Treatment of eye diseases with fructosyl amino acid oxidase

Abstract

The present invention relates to the application of the enzyme fructosyl amino acid oxidase (FAOD) - without the addition of proteases - in medical and cosmetic conditions characterized by the presence of advanced glycation end products (AGEs). More specifically, the present invention relates to the treatment of eye diseases in humans or animals. AGEs accumulate in the aging eye and cause presbyopia, cataracts, dry eye, age-related macular degeneration, glaucoma and diabetic retinopathy. Thus, the present invention relates to the application of FAOD to deglycate and inactivate said AGEs.

Description

[Technical Field]

[0001] FIELD OF THE INVENTION The present invention relates to the application of the enzyme fructosyl amino acid oxidase (FAOD)—without the addition of proteases—in medical conditions characterized by the presence of advanced glycation end products (AGEs). More specifically, the present invention relates to the treatment of eye diseases in humans or animals. AGEs accumulate in the aging eye and contribute to presbyopia, cataracts, dry eye, age-related macular degeneration, glaucoma, and diabetic retinopathy. Therefore, the present invention relates to the in vivo application of FAODs to deglycate and inactivate said AGEs. [Background technology]

[0002] Background of the Invention Protein glycation is an aging process in which metabolically important sugars react with primary amine groups to form adducts that can rearrange and further react, ultimately leading to protein-protein cross-linking (the Maillard reaction). (1) This aging process of protein glycation occurs particularly in organs with long-lived proteins, such as the eyes and skin.

[0003] The lens crystallins, retinal cells, corneal cells, trabecular meshwork, and optic nerve in the eye are not regenerated throughout life and are prone to glycation. As a result, the aging lens hardens, leading older people to wear reading glasses (presbyopia). Furthermore, the lens may even become cloudy, leading to blindness due to cataracts, for which no treatment other than surgery is available (2). Increased levels of AGEs in the tear film can alter corneal biomechanics and induce dry eye syndrome (3). With aging, AGEs also accumulate in and under the retina, contributing to age-related macular degeneration (AMD) and blindness in 25% of people over the age of 75 (2). In addition, aging of the collagen matrix of the trabecular meshwork and the lamina cribrosa of the optic nerve contributes to blindness due to glaucoma, a disease characterized by elevated intraocular pressure (4, 5). In diabetic patients, aging and hyperglycemia are the most significant risk factors for developing blindness due to diabetic retinopathy (5, 6).

[0004] Non-surgical treatment of AGE-dependent eye diseases with the enzyme fructosamine-3-kinase (F3K or FN3K) has been described in the following: WO2019149648 discloses a method for treating cataracts by administering recombinant F3K and its cofactor(s) to the eye to deglycate lens crystallins, and WO2020053188 discloses a method for treating advanced glycation end product-dependent eye diseases by administering recombinant F3K and its cofactor(s) to the eye.

[0005] Fructosyl amino acid oxidase (FAOD; fructosyl-α-L-amino acid:oxygen oxidoreductase (defructosylation)) is an enzyme found in many bacteria and yeasts (7, 8). FAOD catalyzes the oxidation of the C-N bond connecting the C1 of the fructosyl moiety with the nitrogen of the amino group of fructosyl amino acids. Flavin adenine dinucleotide (FAD) acts as its cofactor. It is active toward both fructosyl lysine and fructosyl valine. FAOD-based detection methods for glycosylated proteins, such as those described by Shen et al. (2013 AACC Annual Meeting Abstract B44) (9) and in US2005 / 0014935, have been commercially available since 1999.

[0006] However, FAODs cannot react with most intact glycated proteins, and thus the samples require an initial proteolytic digestion step to liberate glycated amino acids or glycated dipeptides. Capuano et al. (J. Agric. Food Chem 2007:4189) demonstrated the deglycosylation effect of FAODs on some low-molecular-weight proteins, such as insulin, and concluded that FAODs can be used as a tool to inhibit protein glycation in food systems (10). However, the in vivo therapeutic use of FAODs in AGE-induced conditions in humans or animals has never been considered. Summary of the Invention

[0007] In a first instance, the present invention relates to a composition comprising fructosyl aminooxidase for use in treating presbyopia, cataracts, dry eye syndrome, age-related macular degeneration, diabetic retinopathy and / or glaucoma. The present invention further relates to a composition for use as described above, which further comprises flavin adenine dinucleotide (FAD).

[0008] The present invention also relates to a composition for use as described above, further comprising fructosamine-3-kinase and adenosine triphosphate (ATP). The present invention also relates to a composition for use as described above, which further comprises magnesium ions.

[0009] The present invention further relates to a composition for use as described above, which further comprises a peroxidase. The present invention further relates to a composition for use as described above, wherein the composition is administered as drops or via any other external application, or via internal application. [Brief explanation of the drawings]

[0010] [Figure 1A] Figure 1. Fluorescence spectroscopy of porcine retinas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of porcine retinas (n = 40) glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 1A), FAOD (Figure 1B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 1C). PBS+ATP+MgCl2 was used as a negative control (Figure 1D). Baseline autofluorescence spectroscopy measurements were performed on all retinas before glycation (base, black, first bar), after 3 hours of glycation with 25 mmol / L glycolaldehyde (GA, light gray, second bar), and after 3 hours of treatment (treated, dark gray, third bar). [Figure 1B]Figure 1. Fluorescence spectroscopy of porcine retinas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of porcine retinas (n = 40) glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 1A), FAOD (Figure 1B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 1C). PBS+ATP+MgCl2 was used as a negative control (Figure 1D). Baseline autofluorescence spectroscopy measurements were performed on all retinas before glycation (base, black, first bar), after 3 hours of glycation with 25 mmol / L glycolaldehyde (GA, light gray, second bar), and after 3 hours of treatment (treated, dark gray, third bar). [Figure 1C] Figure 1. Fluorescence spectroscopy of porcine retinas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of porcine retinas (n = 40) glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 1A), FAOD (Figure 1B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 1C). PBS+ATP+MgCl2 was used as a negative control (Figure 1D). Baseline autofluorescence spectroscopy measurements were performed on all retinas before glycation (base, black, first bar), after 3 hours of glycation with 25 mmol / L glycolaldehyde (GA, light gray, second bar), and after 3 hours of treatment (treated, dark gray, third bar). [Figure 1D]Figure 1. Fluorescence spectroscopy of porcine retinas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of porcine retinas (n = 40) glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 1A), FAOD (Figure 1B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 1C). PBS+ATP+MgCl2 was used as a negative control (Figure 1D). Baseline autofluorescence spectroscopy measurements were performed on all retinas before glycation (base, black, first bar), after 3 hours of glycation with 25 mmol / L glycolaldehyde (GA, light gray, second bar), and after 3 hours of treatment (treated, dark gray, third bar).

[0011] [Figure 2] Figure 2. Fluorescence spectroscopy of human lens fragments treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of the emission spectra (400-600 nm) of three similar pools (n=30) of human cataract lens fragments before (black line) and after (gray line) treatment. Pools were treated with either FAOD (dotted gray line), FN3K+ATP+MgCl2 (solid gray line), or a combination of both FAOD and FN3K+ATP+MgCl2 (dashed gray line).

