Methods for qualitatively and / or quantitatively analyzing the properties of activating antibodies and uses thereof

JP7779882B2Active Publication Date: 2025-12-03CYTOMX THERAPEUTICES INC
View PDF 6 Cites 0 Cited by

Patent Information

Application Number
JP2023122354
Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Priority Date
2017-07-20
Filing Date
2023-07-27
Publication Date
2025-12-03
Estimated Expiration
2038-07-20

Smart Images

  • Figure 0007779882000016
    Figure 0007779882000016
  • Figure 0007779882000017
    Figure 0007779882000017
  • Figure 0007779882000018
    Figure 0007779882000018
Patent Text Reader

Abstract

To provide methods and kits for qualitatively and / or quantitatively analyzing activation and other properties of activatable antibody therapeutic in biological samples, including tissues and / or biofluid samples.SOLUTION: The invention includes that: i) a loaded capillary or a set of loaded capillaries is loaded with a laminate matrix and a separation matrix in advance and brought into contact; ii) one or more high molecular weight (MW) components of a biological sample are separated from one or more low molecular weight (MW) components of the biological sample in each capillary; iii) the high MW components and low MW components are immobilized in each capillary; iv) each capillary is immunity probed with at least a first reagent which is specific to at least one activatable antibody; and v) the first reagent level in each capillary or set of capillaries is detected and quantified.SELECTED DRAWING: Figure 1A
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of U.S. Provisional Application No. 62 / 534,931, filed July 20, 2017 (35 U.S.C. § 119(e)), the contents of which are incorporated herein by reference in their entirety.

[0002] Technical Field The present invention generally relates to methods for qualitatively and / or quantitatively analyzing the activation and other properties of activatable antibody therapeutics in biological samples, such as tissue and / or biological fluid samples. The present invention also relates to methods for qualitatively and / or quantitatively analyzing activation levels in biological samples, such as tissue and / or biological fluid samples, using a capillary-based immunoassay platform. [Background technology]

[0003] Although antibody-based therapeutics have proven to be effective treatments for several diseases, in some cases, toxicity due to broad target expression limits therapeutic efficacy. Furthermore, antibody-based therapeutics exhibit other limitations, such as rapid clearance from the circulation after administration. In the area of ​​small molecule therapeutics, strategies have been developed to provide prodrugs of active chemical moieties. These prodrugs are administered in a relatively inactive (or significantly less active) form. Upon administration, the prodrug is metabolized in vivo to the active compound. Such prodrug strategies can increase the selectivity of the drug for its intended target and result in reduced adverse effects.

[0004] To overcome the limitations of antibody-based therapeutics, activatable antibody-based therapeutics have been designed.

[0005] There is a need to be able to monitor and quantitatively analyze the activation of these activatable antibody-based therapeutics. Summary of the Invention

[0006] The present invention relates to a method for quantifying the activation level of an activatable antibody, the method comprising: i) contacting the loaded capillary or population of loaded capillaries with a biological sample containing one or more components selected from the group consisting of an activatable antibody, an activated activatable antibody, and combinations thereof; contacting a loaded capillary or a population of loaded capillaries, the capillaries being pre-loaded with a stacking matrix and a separation matrix; ii) separating one or more high molecular weight (MW) components of the biological sample from one or more low molecular weight (MW) components of the biological sample in each capillary; iii) immobilizing a high MW component and a low MW component in each capillary; iv) immunoprobing each capillary with at least a first reagent specific to at least one activatable antibody; v) detecting and quantifying the level of the first reagent in each capillary or population of capillaries; Includes:

[0007] In one embodiment, step ii) comprises separating high molecular weight components of the biological sample in each capillary from low molecular weight components of the biological sample by capillary electrophoresis.

[0008] In further embodiments, the activatable antibody is selected from the group consisting of a conjugated activatable antibody, a multispecific activatable antibody, and a conjugated multispecific activatable antibody.

[0009] In some embodiments, the first reagent comprises an anti-idiotypic antibody or antigen-binding fragment thereof.

[0010] In another embodiment, step iv) further comprises loading each capillary with a second reagent that specifically binds to the first reagent. In some embodiments, the second reagent is detectably labeled. In other embodiments, the second reagent is not detectably labeled, and step iv) further comprises loading each capillary with a third reagent that specifically binds to the second reagent.

