a recombinant retrovirus, which in some embodiments is a recombinant lentivirus. In some embodiments, the cancer is a HER2-expressing soft tissue sarcoma or mesothelioma, and T cells and / or NK cells of a subject (e.g., a soft tissue sarcoma or mesothelioma patient) are transduced with an anti-HER2 CAR, e.g., an anti-HER2 CAB-CAR disclosed herein.

[0292] The methods of treating a disorder provided herein typically involve administering to a subject genetically modified T cells or NK cells expressing an anti-HER2 CAB-CAR provided herein. In some embodiments, the genetically modified cells are present in a delivery solution, e.g., a cryopreserved delivery solution as described herein. In some embodiments, the delivery solution is in a bag, such as an infusion bag disclosed elsewhere herein. In some embodiments, administration can be intravenous, subcutaneous, or intratumoral. In some embodiments, intravenous administration can include infusion rates between 0.25, 0.5, 0.75, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, and 20 ml / min at the lower end of the range and 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, and 35 ml / min at the upper end of the range, e.g., 5-30, 10-25, or 10-20 ml / min. In some embodiments, administration can occur in a single dose. In some embodiments, administration can occur in two or more separate doses, e.g., three or more, four or more, or five or more separate doses. In some embodiments, a single dose can involve the use of more than one bag, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 bags. In some embodiments, the genetically modified cells are frozen, e.g., in a cryopreservative delivery solution, and must be thawed prior to administration. In some embodiments, the genetically modified cells are in a cell dispersion. In methods in which genetically modified T cells and / or NK cells are administered intravenously, typically, 1×10 4 cells / kg~1×10 10 cells / kg body weight, e.g., 1 x 10 4 ~1×10 9 , e.g., 1 x 10 5 ~1×10 7 of CAR-positive T and / or NK cells / kg body weight are delivered in a buffer suitable for parenteral administration. In some embodiments, administration to a subject weighing 50 kg or less is at 0.2 x 10 6 ~5.0×10 8 , or 0.2 × 10 6 ~5.0×10 6per kg of body weight. In some embodiments, administration to a subject weighing more than 50 kg may contain 0.1 x 10 CAR-positive T and / or NK cells expressing an anti-HER2 CAB-CAR as provided herein. 8 ~6×10 8 CAR-positive T and / or NK cells expressing an anti-HER2 CAB-CAR provided herein, e.g., 0.1 x 10 8 ~2.5×10 8 , or 0.6 × 10 8 ~6×10 8 In methods in which genetically modified T cells and / or NK cells are administered intratumorally, typically 1 x 10 6 CAR positive T cells ~5×10 8 CAR-positive T cells are administered in an isotonic solution. In certain embodiments, the cells are administered at a concentration of 1 x 10 in the delivery suspension. 4 ~1×10 10 cells / ml or 1 x 10 6 ~1×10 9 Concentration is in cells / ml.

[0293] Delivery suspensions typically meet certain quality control release standards. Thus, in certain embodiments, the genetically modified T cells and / or NK cells in the delivery suspension will have a viability of 50% or more, 60% or more, or 70% or more, a CD3 positivity of 40% or more, 50% or more, or 60% or more, and / or (in exemplary embodiments, "and") a CD3 and CAR positivity percentage of 5% or more, 10% or more, or 15% or more. In other embodiments, the genetically modified T cells and / or NK cells in the delivery suspension will have a viability of 50% to 95%, 60% and 95%, or 70% to 95%, a CD3 positivity of 40% to 90%, 50% and 90%, or 60% to 90%, and / or (in exemplary embodiments, "and") a CD3 positivity and CAR positivity of 5% to 50%, 10% to 50%, or 15% to 50%. Furthermore, the genetically modified T cells and / or NK cells in the delivery suspension in exemplary embodiments have, on average, or 60%, 70%, 90%, 90%, 95%, 99%, or all measured, 3 or fewer copies of a CAR-encoding nucleic acid per genome. Further, the delivery suspensions provided herein, in exemplary embodiments, have endotoxin levels of 10 EU / mL or less.

[0294] In some embodiments, the administered lymphocytes may be present in a bag, and in exemplary embodiments, an infusion bag such as a cryo-infusion bag, and in further exemplary embodiments, an infusion bag containing subject-identifying information such as patient identification information. In some embodiments, the bag contains lymphocytes in a volume between 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, and 25 mL at the lower end of the range and 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, and 100 mL at the upper end of the range.

[0295] In some embodiments, an exemplary administration method includes confirming the subject's identity using subject-identifying information (patient-specific information) on a cryobag or infusion bag, or in an exemplary embodiment, a cryobag used for infusion, and administering the genetically modified cells via intravenous infusion at a rate of 10 ml to 20 ml / min (adjusted appropriately for younger children and smaller volumes), where the volume of the infusion bag containing the genetically modified T cells and / or NK cells is between 10 ml and 50 ml. In some embodiments, multiple infusion bags are used in any method involving administration. In some examples, when multiple infusion bags are used in a method involving administration, the next bag is not thawed until the previous infusion bag has been successfully administered. In some examples, the tubing is filled with saline before the infusion bag is administered through the tubing. In some embodiments, the method further includes rinsing the infusion bag with between 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, and 25 ml of saline at the lower end of the range and 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100 ml of saline at the higher end of the range, e.g., 5-100, 10-50, or 10-30 ml of saline, and administering the saline from the infusion bag to the subject.