[0012] [Figure 3A]Figure 3. Fluorescence spectroscopy of human corneas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of human corneal fragments glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 3A), FAOD (Figure 3B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 3C). PBS+ATP+MgCl2 was used as a negative control (Figure 3D). Baseline autofluorescence spectroscopy measurements were performed on all corneal fragments before glycation (black curve), after 3 hours of glycation with 25 mmol / L GA (dashed curve), and after 3 hours of treatment (dotted curve). [Figure 3B] Figure 3. Fluorescence spectroscopy of human corneas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of human corneal fragments glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 3A), FAOD (Figure 3B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 3C). PBS+ATP+MgCl2 was used as a negative control (Figure 3D). Baseline autofluorescence spectroscopy measurements were performed on all corneal fragments before glycation (black curve), after 3 hours of glycation with 25 mmol / L GA (dashed curve), and after 3 hours of treatment (dotted curve). [Figure 3C]Figure 3. Fluorescence spectroscopy of human corneas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of human corneal fragments glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 3A), FAOD (Figure 3B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 3C). PBS+ATP+MgCl2 was used as a negative control (Figure 3D). Baseline autofluorescence spectroscopy measurements were performed on all corneal fragments before glycation (black curve), after 3 hours of glycation with 25 mmol / L GA (dashed curve), and after 3 hours of treatment (dotted curve). [Figure 3D] Figure 3. Fluorescence spectroscopy of human corneas treated with FAOD alone or in combination with FN3K. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400–600 nm) of human corneal fragments glycated with glycolaldehyde (GA) and then treated with FN3K+ATP+MgCl2 (Figure 3A), FAOD (Figure 3B), or a combination of FN3K+ATP+MgCl2 and FAOD (Figure 3C). PBS+ATP+MgCl2 was used as a negative control (Figure 3D). Baseline autofluorescence spectroscopy measurements were performed on all corneal fragments before glycation (black curve), after 3 hours of glycation with 25 mmol / L GA (dashed curve), and after 3 hours of treatment (dotted curve).

[0013] [Figure 4] Figure 4. Fluorescence spectroscopy of porcine retinas treated with FAOD and peroxidase. Mean autofluorescence values ​​and standard deviations of triplicate measurements of emission spectra (400-600 nm) of porcine retinas (n=40) before glycation (small black bar) and after 3 hours of glycation with 25 mmol / L glycolaldehyde (large dark gray bar). The porcine retinas were then treated with either FAOD alone or in combination with 473 U / mL peroxidase for 1 hour (light gray bar), 2 hours (white bar), or 3 hours (gray bar).

[0014] [Figure 5A] Figure 5. Fluorescence quantification shifts in cataractous lens fragments treated with FAOD or FN3K. Human lens fragments derived from pools of aged and diabetic patients were treated with different deglycosylation enzymes for 3 hours. Mean autofluorescence values ​​from three experiments of the emission spectra (400-600 nm) of three similar pools (n = 30) of human cataractous lens fragments before (dashed line) and after (solid line) treatment. Pools were treated with either FN3K + ATP + MgCl2 (Figure 5A) or FAOD + FAD (Figure 5B). [Figure 5B] Figure 5. Fluorescence quantification shifts in cataractous lens fragments treated with FAOD or FN3K. Human lens fragments derived from pools of aged and diabetic patients were treated with different deglycosylation enzymes for 3 hours. Mean autofluorescence values ​​from three experiments of the emission spectra (400-600 nm) of three similar pools (n = 30) of human cataractous lens fragments before (dashed line) and after (solid line) treatment. Pools were treated with either FN3K + ATP + MgCl2 (Figure 5A) or FAOD + FAD (Figure 5B).

[0015] [Figure 6] Figure 6. Gel filtration patterns (Sephadex® G-25 Fine resin) of urea-soluble lens fragments before and after FAOD treatment. The absorbance at 488 nm (Seliwanoff reaction) of high molecular weight fructose-containing compounds (AGEs) is presented as a function of elution time. V (>5 kDa) indicates the void volume, and V (<500 Da) indicates the terminal volume. The sharp peak after 165 min of elution time and the smaller peak after 235 min represent the presence of fructose-containing AGEs in the lens before FAOD treatment. The dots on the horizontal axis indicate the total loss of fructose-containing AGEs at each elution time point.

[0016] [Figure 7A]Figure 7. Gain of human lens power after FAOD treatment. Lens power of the human lens in (D, water) as a function of the indicated treatment time (hours) with saline (Figure 7A). Gain of human lens power (D, water) as a function of treatment time with FAOD (Figure 7B). [Figure 7B] Figure 7. Gain of human lens power after FAOD treatment. Lens power of the human lens in (D, water) as a function of the indicated treatment time (hours) with saline (Figure 7A). Gain of human lens power (D, water) as a function of treatment time with FAOD (Figure 7B).

[0017] [Figure 8] Figure 8. Near-infrared microspectroscopy on stained tissue sections of human retina with AGEs reveals distinct biochemical changes after FN3K treatment compared to FAOD treatment. Hotelling plot of spectral data showing a clear distinction between FN3K-treated Druesen (squares) and FAOD-treated Druesen (dots) analyzed by partial least squares discriminant analysis.

[0018] [Figure 9-13] Figure 9. Proposed structure for compound #A1, m / z 133,09695, RT 0.82, detected in a sample containing arginine. Figure 10. Proposed structure for compound #A3, m / z 337,17098, RT 0.88, detected in a sample containing arginine. Figure 11. Proposed structure for compound #A4, m / z 319,16064, RT 0.88, detected in a sample containing arginine. Figure 12. Proposed structure for compound #L1, m / z 309,16554, RT 0.85, detected in a sample containing lysine. Figure 13. Proposed structure for compound #L2, m / z 219,13387, RT 0.89, detected in a sample containing lysine.

[0019] [Figure 14-16]Figure 14. Proposed structure for compound with m / z 205, 11825 at RT 0.91 (compound #L3) detected in a sample containing lysine. Figure 15. Proposed structure for compound with m / z 351, 15047 at RT 0.95 (compound #A9) detected in a sample containing arginine. Figure 16. Proposed structure for compound with m / z 131, 12904 at RT 0.83 (compound #A2) detected in a sample containing arginine. DETAILED DESCRIPTION OF THE INVENTION

[0020] Detailed Description of the Invention The present invention relates to the surprising discovery that FAOD, which has been shown to be unable to reverse protein glycation without the prior use of a proteinase, is capable of deglycosylating proteins in ocular tissues in vivo and has therapeutic effects in its own right. Furthermore, the present invention further discloses that FAOD deglycosylate proteins different from the protein F3K, such that the simultaneous use of both enzymes on the same tissue has improved (additive) therapeutic effects.

[0021] In a first instance, the present invention relates to a composition comprising fructosyl aminooxidase for use in treating certain diseases of the eye, such as glaucoma, age-related macular degeneration of the eye, diabetic retinopathy, dry eye syndrome, presbyopia and cataracts, and the appearance of skin related to AGEs.

[0022] In one aspect, the present invention relates to the surprising discovery that administration of fructosyl amino acid oxidase alone or in combination with fructosamine 3 kinase and its cofactor(s) results in less AGE-induced fluorescence in ocular tissues and lower intraocular pressure. In other words, the latter treatment reduces intraocular pressure and improves vision in patients with AGE-induced diseases such as glaucoma.