[0011] In a further embodiment, the present invention provides a kit comprising: (i) activatable antibody standard curve reagent; (ii) activated activatable antibody standard curve reagent; (iii) an anti-id primary antibody with binding specificity for the activatable antibody; [Brief explanation of the drawings]

[0012] [Figure 1A] Figure 1A is a series of graphs showing the screening of the PL07-2001-C5H9v2 anti-idiotypic (anti-id) clone against 37% one-arm activated activatable antibody at 0.11, 0.33, and 1 μg / ml in human plasma at 1:100. Figure 1A is an electropherogram showing the detection of 17G1 at decreasing concentrations of one-arm activated PL07-2001-C5H9v2 (1 μg / ml, 0.33 μg / ml, and 0.11 μg / ml, referred to in the figure as AA MIX). [Figure 1B] Figure 1B is a series of graphs showing the screening of PL07-2001-C5H9v2 anti-idiotype (anti-id) clones against one-arm activated activatable antibodies at 0.11, 0.33, and 1 μg / ml in human plasma at 1:100, yielding 37% activation. Figure 1B shows the relative activation rates of the top six one-arm activated activatable antibody clones. Relative activation rates are maintained at various concentrations. The 21H10 and 27C1 clones have low affinity, so there is no data for the 0.11 μg / ml concentration. [Figure 2A]

[0023] Figure 2C is a series of graphs showing that the antibody designated herein as 17G1 has high specificity for the activatable antibody (AA) PL07-2001-C5H9v2. 17G1 was assessed for specificity in Wes by spiking 160 ng / ml of one-arm activated PL07-2001-C5H9v2 (activated AA) into either human plasma (Figure 2C) or lung tumor lysate (Figure 2D). [Figure 2B]

[0023] Figure 2C is a series of graphs showing that the antibody designated herein as 17G1 has high specificity for the activatable antibody (AA) PL07-2001-C5H9v2. 17G1 was assessed for specificity in Wes by spiking 160 ng / ml of one-arm activated PL07-2001-C5H9v2 (activated AA) into either human plasma (Figure 2C) or lung tumor lysate (Figure 2D). [Figure 2C]

[0023] Figure 2C is a series of graphs showing that the antibody designated herein as 17G1 has high specificity for the activatable antibody (AA) PL07-2001-C5H9v2. 17G1 was assessed for specificity in Wes by spiking 160 ng / ml of one-arm activated PL07-2001-C5H9v2 (activated AA) into either human plasma (Figure 2C) or lung tumor lysate (Figure 2D). [Figure 2D]

[0023] Figure 2C is a series of graphs showing that the antibody designated herein as 17G1 has high specificity for the activatable antibody (AA) PL07-2001-C5H9v2. 17G1 was assessed for specificity in Wes by spiking 160 ng / ml of one-arm activated PL07-2001-C5H9v2 (activated AA) into either human plasma (Figure 2C) or lung tumor lysate (Figure 2D). [Figure 3A]3A-3C are a series of graphs showing the specific detection of activatable antibody (AA) therapeutics by selective anti-idiotypic antibodies. Figure 3A shows the detection of anti-PDL1 activatable antibody (referred to herein as PL07-2001-C5H9v2) in the plasma of mice treated with 10 mg / kg of PL07-2001-C5H9v2 using commercially available A110UK (goat anti-human IgG (H&L) adsorbed to unlabeled monkey) from American Qualex (available at the website aqsp.com / ). [Figure 3B] Figure 3A is a series of graphs showing the specific detection of activatable antibody (AA) therapeutics by selective anti-idiotypic antibodies. Figure 3B shows the detection of PL07-2001-C5H9v2 in the plasma of mice treated with 0.1 mg / kg of PL07-2001-C5H9v2 using the anti-idiotypic 17G1 antibody. [Figure 4A]

[0023] Figure 4A and Figure 4B are a series of graphs showing preferential activation of activatable antibody (AA) therapeutics in plasma versus tumor as detected in a xenograft tumor model. MDA-MB-231 xenografted mice were treated with 1 mg / ml of anti-PDL1 activatable antibody (referred to herein as PL07-2001-C5H9v2). Tumor and plasma samples were collected on day 4. Figures 4A and 4B show analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 4B]