[0296] In some embodiments, prior to administration of CAR cells to a subject, the subject is administered a drug or treatment (e.g., weight loss, radiation) that can temporarily or definitively affect the activity of the subject's immune system (immunosuppression), such as, for example, a lymphodepleting agent, an agent that depletes T cells, NK cells, and / or B cells, or an agent that reduces the activity of a specific subset of immune cells. In a non-limiting embodiment, the subject is administered a lymphodepleting chemotherapy regimen prior to administering the genetically modified T cells and / or NK cells to the subject. Any of the standard lymphodepleting chemotherapy regimens known in the art of CAR-T therapy can be used with the methods herein. In a non-limiting exemplary embodiment, the chemotherapy regimen includes bendamustine or includes cyclophosphamide and / or fludarabine. In some embodiments, fludarabine is administered at a dose of about 10-50 mg / m 2 (e.g., about 10-15, 15-20, 20-25, 25-30, 30-35, 35-40, 40-45, or 45-50 mg / m 2 In some embodiments, cyclophosphamide is administered intravenously at a dose of about 200-300 mg / m 2 (e.g., about 200-225, 225-250, 250-275, or 275-300 mg / m 2 In some embodiments, bendamustine is administered intravenously at a dose of 50 to 150 mg / m 2 (70-130, 75-125, 75-115, 80-100, 85-95, or 90 mg / m 2 ) is administered, for example, intravenously.

[0297] Fludarabine can be administered for, for example, 2 to 6 days, 2 to 4 days, 3 to 5 days, 3 to 4 days, 4 to 5 days, 3 days, or 4 days, typically consecutive days. Cyclophosphamide, for example, when administered together with fludarabine, can be delivered for 1 to 4 days, 2 to 4 days, 2 to 3 days, or 3 days, typically consecutive days, starting on the same day as fludarabine. Bendamustine can be delivered for, for example, 1 to 4 days, 2 to 4 days, 2 to 3 days, or 3 days. Genetically modified T cells and / or NK cells can be administered to a subject 1 to 21 days, 2 to 14 days, 2 to 10 days, 2 to 7 days, or 2 to 5 days after administration of the lymphodepletion regimen. For example, a subject may be administered lymphodepleting chemotherapy for 1, 2, 3, 4, or 5 days, illustratively 3 consecutive days, 1 to 30, 2 to 15, 2 to 11, 2 to 7, 3 to 5, or 2 to 4 days prior to administration. In some embodiments, the subject's white blood cell count is measured to ensure it exceeds a certain cutoff (e.g., 1 x 10) before administration of the genetically modified T cells and / or NK cells, or no lymphodepleting regimen is administered. In some embodiments, administration precedes, is accompanied by, and / or follows administration of an interleukin or a modified version thereof. For example, some embodiments provided herein include coadministration of IL-2 or a modified version of IL-2 that has sustained release and / or binds to a specific IL-2 receptor that biases T cell proliferation and / or killing activity toward activation. For example, the modified IL-2, in certain embodiments, is pegylated IL-2 and may be NKTR-214 (Nektar Therapeutics, San Francisco, CA). In another embodiment, the modified IL-2 is ALKS4230 (Alkermes, Inc.).

[0298] Carcinomas amenable to treatment by the methods disclosed herein include, but are not limited to, esophageal carcinoma, hepatocellular carcinoma, basal cell carcinoma (a form of skin cancer), squamous cell carcinoma (various tissues), bladder carcinoma including transitional cell carcinoma (malignant neoplasm of the bladder), bronchogenic carcinoma, colon cancer, colorectal carcinoma, gastric cancer, lung cancer including small cell carcinoma and non-small cell lung carcinoma, adrenocortical carcinoma, thyroid carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, renal cell carcinoma, intraductal carcinoma in situ or bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, cervical cancer, uterine cancer, testicular cancer, osteogenic carcinoma, epithelial carcinoma, and nasopharyngeal carcinoma.

[0299] Sarcomas amenable to treatment with the methods disclosed herein include, but are not limited to, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, chordoma, osteogenic sarcoma, osteosarcoma, angiosarcoma, endothelial sarcoma, lymphangiosarcoma, lymphangioendothelial sarcoma, synovioma, mesothelioma, Ewing's sarcoma, leiomyosarcoma, rhabdomyosarcoma, and other soft tissue sarcomas.

[0300] Other solid tumors amenable to treatment with the methods disclosed herein include, but are not limited to, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, chordoma, osteogenic sarcoma, osteosarcoma, angiosarcoma, endothelioma, lymphangiosarcoma, lymphangioendothelioma, synovioma, mesothelioma, Ewing's sarcoma, leiomyosarcoma, rhabdomyosarcoma, and other soft tissue sarcomas.