[0023] In another aspect, the present invention relates to the surprising finding that administration of fructosyl amino acid oxidase alone or in combination with fructosamine 3 kinase and its cofactor(s) results in less AGE-induced retinal fluorescence, which in turn restores light transmittance and thus vision in patients with AGE-induced ocular retinopathies, such as age-related macular degeneration and diabetic retinopathy.

[0024] In another aspect, the present invention relates to the surprising discovery that administration of fructosyl amino acid oxidase alone or in combination with fructosamine 3 kinase and its cofactor(s) results in less AGE-induced corneal fluorescence, i.e., restores light transmittance and thus vision in patients with AGE-induced ocular keratopathy, such as dry eye syndrome.

[0025] In another aspect, the present invention relates to the surprising discovery that treatment with fructosyl amino acid oxidase alone or in combination with fructosamine 3 kinase and its cofactor(s) reduces AGE-induced lens fluorescence and thereby restores light transmittance and visual acuity in patients with AGE-induced ocular lens diseases such as presbyopia and cataracts.

[0026] Several aspects of the present invention thus relate to compositions comprising fructosyl amino acid oxidase, alone or in combination with fructosamine-3-kinase and its cofactor(s), for use in treating AGE-induced eye diseases such as age-related macular degeneration, diabetic retinopathy, presbyopia, cataracts, dry eye syndrome, and glaucoma in humans or animals.

[0027] The term "fluorescence in ocular tissue" refers to the UV fluorescence signal observed after irradiating ocular tissue with UV light. AGEs are quantified based on Maillard-type autofluorescence measurements (UV light excitation wavelength 365 nm, emission wavelength 390-700 nm). The term "low intraocular pressure" refers to the pressure in the eye as measured by any means of tonometry (contact or non-contact tonometry).

[0028] The term "ocular tissue" refers to all ocular tissues in which AGEs accumulate, such as the lens, retina, cornea, trabecular meshwork, vitreous humor, and optic nerve. The term "improving visual acuity" means that visual acuity is improved in clinical testing after application of fructosyl amino acid oxidase alone, or in combination with fructosamine 3 kinase and its cofactor(s), or in combination with peroxidase.

[0029] The term "AGE-induced disease" means - with respect to the aspect of the invention relating to vision - any vision-threatening disease involving AGEs, such as presbyopia, cataracts, dry eye syndrome, age-related macular degeneration, diabetic retinopathy or glaucoma.

[0030] The present invention therefore relates to compositions comprising fructosyl amino acid oxidase. The term "fructosyl amino acid oxidase (FAOD; fructosyl-α-L-amino acid:oxygen oxidoreductase (defructosylation))" refers to any enzyme classified as catalyzing the oxidation of the C-N bond connecting the C1 of the fructosyl moiety and the nitrogen of the amino group of a fructosyl amino acid. The reaction proceeds to an unstable Schiff base intermediate, which hydrolyzes to produce glucosone and the amino acid. The reduced flavin adenine dinucleotide (FAD) cofactor of the enzyme is then reoxidized by molecular oxygen with the release of hydrogen peroxide.

[0031] More specifically, the term "fructosyl amino acid oxidase (fructosyl-α-L-amino acid:oxygen oxidoreductase (defructosylation))" relates to the enzyme encoded by the gene encoding fructosyl amino acid oxidase (fructosyl-α-L-amino acid:oxygen oxidoreductase (defructosylation); EC 1.5.3) of Corynebacterium sp. 2-4-1, cloned and expressed in Escherichia coli as described by Sakaue et al. (11). The latter enzyme, as a non-limiting example of an enzyme that can be used in the present invention, can be purchased from, for example, Creative Enzymes, Shirley, NY, or produced using well-known recombinant methods, for example, as described by Sakaue et al. (11).

[0032] The term "fructosamine-3-kinase" relates to the enzyme classified as enzyme 2.7.1.171 in the Brenda enzyme database (www.brenda-enzvmes.org), for example. The latter enzyme is part of an ATP-dependent system for removing carbohydrates from non-enzymatically glycosylated proteins and catalyzes the following reaction: ATP + [protein]-N6-D-fructosyl-L-lysine = ADP + [protein]-N6-(3-O-phospho-D-fructosyl)-L-lysine. More specifically, the term "fructosamine-3-kinase" refers to, for example and without limitation, the human fructosamine-3-kinase (F3K) having the accession number or National Center for Biotechnology Information (NCBI) reference sequence number NP_071441.1. https: / / www.ncbi.nlm.nih.gov / protein / NP 071441 Both WO2019149648 and WO2020053188 describe the recombinant production of F3K in, for example, Pichia pastoris.

[0033] It should be further clarified that the terms "fructosamine-3-kinase" and "fructosyl amino acid oxidase" relate to the enzyme as described above, but also to functional fragments and variants thereof. The term "functional fragments and variants" relates to fragments and variants of naturally occurring enzymes. Indeed, for many applications of enzymes, a portion of the protein may be sufficient to achieve the enzymatic effect. The same applies to variants (i.e., those in which one or more amino acids in the protein have been replaced by other amino acids, but which retain functionality or even exhibit improved functionality), in particular to variants of enzymes optimized for enzymatic activity (also as further described for recombinant enzymes).

[0034] The term "fragment" therefore refers to an enzyme that contains fewer amino acids than the 309 amino acid sequence of human fructosamine-3-kinase having NCBI reference sequence number NP_071441.1 or the 372 amino acid sequence of fructosyl amino acid oxidase as disclosed by Sakaue et al. (11), while retaining the enzymatic activity. Such a fragment can be a protein in which, for example, not more than 10% of the total number of amino acids are deleted at the C- and / or N-terminus. The term "variant" therefore refers to a protein having at least 50% sequence identity, preferably at least 51-70% sequence identity, more preferably at least 71-90% sequence identity, or most preferably at least 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with the 309 amino acid sequence of human fructosamine-3-kinase having NCBI reference sequence number: NP_071441.1 or with the 372 amino acid sequence of fructosyl amino acid oxidase as disclosed by Sakaue et al. (11), and which retains said enzymatic activity.

[0035] Thus, orthologs, or genes in other genera and species (other than human fructosamine-3-kinase with NCBI Reference SEQ ID NO: NP_071441.1 or fructosyl amino acid oxidase as disclosed by Sakaue et al. (11)) with at least 50% identity at the amino acid level and with said enzymatic activity are part of the present invention. The percentage of amino acid sequence identity is determined by aligning the two sequences and identifying the number of positions with identical amino acids divided by the number of amino acids in the shorter sequence × 100. The latter "variants" may also differ from the protein with NCBI Reference SEQ ID NO: NP_071441.1 or the protein as disclosed by Sakaue et al. (11) only in conservative substitutions and / or modifications that retain the ability of the protein to have enzymatic activity. A "conservative substitution" is one in which an amino acid is substituted with another amino acid with similar properties that a person skilled in the art of protein chemistry would not expect to substantially change the properties of the protein. In general, the following groups of amino acids represent conservative changes: (1) ala, pro, gly, glu, asp, gln, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; and (5) phe, tyr, trp, his.

[0036] A variant may also (or alternatively) be a protein as described herein that has been modified, for example, by the deletion or addition of amino acids that have minimal effect on the enzymatic activity, secondary structure and hydrophobic properties of the enzyme as defined above. The terms "adenosine triphosphate" (ATP), flavin adenine dinucleotide (FAD) and "magnesium ion" refer to well-known cofactors of the latter enzyme.