[0023] Figure 4A and Figure 4B are a series of graphs showing preferential activation of activatable antibody (AA) therapeutics in plasma versus tumor as detected in a xenograft tumor model. MDA-MB-231 xenografted mice were treated with 1 mg / ml of anti-PDL1 activatable antibody (referred to herein as PL07-2001-C5H9v2). Tumor and plasma samples were collected on day 4. Figures 4A and 4B show analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 5A]5A and 5B are a series of graphs showing the preferential activation of activatable antibody therapeutics in plasma versus tumors detected in another xenograft tumor model. SAS xenograft mice were treated with 0.1 mg / kg of anti-PDL1 activatable antibody (referred to herein as PL07-2001-C5H9v2). Figures 5A and 5B show the analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 5B] 5A and 5B are a series of graphs showing the preferential activation of activatable antibody therapeutics in plasma versus tumors detected in another xenograft tumor model. SAS xenograft mice were treated with 0.1 mg / kg of anti-PDL1 activatable antibody (referred to herein as PL07-2001-C5H9v2). Figures 5A and 5B show the analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 6A]

[0023] Figure 6A and Figure 6B are a series of graphs showing preferential activation of activatable antibody therapeutic in plasma versus tumor detected in a xenograft tumor model using an anti-CD166 activatable antibody (referred to herein as 7614.6-3001-HuCD166). H292 xenografted mice were treated with 5 mg / kg of 7614.6-3001-HuCD166. Tumor and plasma samples were collected on day 1. Figures 6A and 6B show analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 6B]

[0023] Figure 6A and Figure 6B are a series of graphs showing preferential activation of activatable antibody therapeutic in plasma versus tumor detected in a xenograft tumor model using an anti-CD166 activatable antibody (referred to herein as 7614.6-3001-HuCD166). H292 xenografted mice were treated with 5 mg / kg of 7614.6-3001-HuCD166. Tumor and plasma samples were collected on day 1. Figures 6A and 6B show analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 7A]

[0033] Figures 7A and 7B are a series of graphs showing preferential activation of activatable antibody therapeutics in plasma versus tumor as detected in a xenograft tumor model using EGFR activatable antibodies with different substrates. H292 xenografted mice were treated with 25 mg / kg of either C225-3954-2001 or C225-3954-3001 activatable antibody therapeutics. Tumor and plasma samples were collected on day 4. Figures 7A and 7B show analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 7B]

[0033] Figures 7A and 7B are a series of graphs showing preferential activation of activatable antibody therapeutics in plasma versus tumor as detected in a xenograft tumor model using EGFR activatable antibodies with different substrates. H292 xenografted mice were treated with 25 mg / kg of either C225-3954-2001 or C225-3954-3001 activatable antibody therapeutics. Tumor and plasma samples were collected on day 4. Figures 7A and 7B show analysis of tumor homogenate and plasma samples by the capillary electrophoresis immunoassay method of the present invention. [Figure 8] 1 is a graph of results obtained from a capillary electrophoresis immunoassay method of the present invention for assessing the ratio of activated anti-CD71 activatable antibody (referred to herein as TF02.13-2011-21.12) to non-activated anti-CD71 activatable antibody in a biological sample, which was used to separate pre-activated activatable antibody mixed with non-activated, i.e., intact, activatable antibody in the presence of human plasma. [Figure 9] 1 is a graph showing results obtained using a capillary electrophoresis immunoassay method of the present disclosure to assess the ratio of activated anti-PD1 activatable antibody (referred to herein as PD34-2011-A1.5 hIgG4 S228P) to non-activated anti-PD1 activatable antibody in a biological sample. This method was used to separate pre-activated activatable antibody mixed with non-activated, i.e., intact, activatable antibody in the presence of human plasma. [Figure 10A]10A-10B are a series of graphs showing results obtained using a capillary electrophoresis immunoassay method of the present disclosure to evaluate activatable antibody (AA) therapeutics (AA Tx) activated with an anti-CD166 activatable antibody (referred to herein as 7614.6-3001-HuCD166) and intact (i.e., non-activated) activatable antibody (AA) therapeutics (AA Tx). Using the capillary immunoassay method of the present disclosure, 7614.6-3001-HuCD166 activatable antibody that had been partially activated by matriptase (FIG. 10A) or MMP-14 (FIG. 10B) was separated from intact 7614.6-3001-HuCD166 activatable antibody. [Figure 10B] 10A-10B are a series of graphs showing results obtained using a capillary electrophoresis immunoassay method of the present disclosure to evaluate activatable antibody (AA) therapeutics (AA Tx) activated with an anti-CD166 activatable antibody (referred to herein as 7614.6-3001-HuCD166) and intact (i.e., non-activated) activatable antibody (AA) therapeutics (AA Tx). Using the capillary immunoassay method of the present disclosure, 7614.6-3001-HuCD166 activatable antibody that had been partially activated by matriptase (FIG. 10A) or MMP-14 (FIG. 10B) was separated from intact 7614.6-3001-HuCD166 activatable antibody. [Figure 11A] Figure 14 shows the chemiluminescent signals of activated activatable antibody (cleavage product of 7614.6-3001-HuCD166) and intact / activated activatable antibody (intact 7614.6-3001-HuCD166) using two-step and three-step detection protocols, respectively, as described in Example 11. [Figure 11B] Figure 14 shows the chemiluminescent signals of activated activatable antibody (cleavage product of 7614.6-3001-HuCD166) and intact / activated activatable antibody (intact 7614.6-3001-HuCD166) using two-step and three-step detection protocols, respectively, as described in Example 11. [Figure 12]FIG. 1 shows the chemiluminescent signal detected for anti-Jagged (intact) activatable antibody 5342-3001-4D11 and the corresponding activated activatable antibody in tumor tissue. DETAILED DESCRIPTION OF THE INVENTION