[0301] Other cancers amenable to treatment with the methods disclosed herein include atypical meningioma (brain), islet cell carcinoma (pancreas), medullary carcinoma (thyroid), mesenchymoma (intestine), hepatocellular carcinoma (liver), hepatoblastoma (liver), clear cell carcinoma (kidney), and mediastinal neuroblastoma.

[0302] In some embodiments, cancers that can be treated with the methods disclosed herein include HER2-positive tumors or cancers. In some embodiments, cancers that can be treated with the methods disclosed herein include breast cancer, gastric cancer, esophageal cancer, ovarian cancer, endometrial cancer, lung cancer, or urothelial bladder cancer. In some embodiments, the subject's cancer is a recurrent or refractory HER2-positive solid tumor. The tumor may be an advanced solid tumor with stage IV TNM staging (according to the 8th edition of the AJCC) confirmed by histology or cytology that has failed standard therapy. In certain embodiments, there is at least one measurable lesion with a non-lymph node lesion with a longest axis of ≥10 mm or a lymph node lesion with a shortest axis of ≥15 mm by CT or magnetic resonance imaging (MRI) according to RECIST 1.1 criteria. In some embodiments, the subject may have an Eastern Cooperative Oncology Group (ECOG) Performance Score (PS) of 0 to 1.

[0303] Enhancement of the host's immune function to fight tumors can be used in conjunction with the methods of the present invention. Conventional methods include (i) APC enhancement, such as (a) injecting DNA encoding exogenous MHC alloantigens into tumors, or (b) transfecting biopsied tumor cells with genes that increase the likelihood of cellular immune antigen recognition (e.g., immunostimulatory cytokines, GM-CSF, costimulatory molecules B7.1, B7.2); (iii) adoptive cellular immunotherapy, or treatment with activated tumor-specific T cells. Adoptive cellular immunotherapy involves isolating tumor-infiltrating host T lymphocytes and expanding the population in vitro, such as through stimulation with IL-2, tumor, or both. In addition, isolated dysfunctional T cells can also be activated by in vitro application of anti-PD-LCDR1 antibodies. These activated T cells can then be readministered to the host. One or more of these methods can be used in combination with the CAR-T method provided herein.

[0304] Combination therapy In some embodiments, the anti-HER2 CAR cells (e.g., T cells and / or NK cells) of any of the aspects and embodiments provided herein are administered to cancers / patients resistant to standard cancer therapy in combination with standard cancer therapy or as adjuvant therapy. In an exemplary embodiment, the mammalian (e.g., human) subject of the methods herein has a recurrent solid tumor that is resistant to anti-HER2 antibody therapy, such as trastuzumab therapy, or is HER2-positive. Such methods combine any method or composition in a method comprising administering any of the anti-HER2 CAR cells provided herein or RNA encoding an anti-HER2 CAR provided herein and administering standard cancer therapy. Standard cancer therapy includes surgery (e.g., surgical removal of cancerous tissue), radiation therapy (e.g., radiotherapy, X-ray therapy, irradiation), or the use of ionizing radiation to kill cancer cells and shrink tumors. Radiation therapy can be administered externally via external beam radiation therapy (EBRT) or internally via brachytherapy. Other options include bone marrow transplantation, chemotherapy or the application of cytotoxic drugs that generally affect rapidly dividing cells, targeted therapy or drugs that specifically affect non-regulated proteins in cancer cells (e.g., tyrosine kinase inhibitors imatinib, gefitinib; monoclonal antibodies, photodynamic therapy), biologic response modifier therapy, immunotherapy or enhancing the host's immune response (e.g., vaccines), hormone therapy or hormone blockade (e.g., if the tumor is hormone-sensitive), angiogenesis inhibitors or blockade of angiogenesis and growth, and palliative care or treatments aimed at improving quality of care to reduce pain, nausea, vomiting, diarrhea, and bleeding. Painkillers such as morphine and oxycodone, and antiemetics such as ondansetron and aprepitant may allow for more aggressive treatment regimens and certain combinations of the aforementioned.

[0305] Radiation therapy includes, but is not limited to, X-rays or gamma rays delivered from a source such as an externally applied beam or by implanted small radioactive sources.

[0306] Suitable antibodies for use in cancer therapy include naked antibodies, such as trastuzumab (Herceptin (anti-HER2)), bevacizumab (Avastin™), cetuximab (Erbitux™), panitumumab (Vectibix™), ipilimumab (Yervoy™), rituximab (Rituxan), alemtuzumab (LEMTRADA™), ofatumumab (Arzera™), oregovomab (Ovarex™), lambrolizumab (MK-3475), pertuzumab (Perjeta™), ranibizumab (Lucentis™), and the like, and conjugated antibodies, such as gemtuzumab ozogamicin (Mylortarg™), brentuximab vedotin, 90 Y-labeled ibritumomab tiuxetan (Zevalin™), 131 Suitable antibodies for use in cancer therapy include, but are not limited to, I-labeled tositumomab (Adcetris™), (Bexar™), and the like. Suitable antibodies for use in cancer therapy include antibodies raised against tumor-associated antigens. Such antigens include CD20, CD30, CD33, CD52, EpCAM, CEA, gpA33, mucins, TAG-72, CAIX, PSMA, folate-binding proteins, gangliosides (e.g., GD2, GD3, GM2, etc.), Le y , VEGF, VEGFR, integrin alpha-V-beta-3, integrin alpha-5-beta-1, EGFR, ERBB2, ERBB3, MET, IGF1R, EPHA3, TRAILR1, TRAILR2, RANKL, PAP, tenascin, and the like.