[0037] The present invention further relates to a composition for use as described above, further comprising a peroxidase. The term "peroxidase" refers to any known enzyme having the EC number 1.11.1.x and capable of decomposing peroxides, more particularly hydrogen peroxide released during the oxidation of reduced FAD, which is a cofactor of FAOD. The term "animal" may relate to any animal, such as mammals (dogs, cats, horses, . . . ), birds and reptiles.

[0038] The present invention therefore relates to a method for treating (or preventing) - in other words - age-related presbyopia, cataracts, dry eye syndrome, age-related macular degeneration, diabetic retinopathy, or glaucoma in a subject in need thereof, which method comprises administering to the eye of the subject a therapeutically effective amount of a compound comprising fructosyl amino acid oxidase alone or in combination with fructosamine-3-kinase and adenosine triphosphate, and - in certain embodiments of the invention - magnesium ions and / or peroxidase.

[0039] The term "therapeutically effective amount" refers to an amount derived from a therapeutic dose of fructosyl amino acid oxidase alone, ranging from 1 U / mL to 100 U / mL, or in combination with peroxidase at 10-946 U / mL, or in combination with fructosamine-3-kinase at 4.17-12.5 mg / mL, ATP at 2.50-4.17 mM, and MgCl at 1.00-1.67 mM. The latter therapeutic dose can be obtained by mixing a 25 mg / mL solution of fructosamine-3-kinase with a fresh solution of 5 mM ATP / 2 mM MgCl at a ratio of 1:1, 1:2, 1:3, or 1:5.

[0040] It should be clear that in addition to "administering drops" of such therapeutically effective amounts, which is one mode of administration, other means of administration are also contemplated, including, but not limited to, external application, such as via a gel, and other internal applications, such as suprachoroidal, intravitreal, or subretinal injection, or implantation anywhere in or around the eye. Thus, and for example, the present invention thus relates to a composition comprising fructosyl aminooxidase, alone or in combination with fructosamine-3-kinase and ATP (which may further comprise magnesium ions), for use in treating AGE-induced eye diseases such as age-related macular degeneration, diabetic retinopathy, presbyopia, cataracts, dry eye, and glaucoma, wherein the composition is administered by drops or any other external application, or internal application (such as injection or implantation), or any other mode of ocular drug delivery (12).

[0041] The term "therapeutically effective amount" refers to a volume ranging from 10 μl to 100 μl, resulting in a therapeutic dose of fructosamine-3-kinase ranging from about 4.17 to 12.5 μg / ml, 2.50 to 4.17 mM ATP, and 1.00 to 1.67 mM MgCl2, for F3K. The latter therapeutic dose can be obtained by mixing a 25 μg / ml solution of fructosamine-3-kinase with a fresh solution of 5 mM ATP / 2 mM MgCl2 in a ratio of 1:1, 1:2, 1:3, or 1:5.

[0042] The term "therapeutically effective amount" refers to a volume ranging from 10 μl to 100 μl, which is taken from a therapeutic dose of fructosyl amino acid oxidase ranging from 1 U / mL to 100 U / mL, for FAOD. An FAD concentration of 2 mmol FAD / mol FAOD can be used for optimal enzyme function. The solution buffer should have a pH value between 6.8 and 7.7.

[0043] The present invention further relates to a composition as described above, wherein the fructosamine-3-kinase and the fructosyl amino acid oxidase are recombinant enzymes. The term "recombinant" refers to fructosamine-3-kinase or fructosyl amino acid oxidase obtained as a result of expression of recombinant DNA encoding the fructosamine-3-kinase or fructosyl amino acid oxidase inside a living cell, such as a bacterial or yeast cell. Practitioners are further directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 4th Edition, Cold Spring Harbor Press, Plainsview, New York (2012) and Ausubel et al., Current Protocols in Molecular Biology (Supplementary Note 114), John Wiley & Sons, New York (2016).

[0044] More specifically, the present invention relates to a recombinant fructosamine-3-kinase obtained by recombinant production in Pichia pastoris, and even more specifically, wherein the recombinant fructosamine-3-kinase obtained by recombinant production in Pichia pastoris has the amino acid sequence as given by SEQ ID NO: 1 or SEQ ID NO: 2. SEQ ID NO: 1 is a construct with an N-terminally cleavable HIS tag and a caspase 3-cleavable Asp-Glu-Val-Asp (DEVD) linker between the His6 tag and the protein coding sequence, allowing for clean removal of the tag. SEQ ID NO: 2 is a truncated version of SEQ ID NO: 1. The amino acid sequences of SEQ ID NO:1 and SEQ ID NO:2 (and their respective encoding nucleic acid sequences, SEQ ID NO:3 and SEQ ID NO:4) are as follows:

[0045] SEQ ID NO:1: [ka]

[0046] SEQ ID NO:3: [ka]

[0047] SEQ ID NO: 2 (= FN3K after removal of the N-terminal HIS tag): Type: single-letter amino acid EQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREKLKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIP QVNEWQDDWPTFFARHRLQAQLDLIEKDYADREARELWSRLQVKIPDLFCGLEIVPALLHGDLWSGNVAEDDVGPIIYDPASFYGHSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPSLGTMRRLLK*

[0048] SEQ ID NO:4: Type:DNA GAACAGTTGTTGAGAGCTGAGTTGAGAACTGCTACTTTGAGAGCTTTTGGTGGTCCAGGTGCTGGTTGTATTTCTGAGGGTAGAGCTTACGATACTGACGCTGGTCCAGTTTTCGTTAAGGTTAACAGAAGAACTCAGGCTAGACAGATGTTCGAGGGTGAAGTTGCTTCTTTGGAGGCTTTGAGATCCACTGGTTTGGTTAGAGTTCCAAGACCAATGAAGGTTATCGACTTGCCAGGTGGTGGTGCTGCTTTTGTTATGGAACACTTGAAGATGAAGTCCTTGTCCTCCCAGGCTTCTAAGTTGGGTGAACAAATGGCTGACTTGCACTTGTACAACCAGAAGTTGAGAGAAAAGTTGAAAGAGGAAGAGAACACTGTTGGTAGAAGAGGTGAAGGTGCTGAGCCACAATACGTTGACAAGTTCGGTTTCCACACTGTTACTTGTTGTGGTTTCATCCCACAGGTTAACGAGTGGCAAGATGACTGGCCAACTTTCTTCGCTAGACACAGATTGCAAGCTCAGTTGGACTTGATCGAGAAGGACTACGCTGACAGAGAAGCTAGAGAATTGTGGTCCAGATTGCAGGTTAAGATCCCAGACTTGTTCTGTGGTTTGGAGATCGTTCCAGCTTTGTTGCACGGTGATTTGTGGTCTGGTAACGTTGCTGAAGATGACGTTGGTCCAATTATCTACGACCCAGCTTCTTTCTACGGTCACTCTGAATTCGAGTTGGCTATCGCTTTGATGTTCGGTGGTTTCCCAAGATCCTTCTTCACTGCTTACCACAGAAAGATCCCAAAGGCTCCAGGTTTCGACCAGAGATTGTTGTTGTACCAGTTGTTCAACTACTTGAACCATTGGAACCACTTCGGTAGAGAGTACAGATCTCCATCCTTGGGTACTATGAGAAGATTGTTGAAGTAA

[0049] The present invention indeed relates to the finding that, in addition, recombinant fructosamine-3-kinase obtainable by recombinant production in Pichia pastoris and having the amino acid sequences as given by SEQ ID NOs: 1 and 2 is a preferred enzyme for treating said AGE-related conditions. Indeed, the latter enzymes are preferred because 1) their production in Pichia results in higher enzyme yields compared to, for example, production in E. coli, 2) the enzymes have higher purity when analyzed on SDS-PAGE, and 3) the presence of endotoxins, which are known to lead to inflammation following administration, can be avoided. The following examples are provided to better illustrate the present invention and should not be construed as limiting the scope of the invention.