[0013] The present disclosure provides methods and kits for qualitatively and / or quantitatively analyzing activation and other properties of activatable antibody activation in biological samples, including tissue and / or biological fluid samples, using a capillary-based immunoassay platform.

[0014] An activatable antibody typically comprises at least (i) an antibody or antigen-binding fragment thereof (AB) that specifically binds a target, (ii) a masking moiety (MM) linked to the AB such that the AB inhibits binding of the AB to its target when the activatable antibody is in an uncleaved or intact state, and (iii) a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease. Activatable antibodies are generally activated in the presence of a protease for which the substrate of the CM functions as a substrate, and the protease cleaves the CM substrate, thus generating an "activated" (or "cleaved") activatable antibody. Activatable antibodies may also be in the form of a conjugated activatable antibody, a multispecific activatable antibody, a conjugated multispecific activatable antibody, etc. Activatable antibodies are described in more detail below.

[0015] It would be useful to be able to qualitatively and / or quantitatively measure characteristics of activatable antibodies in a biological sample, such as the activation level of the activatable antibody in the biological sample, the total amount of activated, i.e., cleaved, activatable antibody and / or intact, i.e., inactivated, activatable antibody in the biological sample, or any combination or correlation thereof. Such methods are useful for monitoring the effectiveness of activatable antibodies and activatable antibody-based therapeutics at any stage of development and / or therapeutic treatment. For example, in some embodiments, the methods and kits provided herein are useful for testing the effectiveness of activatable antibodies and activatable antibody-based therapeutics prior to administration to a subject in need thereof and / or during a treatment regimen to monitor the effectiveness of the activatable antibodies and activatable antibody-based therapeutics over and / or after a treatment period. In some embodiments, the methods and kits provided herein are useful for providing retrospective analysis of activatable antibodies and activatable antibody-based therapeutics.

[0016] In some embodiments, the present disclosure provides a method for quantifying the activation level of an activatable antibody, the method comprising: i) contacting the loaded capillary or population of loaded capillaries with a biological sample containing one or more components selected from the group consisting of an activatable antibody, an activated activatable antibody, and combinations thereof; contacting a loaded capillary or a population of loaded capillaries, the capillaries being pre-loaded with a stacking matrix and a separation matrix; ii) separating one or more high molecular weight (MW) components of the biological sample from one or more low molecular weight (MW) components of the biological sample in each capillary; iii) immobilizing a high MW component and a low MW component in each capillary; iv) immunoprobing each capillary with at least a first (primary) reagent specific for at least one activatable antibody; v) detecting and quantifying the level of the first (primary) reagent in each capillary or population of capillaries; Includes:

[0017] In some embodiments, the method further comprises, prior to step i), loading at least one capillary or population of capillaries with a stacking matrix and a separation matrix to produce at least one loaded capillary or population of loaded capillaries.