[0307] In exemplary embodiments herein, the anti-cancer antibody therapeutic is an anti-HER2 antibody biologic, such as trastuzumab or its biosimilar, e.g., trastuzumab-ANNS (Kanjinti™ (Amgen, Thousand Oaks, CA)). As shown in Example 5, the anti-HER2 CARs provided herein can be effectively administered to patients who are resistant to Herceptin therapy. Thus, in some embodiments, the subject or source or T cells and / or NK cells of any aspect or embodiment herein can be a subject who has received or is receiving trastuzumab or a biosimilar thereof therapy, or a subject who is resistant to such therapy, or a subject who experiences significant adverse events from trastuzumab therapy, and in some examples, is allergic to trastuzumab therapy.

[0308] Biological response modifiers suitable for use in connection with the methods of the present disclosure include, but are not limited to, (1) inhibitors of tyrosine kinase (RTK) activity; (2) inhibitors of serine / threonine kinase activity; (3) tumor-associated antigen antagonists, e.g., antibodies that specifically bind to tumor antigens; (4) apoptosis receptor agonists; (5) interleukin-2; (6) interferon alpha; (7) interferon gamma; (8) colony-stimulating factors; (9) angiogenesis inhibitors; and (10) antagonists of tumor necrosis factor.

[0309] Chemotherapeutic agents are non-peptide (i.e., proteinaceous) compounds that reduce the proliferation of cancer cells and include cytotoxic drugs and cytostatic agents. Non-limiting examples of chemotherapeutic agents include alkylating agents, nitrosoureas, antimetabolites, antitumor antibiotics, plant (vinca) alkaloids, and steroid hormones.

[0310] Drugs that act to reduce cell proliferation are known in the art and are widely used. Such drugs include alkylating agents such as nitrogen mustards, nitrosoureas, ethyleneimine derivatives, alkyl sulfonates, and triazenes, including, but not limited to, mechlorethamine, cyclophosphamide (Cytoxan™), melphalan (L-sarcolysin), carmustine (BCNU), lomustine (CCNU), semustine (methyl-CCNU), streptozocin, chlorozotocin, uracil mustard, chlormethine, ifosfamide, chlorambucil, pipobroman, triethylenemelamine, triethylenethiophosphoramine, busulfan, dacarbazine, and temozolomide.

[0311] Antimetabolites include folic acid analogs, pyrimidine analogs, purine analogs, and adenosine deaminase inhibitors, including, but not limited to, cytarabine (CYTOSAR-U), cytosine arabinoside, fluorouracil (5-FU), floxuridine (FudR), 6-thioguanine, 6-mercaptopurine (6-MP), pentostatin, 5-fluorouracil (5-FU), methotrexate, 10-propargyl-5,8-dideazafolate (PDDF, CB37 l 7), 5,8-dideazatetrahydrofolic acid (DDATHF), leucovorin, fludarabine phosphate, pentostatin, and gemcitabine.

[0312] Suitable natural products and their derivatives (e.g., vinca alkaloids, antitumor antibiotics, enzymes, lymphokines, and epipodophyllotoxins) include Ara-C, paclitaxel (Taxol®), docetaxel (Taxotere®), deoxycoformycin, mitomycin-C, L-asparaginase, azathioprine; brequinar; alkaloids, e.g., vincristine, vinblastine, vinorelbine, vindesine, etc.; podophyllotoxins, e.g., etoposide, teniposide, etc.; antibiotics, e.g., anthracyclines, daunorubicin hydrochloride (daunomycin, phenoxyzolidinone cyclopeptides, e.g., dactinomycin; basic glycopeptides, e.g., bleomycin; anthraquinone glycosides, e.g., plicamycin (mithramycin); anthracenediones, e.g., mitoxantrone; azirinopyrroloindolediones, e.g., mitomycin; macrocyclic immunosuppressants, e.g., cyclosporine, FK-506 (tacrolimus, prograf), rapamycin, etc.; and the like.

[0313] Other antiproliferative cytotoxic agents are navelbene, CPT-11, anastrozole, letrazole, capecitabine, reloxafine, cyclophosphamide, ifosfamide, and droloxafine.

[0314] Microtubule disrupting agents with antiproliferative activity are also suitable for use, including allocolchicine (NSC 406042), halichondrin B (NSC 609395), colchicine (NSC 757), colchicine derivatives (e.g., NSC 33410), dolastatin 10 (NSC 376128), maytansine (NSC 153858), rhizoxin (NSC 332598), paclitaxel (Taxol®, Taxol® derivatives, docetaxel (Taxotere®), thiocolchicine (NSC 361792), trityl cysteine), vinblastine sulfate, vincristine sulfate; natural and synthetic epothilones, including (but not limited to) epothilone A, epothilone B, discodermolide, estramustine, nocodazole, and the like.