[0050] example Example 1. Fluorescence spectroscopy of porcine retinas treated with FAOD alone or in combination with FN3K. Pig retinas (n = 40) were obtained from a local slaughterhouse and stored at 4°C until processing. Within 12 h postmortem, neural retinas were isolated through dissection by trained ophthalmologists, transferred to sterile 6-well plates (Thermo Scientific, Roskilde, Denmark), and frozen at -20°C. Retinal fragments were dissected from each frozen retina and placed in a 96-well plate (FluoroNunc PolySorp, Thermo Fisher Scientific, Waltham, MA, USA) for fluorescence measurements. Subsequently, baseline fluorescence measurements were performed on each retinal fragment at a fixed distance and a 90° angle. AGE modification was performed by incubating the retinal fragments with 200 μL of 25 mM glycolaldehyde dimer (crystalline form, Sigma-Aldrich) in phosphate-buffered saline (PBS) for 3 h at 37°C. After incubation, the activator was carefully washed away, and the retinal fragments were stored overnight (4 °C) until the chemical reaction was complete. Finally, in vitro deglycosylation was initiated using a solution containing FN3K (WO2019149648) 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L (n = 10), FAOD 10 U / mL (n = 10), or the combination FN3K 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L + FAOD 10 U / mL (n = 10).

[0051] FAOD was purchased from Creative Enzymes, Shirley, NY. 20 microliters of the solution was added to each retinal fragment and incubated at 37°C for 3 h. Fluorescence measurements were taken before the addition of the deglycation solution and repeated after the incubation period. As a control experiment, 10 retinal fragments were treated in a similar manner. However, after AGE modification, the fragments were treated with PBS + ATP 5 mmol / L + MgCl2 2 mmol / L.

[0052] AGEs were quantified based on Maillard-type autofluorescence (AF) measurements (excitation 365 nm, emission 390–700 nm) using a Flame miniature spectrometer (FLAME-S-VIS-NIR-ES, 350–1000 nm, Ocean Optics, Dunedin, FL, USA) equipped with a high-power LED light source (365 nm, Ocean Optics) and a reflection probe (QR400-7-VIS-BX, Ocean Optics). AF values ​​were calculated by dividing the average light intensity emitted per nm over the range of 407–677 nm by the average light intensity per nm over the range of 342–407 nm.

[0053] The mean AF measurements show a sharp increase after GA glycation in all retinal fragments: AF in the neural retina decreased by 34% when treated with FN3K solution (Fig. 1A), 38% when treated with FAOD solution (Fig. 1B), and 62% when treated with a solution containing both FN3K and FAOD (Fig. 1C), while control-treated retinas remained stable (AF +4%) (Fig. 1D).

[0054] Example 2. Fluorescence spectroscopy of human lens fragments treated with FAOD alone or in combination with FN3K. Human cataract lens fragments (n = 30) obtained after phacoemulsification surgery were washed several times with PBS, pooled, and stored at 4°C. UV fluorescence was measured in three pools of lens fragments (Figure 2). AGEs were quantified based on Maillard-type autofluorescence (AF) measurements (excitation 365 nm, emission 390-700 nm) using a Flame miniature spectrometer (FLAME-S-VIS-NIR-ES, 350-1000 nm, Ocean Optics, Dunedin, FL, USA) equipped with a high-power LED light source (365 nm, Ocean Optics) and a reflection probe (QR400-7-VIS-BX, Ocean Optics).

[0055] Pooled lens fragments were then treated with FN3K (WO2019149648) 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L (n = 10), FAOD 10 U / mL (n = 10), or the combination FN3K 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L + FAOD 10 U / mL (n = 10) for 3 hours at 37°C. FAOD was purchased from Creative Enzymes, Shirley, NY. FN3K treatment resulted in a 68.85% reduction in UV fluorescence at 450 nm and a 69.71% reduction at 490 nm. FAOD treatment resulted in a 90% reduction in UV fluorescence at 450 nm and a 90.57% reduction at 490 nm. Treatment with a combination of both FN3K and FAOD resulted in a 93.68% reduction in UV fluorescence measurements at 450 nm and a 93.77% reduction at 490 nm (Figure 2).

[0056] Example 3. Fluorescence spectroscopy of human corneas treated with FAOD alone or in combination with FN3K. Human corneas (n = 3) were obtained from cadaveric eyes and stored at 4°C until processing. Within 12 h postmortem, human corneas were isolated through dissection by trained ophthalmologists, transferred to sterile 6-well plates (Thermo Scientific, Roskilde, Denmark), and frozen at -20°C. Corneal fragments were dissected from each cornealed retina and placed in a 96-well plate (FluoroNunc PolySorp, Thermo Fisher Scientific, Waltham, MA, USA) for fluorescence measurements. Subsequently, baseline fluorescence measurements were performed on each corneal fragment at a fixed distance and a 90° angle. AGE modification was performed by incubating the corneal fragments with 200 μL of 25 mM glycolaldehyde dimer (GA) (crystalline form, Sigma-Aldrich) in phosphate-buffered saline (PBS) at 37°C for 3 h.

[0057] After incubation, the activator was carefully washed away, and the corneal fragments were stored overnight (4°C) until the chemical reaction was complete. Finally, in vitro deglycation was initiated using a solution containing FN3K (WO2019149648) 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L, FAOD 10 U / mL, or a combination of FN3K 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L + FAOD 10 U / mL. FAOD was purchased from Creative Enzymes, Shirley, NY. Twenty microliters of the solution was added to each corneal fragment and incubated at 37°C for 3 h. Fluorescence measurements were taken before the addition of the deglycation solution and repeated after the incubation period. As a control, a corneal fragment was treated in a similar manner. However, the fragments were control treated with PBS + ATP 5 mmol / L + MgCl2 2 mmol / L after AGE modification.

[0058] AGEs were quantified based on Maillard-type autofluorescence (AF) measurements (excitation 365 nm, emission 390–700 nm) using a Flame miniature spectrometer (FLAME-S-VIS-NIR-ES, 350–1000 nm, Ocean Optics, Dunedin, FL, USA) equipped with a high-power LED light source (365 nm, Ocean Optics) and a reflection probe (QR400-7-VIS-BX, Ocean Optics). AF values ​​were calculated by dividing the average light intensity emitted per nm over the range of 407–677 nm by the average light intensity per nm over the range of 342–407 nm.

[0059] The mean AF measurements show a sharp increase in all corneal fragments after glycation with GA: AF in corneal fragments decreased by 3% when treated with FN3K solution (Figure 3A), 12% when treated with FAOD solution (Figure 3B), and 27% when treated with a solution containing both FN3K and FAOD (Figure 3C), while control-treated retinas showed a slight increase in AF (Figure 3D).