[0315] Hormone modulators and steroids (including synthetic analogs) suitable for use include corticosteroids, such as prednisone, dexamethasone, and the like; estrogens and progestins, such as hydroxyprogesterone caproate, medroxyprogesterone acetate, megestrol acetate, estradiol, clomiphene, tamoxifen, and the like; and adrenocortical suppressants, such as aminoglutethimide; These include, but are not limited to, 7a-ethinylestradiol; diethylstilbestrol, testosterone, fluoxymesterone, dromostanolone propionate, testolactone, methylprednisolone, methyltestosterone, prednisolone, triamcinolone, chlorotrianisene, hydroxyprogesterone, aminoglutethimide, estramustine, medroxyprogesterone acetate, leuprolide, flutamide (Drogenil), toremifene (Fareston), and Zoladex (registered trademark). Estrogen stimulates proliferation and differentiation, and therefore compounds that bind to estrogen receptors are used to block this activity. Corticosteroids can inhibit T cell proliferation.

[0316] Other chemotherapeutic agents include metal complexes, such as cisplatin (cis-DDP), carboplatin, and the like; ureas, such as hydroxyurea; and hydrazines, such as N-methylhydrazine; epipodophyllotoxins; topoisomerase inhibitors; procarbazine; mitoxantrone; leucovorin; tegafur; etc. Other notable antiproliferative agents include immunosuppressants, such as mycophenolic acid, thalidomide, deoxyspergualin, azasporin, leflunomide, mizoribine, azaspirane (SKF105685); Iressa® (ZD1839, 4-(3-chloro-4-fluorophenylamino)-7-methoxy-6-(3-(4-morpholinyl)propoxy)quinazoline); and the like.

[0317] "Taxane" includes paclitaxel, as well as any active taxane derivative or prodrug. "Paclitaxel" (which should be understood herein to include analogs, formulations, and derivatives, such as docetaxel, Taxol™, Taxotere™ (a formulation of docetaxel), the 10-desacetyl analog of paclitaxel, and the 3'N-desbenzoyl-3'Nt-butoxycarbonyl analog of paclitaxel) can be readily made using techniques known to those skilled in the art (WO 94 / 07882). , 94 / 07881, 94 / 07880, 94 / 07876, 93 / 23555, 93 / 10076; U.S. Patent Nos. 5,294,637; 5,283,253; 5,279,949; 5,274,137; 5,202,448; 5,200,534; 5,229,529; and European Patent No. 590,267), or can be obtained from a variety of commercial sources, including, for example, Sigma Chemical Co., St. Louis, Mo. (T7402 derived from European yew; or T-1912 derived from Hong Dong).

[0318] Paclitaxel should be understood to refer not only to the generally chemically available forms of paclitaxel, but also to analogs and derivatives (e.g., Taxotere™ docetaxel, as discussed above) and paclitaxel conjugates (e.g., paclitaxel-PEG, paclitaxel-dextran, or paclitaxel-xylose).

[0319] The term "taxane" also includes various known derivatives, including hydrophilic and hydrophobic derivatives. Taxane derivatives include, but are not limited to, the galactose and mannose derivatives described in WO 99 / 18113; other derivatives described in WO 99 / 14209; taxane derivatives described in WO 99 / 09021, WO 98 / 22451, and U.S. Pat. No. 5,869,680; 6-thio derivatives described in WO 98 / 28288; sulfenamide derivatives described in U.S. Pat. No. 5,821,263; and taxol derivatives described in U.S. Pat. No. 5,415,869. Taxanes also include prodrugs of paclitaxel, including, but not limited to, those described in WO 98 / 58927; WO 98 / 13059; and U.S. Pat. No. 5,824,701.

[0320] Exemplary Embodiments The present disclosure provides a chimeric antigen receptor (CAR) that binds to HER2, a conditionally active CAR that binds to HER2, and a nucleic acid that comprises a nucleotide sequence that encodes such a CAR.The present disclosure also provides a genetically modified cell that produces CAR, and a method for producing such a cell.The CAR of the present disclosure can be used in various methods that are also provided, including a method for performing adoptive cell therapy, such as CAR therapy for cancer.

[0321] Some non-limiting exemplary aspects and embodiments are provided in this section. In one aspect, provided herein is an isolated nucleic acid encoding a chimeric antigen receptor (CAR) for binding to HER2, the CAR comprising: a) an antigen-specific targeting region (ASTR) that specifically binds to the HER2 protein; b) a transmembrane domain, and c) an ASTR comprising an intracellular activation domain, wherein a transmembrane domain is located between the ASTR and the intracellular activation domain, and the ASTR comprises a heavy chain variable region comprising three complementarity determining regions (CDRs), the CDRs having the sequences HCDR1, HCDR2, and HCDR3, wherein the HCDR1 sequence is GFNIKDTYIH (SEQ ID NO: 131), the HCDR2 sequence is X1IYPTNGYTX2YADSVKG (SEQ ID NO: 137), and the HCDR3 sequence is WGGDGFYAMDY (SEQ ID NO: No. 133), and ASTR comprises a light chain variable region comprising three CDRs having the sequences LCDR1, LCDR2, and LCDR3, wherein the LCDR1 sequence is RASQDVNTX3VA (SEQ ID NO: 142), the LCDR2 sequence is SASFLYS (SEQ ID NO: 135), and the LCDR3 sequence is QQX4YTTPPT (SEQ ID NO: 143), wherein X1 is R or K, X2 is R or E, X3 is A or D, and X4 is H, D, or E, and wherein any combination of X1, X2, X3, and X4 of ASTR is other than R, R, A, and H, respectively.