[0060] Example 4. Fluorescence spectroscopy of human retinas treated with FAOD and peroxidase. Pig retinas (n = 40) were obtained from a local slaughterhouse and stored at 4°C until processing. Within 12 h postmortem, neural retinas were isolated through dissection by trained ophthalmologists, transferred to sterile 6-well plates (Thermo Scientific, Roskilde, Denmark), and frozen at -20°C. Retinal fragments were cut from each frozen retina and placed in a 96-well plate (FluoroNunc PolySorp, Thermo Fisher Scientific, Waltham, MA, USA) for fluorescence measurements. Subsequently, baseline fluorescence measurements were performed on each retinal fragment at a fixed distance and a 90° angle. AGE modification was performed by incubating the retinal fragments with 200 μL of 25 mM glycolaldehyde dimer (GA) (crystalline form, Sigma-Aldrich) in phosphate-buffered saline (PBS) for 3 h at 37°C.

[0061] After incubation, the activator was carefully washed away, and the retinal fragments were stored overnight (4°C) until the chemical reaction was complete. Finally, in vitro deglycosylation was initiated using a solution containing 10 U / mL of FAOD alone or in combination with 473 U / mL of peroxidase. FAOD was purchased from Creative Enzymes, Shirley, NY. Twenty microliters of the solution was added to each retinal fragment and incubated at 37°C for 1, 2, or 3 hours, respectively. The deglycosylation enzyme was carefully washed off with PBS, and AGEs were quantified based on Maillard-type autofluorescence (AF) measurements (excitation 365 nm, emission 390–700 nm) using a Flame miniature spectrometer (FLAME-S-VIS-NIR-ES, 350–1000 nm, Ocean Optics, Dunedin, FL, USA) equipped with a high-power LED light source (365 nm, Ocean Optics) and a reflection probe (QR400-7-VIS-BX, Ocean Optics). AF values ​​were calculated by dividing the average light intensity emitted per nm over the range of 407–677 nm by the average light intensity per nm over the range of 342–407 nm.

[0062] The mean AF measurements show a sharp increase after glycation with GA in all retinal fragments (Figure 4). AF in the neural retina was similarly reduced by 47% when treated with FAOD solution alone or in combination with peroxidase for 1 hour. After 2 hours of incubation with the deglycation solution, however, AF in the neural retina was reduced by another 40% when treated with FAOD solution in combination with peroxidase compared to 29% when FAOD solution alone was used. After 3 hours of incubation, AF in the neural retina was further reduced by 5% when treated with FAOD solution in combination with peroxidase compared to 26% when FAOD solution alone was used, suggesting that the deglycation process is more rapid when using FAOD solution for deglycation with peroxidase.

[0063] Example 5. Measurement of visual function and intraocular pressure in dogs in vivo after treatment with FAOD in combination with FN3K. Four dogs (an 11-year-old Chihuahua, an 8-year-old Poodle, an 8-year-old Maltese, and a 7-year-old German Shepherd) with bilateral cataracts were treated with drops containing a combination of FAOD and FN3K in the right eye for 4 weeks, and with a mutant, inactive FN3K enzyme in the left eye (WO20200053188). Two of the four dogs, the Chihuahua and the German Shepherd, had developed cataracts within the previous 3 weeks. The other two dogs had older cataracts (greater than 3 months). Treatment consisted of 6 drops administered 5 minutes apart on the first day, and then weekly for 4 weeks (a total of 4 treatments).

[0064] The instillation in the right eye (RE) contained 100 U / mL FAOD, 70 μg / mL FN3K, 5 mmol / L ATP, and 2 mmol / L MgCl2. FAOD was purchased from Creative Enzymes, Shirley, NY. As a control, the instillation in the left eye (LE) contained 70 μg / mL mutant FN3K, 5 mmol / L ATP, and 2 mmol / L MgCl2. Visual function (VF) was tested before treatment (baseline) and weekly thereafter during treatment using three different visual tests. All tests were performed separately for the RE and LE. In the table test, dogs received a positive (+) score if they extended their paws as they approached the table; in the cotton ball test, dogs received a positive (+) score if they searched for a cotton ball that had been thrown on the table; and in the trail test, dogs received a positive (+) score if they walked from the entrance to the exit without bumping into chairs and boxes that were randomly placed on the trail.

[0065] Table 1 shows the improvement in visual function in two of the four dogs (a Chihuahua and a German Shepherd) treated with RE, already after two weeks of treatment. The dog that showed the most rapid improvement was one that had developed cataracts within the previous three weeks. [Table 1]

[0066] Second, the effect of deglycosylating enzyme treatment on intraocular pressure (IOP) was evaluated in four dogs (an 11-year-old Chihuahua, an 8-year-old Poodle, an 8-year-old Maltese, and a 7-year-old German Shepherd). Before measuring IOP, an anesthetic drop (oxybuprocaine) was applied to the cornea, and IOP was then measured by applanation tonometry using a Tono-pen Veterinary (Reichert, NY, USA). IOP was measured before and 30 minutes after treatment with RE (a combination of FAOD and FN3K enzyme) and LE (a mutant, inactive FN3K enzyme). Treatment consisted of six drops administered 5 minutes apart.

[0067] The right eye (RE) was treated with 100 U / mL FAOD, 70 μg / mL FN3K, 5 mmol / L ATP, and 2 mmol / L MgCl. FAOD was purchased from Creative Enzymes, Shirley, NY, USA. As a control, the left eye (LE) was treated with 70 μg / mL mutant inactive FN3K (WO20200053188), 5 mmol / L ATP, and 2 mmol / L MgCl. In the RE, elevated IOP (>13 mmHg) before treatment was noted in two dogs: a Maltese dog with a maximum of 22 mmHg and a German Shepherd dog with a maximum of 14 mmHg. After treatment with the deglycosylating enzyme combination (FAOD and FN3K), IOP decreased by 54% in the Maltese dog and 29% in the German Shepherd dog. In the other two dogs, IOP in the RE was low (<13 mmHg) before treatment and remained low (<13 mmHg) after treatment with the deglycosylating enzyme. In all four dogs, IOP in the LE was low (<13 mmHg) before treatment and remained low (<13 mmHg) after treatment with the mutant, inactive FN3K enzyme.

[0068] Example 6 (Figure 5): Different fluorescence patterns indicate different substrate specificities for FN3K and FAOD. Human cataract lens fragments (n = 30) obtained after phacoemulsification surgery were washed several times with PBS, pooled, and stored at 4°C. Because the age-related increase in all AGEs is not completely similar in diabetic patients compared with nondiabetic patients, the pool of lens fragments was expanded to include elderly patients with diabetes (13). AGEs were quantified based on Maillard-type autofluorescence (AF) measurements (excitation 365 nm, emission 390–700 nm) using a Flame miniature spectrometer (FLAME-S-VIS-NIR-ES, 350–1000 nm, Ocean Optics, Dunedin, FL, USA) equipped with a high-power LED light source (365 nm, Ocean Optics) and a reflection probe (QR400-7-VIS-BX, Ocean Optics). Two similar pools of lens fragments were then treated with either FN3K (WO2019149648) 250 μg / mL + ATP 5 mmol / L + MgCl 2 mmol / L (n=15) or FAOD 10 U / mL (n=15) for 3 hours at 37° C. FAOD was purchased from Creative Enzymes, Shirley, NY.

[0069] Following incubation with FN3K treatment, a significant decrease in autofluorescence was observed in the AGE spectrum (450–500 nm). As a result, two maxima can be observed after FN3K treatment: one large peak at 500 nm and a second, smaller autofluorescence peak at 450 nm, accompanied by a significant decrease in autofluorescence at 450 nm. In contrast, the fluorescence pattern after FAOD treatment is different, with a complete loss of autofluorescence signal at 450 nm, but with a smaller new peak observed at 520 nm, which represents a secondary fluorescent product of the former AGEs (14). Thus, following FAOD treatment without FN3K treatment, the relative amount of autofluorescence loss after FAOD treatment is shifted to a new autofluorescence peak at 520 nm.

[0070] Example 7 (Figure 6) Differential gel filtration patterns of urea-soluble pooled human cataract lens fragments indicate different substrate specificities for FN3K and FAOD Human lens fragments were obtained from 10 patients following phacoemulsification during cataract surgery. Nondiabetic and diabetic patients were included. After surgery, the storage solution containing the lens fragments was centrifuged (1902 × g, 5 min, 21°C), and the supernatant was removed. The pooled fragments (20 mg) were then incubated in 200 μL of a solution containing FAOD (3.83 U / mL) at 37°C for 3 h. The untreated pooled fragments (20 mg) were stored under the same conditions.

[0071] Because cataracts are known to be associated with a strong increase in water-insoluble proteins, urea-soluble (water-insoluble) proteins from both untreated and treated lens fragments were extracted in 6 M urea in PBS for 4 h at 4°C in Eppendorf SafeLock tubes (Hamburg, Germany). After centrifugation (16,000 × g, 10 min, 21°C), the supernatant was retained for gel filtration. To assess the molecular weight of fructose-containing lens compounds such as AGEs, gel filtration of untreated and FAOD-treated lens fragments was performed on a chromatography column (length: 60 cm, diameter: 15 mm) packed with Sephadex G-25® Fine resin (Sigma-Aldrich).

[0072] Following fractionation, the presence of AGEs was first checked based on Maillard-type autofluorescence (AF) measurements (excitation 365 nm, emission 390–700 nm) using a Flame miniature spectrometer (FLAME-S-VIS-NIR-ES, 350–1000 nm, Ocean Optics, Dunedin, FL, USA) equipped with a high-power LED light source (365 nm, Ocean Optics) and a reflection probe (QR400-7-VIS-BX, Ocean Optics). The autofluorescence peak for FAOD-treated lens fragments was detected at 520 nm, whereas the autofluorescence peaks for FN3K-treated lens fragments were detected at 450 and 500 nm (15). Next, all individual fragments were examined photometrically using the resorcinol-HCl (Seliwanoff) reaction, a well-known colorimetric reaction for ketoses (16). For this reaction, 50 μL of sample was added to 100 μL of resorcinol (9 mM, Sigma-Aldrich) and 1 mL of hydrochloric acid (9 M, Sigma-Aldrich). Following a 5-minute incubation in a boiling water bath, the resulting color was read photometrically at 488 nm in a standard 10 mm cuvette.

[0073] Gel filtration of untreated lens fragments showed, before treatment, a sharp peak at 165 min elution time corresponding to a molecular weight of ±2500 Da and a second minor peak at 235 min elution time corresponding to 1660 Da, indicating the presence of high molecular weight structures such as cross-linked AGEs. In the FN3K-treated lens fraction, a series of ketoses (fructose-derived AGEs) with molecular weights ranging from 1500 to 2500 Da were detected (15). In contrast, in human cataract lens fragments after treatment with FAOD, fructose-containing AGEs were completely absent, and no peaks were detected at any time point during elution. Treatment with FAOD, therefore, results in components that are not only different in molecular weight but also in structure compared to treatment with FN3K.

[0074] Example 8 (Figure 7). Human lens power gain after FAOD treatment Human lenses were obtained from cadaveric eyes that had rejected corneal transplants (Biobank Antwerpen, Antwerpen Belgium, ID71030031000). Eyes were dissected and lenses were removed by an experienced ophthalmic surgeon. Lenses were incubated with FAOD or PBS. Lens power was measured before treatment and every consecutive hour for up to 4 hours. Focal length measurements were based on the thin lens equation, which relates the focal length f of the lens to the object distance S1 from the lens and the image distance S2 from the lens:

number

number

number

[0075] Because the focal length of the lens under test is quite small (approximately 8 mm), direct imaging onto the CMOS sensor is impractical, and an additional imaging lens is used. A high-resolution CMOS sensor (Basler ace - acA2000-165uc, 2040x1086 pixels, and pixel size 5.5 μm) is used in combination with a fixed focal length imaging lens (25 mm / F1.4 59871 Edmund optics, New Jersey). The target object consists of a periodic pattern of dark and white lines. First, a reference image without the lens under test is taken by positioning the camera at a position where the image is in focus. Then, the lens under test is positioned at a random position from the target object, and the camera distance is repositioned so that the image of the target object is in focus.

[0076] By measuring the period of the lines imaged by the camera, the magnification can be calculated, and the position of the camera can be used to finally calculate the focal length. The measurement method was verified by performing the procedure on a known aspheric lens (Thorlabs C340TMD-A) with a focal length of 4.03 mm, which resulted in an error of less than 1% of the focal length. Because the quality of the lens under test (due to haze and aberrations) is significantly worse than a glass lens, possible problems with focusing the image could be addressed by repeating the procedure for different distances between the object and the lens under test and averaging the results.

[0077] Lens power at baseline (Figure 7A) was 17 ± 0.95 D and did not change when treated with saline. Lens power was measured in air and converted to lens power in water (the refractive index of the lens in air is 1.5, and the refractive index of the lens in water is 1.13). Lens power increased by 0.45 ± 0.35 D after 2 hours of FAOD treatment, 0.96 ± 0.96 D after 3 hours of FAOD treatment, and 2.11 ± 0.67 D after 5 hours (maximum) (Figure 7B). FOAD treatment of human lenses thus results in increased lens power, which reflects a direct relationship to the mechanical properties of the lens (17).

[0078] Example 9 (FIG. 8) Near-infrared microspectroscopy on stained tissue sections of human retina with AGEs reveals different biochemical changes after FN3K treatment compared to FAOD treatment. Donor eyes were obtained from two patients (age >70 years) with stage 3 AMD. After tissue sectioning, the samples were deparaffinized prior to treatment and then treated by sequential immersion in xylene (3 × 1.5 min), alcohol (90% 2 × 1 min, 75% 1 × 1 min), and rinsing in water. Slides were dried at 60°C for 10 min. For the control treatment, one section was covered with 1 mL of ATP / MgCl2 solution. For the FN3K treatment, the adjacent section was treated with 1 mL of FN3K solution (FN3K (WO2019149648) 250 μg / mL + ATP 5 mmol / L + MgCl2 2 mmol / L). For the FAOD treatment, the adjacent section was treated with 1 mL of FAOD solution 3.83 U / mL. The sections were incubated at 37°C for 24 h.

[0079] After incubation, the tissue sections were carefully washed with distilled water and dried overnight at 37°C. The sections were then stained and coverslipped. Infrared (IR) microspectroscopy combines light microscopy with IR spectroscopy and is a powerful analytical technique for selectively visualizing the biochemistry of tissue sections (18, 19). IR spectroscopy is based on the principle that different regions of IR light are absorbed by various molecules within tissue (e.g., carbohydrates, proteins, and lipids) (19, 20). In a typical IR microspectroscopy system, visible light is used to visualize and target areas of interest on the tissue section. Once the specific region is found (e.g., a specific drusen), the system is switched to the IR configuration, and IR light is beamed onto the desired target (19).