[0322] In some embodiments of this immediately above aspect and any other aspect provided herein, X1, X2, X3, and X4 of ASTR are R, R, A, and H, respectively. In exemplary embodiments of this immediately above aspect and any other aspect provided herein, X1, X2, X3, and X4 of ASTR are other than R, R, A, and H, respectively. In some embodiments, X1, X2, X3, and X4 of the heavy chain variable region and the light chain variable region are other than R, R, A, and H, respectively. 1、X2, X3, and X4 can be R, R, D, and H, respectively (VL-A032D), R, R, A, and D, respectively (VL-H091D), R, R, A, and E, respectively (VL-H091E), K, R, A, and H, respectively (H-R050V), or R, E, A, and H, respectively (VH-R059E). In some embodiments, the remainder of the ASTR comprises a heavy chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the heavy chain variable region (framework regions of the heavy chain variable region) of SEQ ID NO: 119 excluding the CDRs, and a light chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the light chain variable region (framework regions of the light chain variable region) of SEQ ID NO: 122 excluding the CDRs. The FRs of SEQ ID NO: 119 include residues 1-25, residues 36-49, residues 67-98, and residues 110-120. The FRs of SEQ ID NO: 122 include residues 1-23, residues 35-49, residues 57-88, and residues 98-107.

[0323] In another aspect, a chimeric antigen receptor (CAR) for binding to HER2 is provided, the CAR comprising: a) an antigen-specific targeting region (ASTR) that specifically binds to the HER2 protein; b) a transmembrane domain, and c) an intracellular activation domain, wherein the transmembrane domain is located between the ASTR and the intracellular activation domain, and the ASTR comprises a heavy chain variable region comprising three complementarity determining regions (CDRs), the CDRs having the sequences HCDR1, HCDR2, and HCDR3, wherein the HCDR1 sequence is GFNIKDTYIH (SEQ ID NO: 131), the HCDR2 sequence is X1IYPTNGYTX2YADSVKG (SEQ ID NO: 137), and the HCDR3 sequence is WGGDGFYAMDY (SEQ ID NO: 133); The LCDR1 sequence is RASQDVNTX3VA (SEQ ID NO: 142), the LCDR2 sequence is SASFLYS (SEQ ID NO: 135), and the LCDR3 sequence is QQX4YTTPPT (SEQ ID NO: 143), wherein X1 is R or K, X2 is R or E, X3 is A or D, and X4 is H, D, or E, and the combination of X1, X2, X3, and X4 of ASTR is other than R, R, A, and H, respectively.

[0324] In some embodiments of this immediately above aspect and any other aspect provided herein, X1, X2, X3, and X4 of ASTR are R, R, A, and H, respectively. In exemplary embodiments of this immediately above aspect and any other aspect provided herein, X1, X2, X3, and X4 of ASTR are other than R, R, A, and H, respectively. In some embodiments, X1, X2, X3, and X4 of the heavy and light chain variable regions can be R, R, D, and H, respectively (VL-A032D), R, R, A, and D, respectively (VL-H091D), R, R, A, and E, respectively (VL-H091E), K, R, A, and H, respectively (H-R050V), or R, E, A, and H, respectively (VH-R059E). In some embodiments, the remainder of the ASTR comprises a heavy chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the heavy chain variable region of SEQ ID NO: 119 excluding the CDRs (framework regions of the heavy chain variable region), and a light chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the light chain variable region of SEQ ID NO: 122 excluding the CDRs (framework regions of the light chain variable region).

[0325] In exemplary embodiments, the ASTR of any of the anti-HER2 CARs provided in the aspects above comprises a 5-50 (e.g., 10-40, 15-30) amino acid linker between the heavy and light chain variable regions. In some embodiments, an ASTR for any aspect or embodiment herein has heavy and light chain variable region sequences that are at least 70%, 80%, 85%, 90%, 95, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 119 and SEQ ID NO: 122, respectively, and includes one, two, three, or all four of: X1 as K, X2 as E, X3 as D, and X4 as D or E. In some embodiments, the ASTR has heavy and light chain variable region sequences that are identical to SEQ ID NO: 119 and SEQ ID NO: 122, respectively, except for one, two, three, or all four of: X1 as K, X2 as E, X3 as D, and X4 as D or E.

[0326]

[0013] In another aspect, provided herein is an isolated nucleic acid encoding a chimeric antigen receptor (CAR) for binding to HER2, the CAR comprising: a) an antigen-specific targeting region (ASTR) that specifically binds to the HER2 protein; b) a transmembrane domain, and c) an intracellular activation domain, wherein the transmembrane domain is located between the ASTR and the intracellular activation domain; the ASTR comprises a heavy chain variable region comprising three complementarity determining regions (CDRs), the CDRs having the sequences HCDR1, HCDR2, and HCDR3, the HCDR1 sequence being GFX1IKDTYIH (SEQ ID NO: 138), the HCDR2 sequence being RIX2PTX3X4YX5RYADSVKG (SEQ ID NO: 139), and the HCDR3 sequence being WGGDGFYX6MDY (SEQ ID NO: 140); the ASTR can comprise a light chain variable region comprising three CDRs, the CDRs having the sequences LCDR1, LCDR2, LCDR3, 2, and LCDR3, wherein the LCDR1 sequence is RASQDVNTX7VA (SEQ ID NO: 142), the LCDR2 sequence is SASFLYS (SEQ ID NO: 135), and the LCDR3 sequence is QQX8YTTPPT (SEQ ID NO: 143), wherein X1 is N or W, X2 is Y, D, or K, X3 is N or A, X4 is G or K, X5 is T or D, X6 is A or E, X7 is A or D, and X8 is H, D, or E, and the combinations of X1, X2, X3, X4, X5, X6, X7, and X8 of ASTR are other than N, Y, N, G, T, A, A, and H, respectively. In some embodiments, the remainder of the ASTR comprises a heavy chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the heavy chain variable region of SEQ ID NO: 119 excluding the CDRs (framework regions of the heavy chain variable region), and a light chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the light chain variable region of SEQ ID NO: 122 excluding the CDRs (framework regions of the light chain variable region). In some embodiments, the ASTR can comprise the heavy chain variable region mutation S119E numbered in SEQ ID NO: 119, and in some embodiments, the X of the ASTR 1、X 2 、 The combinations of X3, X4, X5, X6, X7, and X8 are N, Y, N, G, T, A, A, and H, respectively, and the ASTR comprises the heavy chain mutation S119E numbered in SEQ ID NO: 119.

[0327] In another aspect, a chimeric antigen receptor (CAR) for binding to HER2 is provided, the CAR comprising: a) an antigen-specific targeting region (ASTR) that specifically binds to the HER2 protein; b) a transmembrane domain, and c) an intracellular activation domain, wherein the transmembrane domain is located between the ASTR and the intracellular activation domain; the ASTR comprises a heavy chain variable region comprising three complementarity determining regions (CDRs), the CDRs having the sequences HCDR1, HCDR2, and HCDR3, the HCDR1 sequence being GFX1IKDTYIH (SEQ ID NO: 138), the HCDR2 sequence being RIX2PTX3X4YX5RYADSVKG (SEQ ID NO: 139), and the HCDR3 sequence being WGGDGFYX6MDY (SEQ ID NO: 140); the ASTR can comprise a light chain variable region comprising three CDRs, the CDRs having the sequences LCDR1, LCDR2, LCDR3, 2, and LCDR3, wherein the LCDR1 sequence is RASQDVNTX7VA (SEQ ID NO: 142), the LCDR2 sequence is SASFLYS (SEQ ID NO: 135), and the LCDR3 sequence is QQX8YTTPPT (SEQ ID NO: 143), wherein X1 is N or W, X2 is Y, D, or K, X3 is N or A, X4 is G or K, X5 is T or D, X6 is A or E, X7 is A or D, and X8 is H, D, or E, and the combinations of X1, X2, X3, X4, X5, X6, X7, and X8 of ASTR are other than N, Y, N, G, T, A, A, and H, respectively. In some embodiments, the remainder of the ASTR comprises a heavy chain variable region that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or identical to the heavy chain variable region (framework regions of the heavy chain variable region) of SEQ ID NO: 119 excluding the ...

Claims

1. A nucleic acid encoding a chimeric antigen receptor (CAR) for binding to HER2, the CAR comprising: a) an antigen-specific targeting region (ASTR) that binds to the HER2 protein; b) a transmembrane domain, and c) an intracellular activation domain, wherein the transmembrane domain is located between the ASTR and the intracellular activation domain, and the ASTR comprises a heavy chain variable region comprising three complementarity determining regions (CDRs), wherein the CDRs have the sequences HCDR1, HCDR2, and HCDR3; the HCDR1 sequence is GFNIKDTYIH (SEQ ID NO: 131); the HCDR2 sequence is X1IYPTNGYTX2YADSVKG (SEQ ID NO: 137); the HCDR3 sequence is WGGDGFYAMDY (SEQ ID NO: 133); the ASTR comprises a light chain variable region comprising three CDRs having the sequences LCDR1, LCDR2, and LCDR3; the LCDR1 sequence is RASQDVNTX3VA (SEQ ID NO: 142); the LCDR2 sequence is SASFLYS (SEQ ID NO: 135); the LCDR3 sequence is QQX4YTTPPT (SEQ ID NO: 143); wherein the combinations of X1, X2, X3, and X4 are K, R, A, and H; K, E, A, and H; R, R, D, and H; K, E, D, and H; R, R, A, and D; R, R, D, and D; K, R, D, and D; K, E, D, and D; R, R, A, and E; K, E, A, and E; K, R, D, and E; or K, E, D, and E; and The nucleic acid, wherein the CAR is a conditionally active CAR that has increased anti-HER2 CAR activity at a pH of 6.7 compared to a pH of 7.