[0080] To obtain chemical fingerprints of drusen lesions on the same tissue sections used for light microscopy, Fourier transform near-infrared (FT-NIR) transmission microscopy spectra were recorded using a Bruker Hyperion 2000 microscope coupled to a Bruker Vertex 80v FTIR spectrometer (Bruker, MA, USA) operating with a halogen light source, a CaF2 beam splitter, and an InGaAs detector. The microscope objective magnification was set to 15x and the aperture was set to 20 μm × 20 μm. Background was collected with 800 co-adds. Spectra were recorded (800 scans) in the range of 12,000–4,000 cm⁻¹ with a resolution of 16 cm⁻¹. Spectral data analysis was performed using SIMCA software version 15.0 (MKS Data Analytics Solutions, Malmö, Sweden).

[0081] Various preprocessing steps were performed to minimize extraneous light scattering and normalize the spectroscopic signals. Differentiation was performed to highlight small structural differences and reduce baseline effects (21). Standard normal variate normalization (SNV) was performed to eliminate multiplicative scaling effects and additional baseline offset variability. After preprocessing, the spectral data were analyzed by unsupervised pattern recognition methods such as principal component analysis (PCA) and supervised pattern recognition methods such as partial least squares discriminant analysis (PLS-DA), a useful method for illustrating which variables are involved in the discrimination between two distinct groups. The resulting Hotelling plots show a clear distinction between Druesen treated with FN3K and Druesen treated with FAOD.

[0082] Example 10 Mixtures of fructose and lysine, fructose and arginine, glucose and arginine, and glucose-lysine were incubated at 37°C for 1 week. After incubation, aliquots of the mixtures were digested with fructosyl amino oxidase (FAOD, 38.3 U / mL) and fructosamine 3-kinase (F3K, 250 μg / mL; ATP, 5 mmol / L; MgCl2, 2 mmol / L), respectively. An untargeted metabolite profiling approach based on ultra-high performance liquid chromatography (UHPLC) coupled with high resolution mass spectrometry (HRMS) was applied.

[0083] material and method sample Mixtures prior to treatment with enzymes (Group 1): • A mixture of glucose (100 mg / mL) and arginine (100 mg / mL) in water incubated at 37°C for 1 week. • A mixture of fructose (100 mg / mL) and arginine (100 mg / mL) in water incubated at 37°C for 1 week. • A mixture of glucose (100 mg / mL) and lysine (100 mg / mL) in water incubated at 37°C for 1 week. • A mixture of fructose (100 mg / mL) and lysine (100 mg / mL) in water incubated at 37°C for 1 week.

[0084] Mixture after treatment with enzyme (Group 2): • Mixed Glu-Arg treated with FAOD; • Mixed Glu-Arg treated with FN3K; ● Mixed Fru-Arg treated with FAOD; • Mixed Fru-Arg treated with FN3K; ● Mixed Glu-Lys treated with FAOD; • Mixed Glu-Lys treated with FN3K; • Mixed Fru-Lys treated with FN3K.

[0085] In addition, solutions of glucose, fructose, arginine and lysine were also provided for optimization purposes and to study the MS fragmentation patterns of these compounds.

[0086] UHPLC-HRMS conditions Chromatographic separation was achieved using a Zorbax RRHD Eclipse Plus reversed-phase C18 column (100A, 1.8 μm, 100 mm × 2.1 mm) on an Accela 1250 pump (Thermo Fisher Scientific). The mobile phase consisted of 0.1% (v / v) formic acid in water (eluent A) and 0.1% (v / v) formic acid in methanol (eluent B). The gradient elution program was applied as follows: 0–0.5 min: 5% B, 0.5–20.0 min: 5–99% B, 20.0–21.0 min: 99% B, 21.0–24.0 min: 99–5% B, and 24.0–28.0 min: 5% B. The mobile phase flow rate was 0.3 mL / min. The column temperature was set at 40 °C, and the autosampler temperature was 10 °C. The injection volume was 5 μL.

[0087] High-resolution accurate mass and tandem mass spectrometry (MS / MS) fragmentation data were acquired using a Q-Exactive hybrid quadrupole-Orbitrap mass spectrometer (Thermo Fisher Scientific) equipped with a heated electrospray ionization (HESI-II) interface. The instrument was operated in positive ionization mode. Data acquisition included full MS and data-dependent MS / MS scans. The ionization source parameters were as follows: spray voltage 3.0 kV, capillary temperature 350 °C, heater temperature 375 °C, sheath gas flow rate 45 arbitrary units (au), and auxiliary gas flow rate 10 a.u. Daily external calibration of the HRMS was performed using Calmix solution from Thermo Scientific over a mass range of 138 to 1721 Da. Online mass calibration was enabled using diisooctyl phthalate (C24H38O4) as the lock mass.

[0088] The instrument was controlled by Xcalibur 4.2 software (Thermo Fisher Scientific). For data processing, both Xcalibur and Compound Discoverer 3.3 software (Thermo Fisher Scientific) were used.

[0089] result Detection of related compounds in the investigated samples Processing of the data generated by UHPLC-HRMS / MS analysis revealed the presence of a large number of compounds in the samples investigated (±800 distinct compounds were detected in each sample). The majority of compounds detected in a given sample from Group 2 (i.e., a mixture of specific amino acids and sugars incubated at 37°C and subsequently treated with enzymes) were also present in the corresponding sample from Group 1 (i.e., a mixture of specific amino acids and sugars incubated at 37°C but not treated enzymatically).

[0090] Therefore, detected MS peaks were considered relevant (i.e., potential advanced glycation end products (AGEs)) when they met the following criteria: No compound is present in the blank (water). • For a given sample from group 1, the detected compound is not present in samples obtained using the same sugar and a different amino acid. For a given sample from group 2, the detected compound is not present in samples obtained using the same sugar and enzyme but a different amino acid. For the arginine-containing and lysine-containing samples, 40 and 19 related compounds (potentially AGEs) were selected, respectively.

[0091] Comparative analysis of MS FAOD and F3K digestion Eliminates AGEs (A = arginine-based, L = lysine-based) Strong = >80% reduction (vs. untreated sample) Weak: Reduction between 20 and 40% Inactive: Less than 20% difference

[0092] [Table 2]

[0093] Products formed [Table 3]

[0094] Conclusion: Both F3K and FAOD can degrade various advanced glycation end products. FAOD recognizes substrates that are not recognized by F3K (compounds #A3 and #A4). The effect of FAOD on AGE degradation is generally more pronounced than that of F3K.

[0095] References [Table 4-1]

Table 4-2

Claims

1. A composition comprising fructosyl amino acid oxidase for use in treating presbyopia, cataracts, age-related macular degeneration, dry eye syndrome, diabetic retinopathy and / or glaucoma.

2. The composition of claim 1 further comprising flavin adenine dinucleotide (FAD).

3. The composition of claim 1 or 2, further comprising fructosamine-3-kinase and adenosine triphosphate (ATP).

4. The composition of claim 3 further comprising magnesium ions.

5. The composition according to any one of claims 1 to 4, further comprising a peroxidase.

6. The composition according to any one of claims 1 to 5, which is administered as drops or via any other external application, or via internal application.

Images