4.

2. A chimeric antigen receptor (CAR) for binding to HER2, encoded by the nucleic acid of claim 1.

3. 10. A modified T cell, comprising the nucleic acid of claim 1 operably linked to a promoter, a) the modified T cell comprises a nucleic acid of claim 1, or b) A modified T cell, wherein a recombinant nucleic acid vector comprising the nucleic acid of claim 1 is associated with said modified T cell.

4. wherein the combinations of X1, X2, X3, and X4 are R, R, D, and H, respectively; R, R, A, and D, respectively; R, R, A, and E, respectively; or K, R, A, and H, respectively.

5. 5. The nucleic acid of claim 1 or 4, the CAR of claim 2 or 4, or the modified T cell of claim 3 or 4, wherein the sequence of the heavy chain variable region is at least 90% identical to SEQ ID NO:

119.

6. 6. The nucleic acid of any one of claims 1, 4 or 5, the CAR of any one of claims 2, 4 or 5, or the modified T cell of any one of claims 3 to 5, wherein the sequence of the light chain variable region is at least 90% identical to SEQ ID NO:

122.

7. The nucleic acid of any one of claims 1 or 4 to 6, the CAR of any one of claims 2 or 4 to 6, or the modified T cell of any one of claims 3 to 6, wherein the ASTR is a single-chain variable fragment comprising a heavy chain variable region and a light chain variable region.

8. The nucleic acid of any one of claims 1 or 4 to 7, the CAR of any one of claims 2 or 4 to 7, or the modified T cell of any one of claims 3 to 7, wherein the heavy chain and light chain are separated by a linker, and the linker is 5 to 50 amino acids in length.

9. The nucleic acid of any one of claims 1 or 4 to 7, the CAR of any one of claims 2 or 4 to 7, or the modified T cell of any one of claims 3 to 7, wherein the heavy chain variable region and the light chain variable region are separated by a linker, and the linker comprises one of the sequences of SEQ ID NOs: 1, 63-71, 144, 152, or 249.

10. The nucleic acid of any one of claims 1 or 4 to 9, the CAR of any one of claims 2 or 4 to 9, or the modified T cell of any one of claims 3 to 9, wherein the heavy chain is N-terminal to the light chain.

11. 10. The nucleic acid of any one of claims 1 or 4 to 9, the CAR of any one of claims 2 or 4 to 9, or the modified T cell of any one of claims 3 to 9, wherein the light chain is N-terminal to the heavy chain.

12. The nucleic acid described in claim 1, the CAR described in claim 2, or the modified T cell described in claim 3, wherein the ASTR comprises any one of the amino acid sequences of SEQ ID NOs: 157, 160, 171, or 175.

13. The nucleic acid described in claim 1, the CAR described in claim 2, or the modified T cell described in claim 3, wherein the ASTR comprises any one of the amino acid sequences of SEQ ID NOs: 158, 161, 164, 165, 167, or 176.

14. The nucleic acid of claim 1, the CAR of claim 2, or the modified T cell of claim 3, wherein the ASTR comprises any one of the amino acid sequences of SEQ ID NOs: 159, 162, 168-170, or 172-174.

15. The nucleic acid described in claim 1, the CAR described in claim 2, or the modified T cell described in claim 3, wherein the ASTR comprises any one of the amino acid sequences of SEQ ID NOs: 163, 166, 177, or 178.

16. 16. The nucleic acid of any one of claims 1 or 4 to 15, the CAR of any one of claims 2 or 4 to 15, or the modified T cell of any one of claims 3 to 15, wherein the CAR further comprises a stalk domain, and the CAR comprises, from amino terminus to carboxy terminus, the ASTR, the stalk domain, the transmembrane domain, and the intracellular activation domain.

17. The nucleic acid, CAR, or modified T cell described in claim 16, wherein the stalk domain is a CD8 stalk domain.

18. The nucleic acid, CAR, or modified T cell described in claim 17, wherein the CAR comprises the amino acid sequence of SEQ ID NO:

24.

19. The nucleic acid, CAR, or modified T cell described in any one of claims 16 to 18, wherein the CAR further comprises a costimulatory domain, the CAR comprising, from the amino terminus to the carboxy terminus, the ASTR, the stalk domain, the transmembrane domain, the costimulatory domain, and the intracellular activation domain, wherein the costimulatory domain comprises an ICΔ costimulatory domain, a CD28 costimulatory domain, or a CD137 costimulatory domain, or both an ICΔ costimulatory domain and a CD137 costimulatory domain, or both a CD28 costimulatory domain and a CD137 costimulatory domain.

20. The nucleic acid, CAR, or modified T cell described in claim 19, wherein the costimulatory domain is the CD137 costimulatory domain, and the CD137 costimulatory domain comprises the amino acid sequence of SEQ ID NO:

53.

21. A nucleic acid, CAR, or modified T cell described in any one of claims 16 to 20, wherein the intracellular activation domain comprises the amino acid sequence of SEQ ID NO: 28.

Images