[0018] As used herein, the term "stacking matrix" refers to a highly porous material (relative to the separation matrix) that functions to concentrate proteins present in a biological sample and "stacking" the proteins at the interface with the separation matrix so that the proteins begin migration from the same physical starting point under electrophoretic conditions. A suitable stacking matrix for use in the practice of the present invention can be prepared from the same materials and compositions used to prepare stacking gels for Western blotting (e.g., acrylamide, 0.5 M Tris-HCl (pH 6.8), SDS, water, ammonium persulfate, and N,N,N',N'-tetramethylethylenediamine (TEMED)). The term "separation matrix" as used herein refers to a material that promotes separation of proteins based on molecular weight under electrophoretic conditions. A suitable separation matrix for use in the practice of the present invention can be prepared from the same materials and compositions used to prepare separation gels for Western blotting (e.g., water, acrylamide, Tris-HCl (pH 8.8), SDS, TMED, ammonium persulfate, etc.). Capillaries pre-loaded with stacking matrices and separation matrices can be obtained commercially, for example, from ProteinSimple (supplier of Wes™ Separation Module capillary cartridges and associated reagents for use in Wes™ capillary electrophoresis immunoassay systems).

[0019] The loaded capillary or population of loaded capillaries is then contacted with a biological sample to initiate loading of the biological sample into each loaded capillary. The biological sample typically contains at least one relatively high molecular weight component that is an activatable antibody (whether intact or uncleaved) (e.g., including a conjugated activatable antibody, a multispecific activatable antibody, or a conjugated multispecific activatable antibody) and at least one relatively low molecular weight component that is an activated (cleaved) activatable antibody. Often, the biological sample contains both an activatable antibody (whether intact or uncleaved) and an activated (cleaved) activatable antibody species. In some embodiments, the biological sample comprises a bodily fluid from a subject. In some embodiments, the bodily fluid is isolated from anywhere in the subject's body. In some embodiments, the bodily fluid is blood or a blood component such as plasma or serum. In some embodiments, the biological sample comprises a cell culture supernatant. In some embodiments, the biological sample comprises a tissue sample from a subject. The tissue sample can be isolated from anywhere in the subject's body. In some embodiments, the tissue sample is a tumor sample.

[0020] In some embodiments, the biological sample is from a mammal, such as a human, a non-human primate, a companion animal (e.g., a cat, a dog, a horse), a farm animal, a working animal, or a zoo animal. In some embodiments, the subject is a human. In some embodiments, the subject is a companion animal. In some embodiments, the subject is an animal receiving veterinary care.

[0021] In some embodiments, step i) comprises loading about 1-500 ng of biological sample, or any value and / or range between about 1-500 ng of biological sample. In some embodiments, step i) comprises loading about 5-40 ng of biological sample. In some embodiments, the biological sample is prepared using one or more buffers in an amount sufficient to result in molecular weight separation. In some embodiments, the biological sample is prepared using one or more SDS-containing buffers in an amount sufficient to result in molecular weight separation.

[0022] Separation of one or more high molecular weight component(s) (e.g., (intact) activatable antibody) from one or more low molecular weight component(s) (e.g., (cleaved) activated activatable antibody) of the biological sample in each capillary can be achieved by subjecting each capillary to electrophoresis. Electrophoresis causes compounds in the biological sample to migrate through a separation gel at different rates depending on their molecular size (e.g., molecular weight). In some embodiments, the separation is carried out over a period (i.e., "separation time") of less than about 35 minutes. Often, the separation time is at least about 35 minutes, or at least about 36 minutes, or at least about 37 minutes, or at least about 38 minutes.

[0023] Any suitable immobilization method and reagents can be used to immobilize the high and low molecular weight components within each capillary (e.g., on the interior surface of each capillary). In some embodiments, step iii) involves using UV light to immobilize the high MW components (e.g., (intact) activatable antibodies) and low MW components (e.g., (cleaved) activated activatable antibodies) of the biological sample. This step results in the immobilization of the (intact) activatable antibodies and (cleaved) activatable antibodies present in the biological sample. A suitable system for performing the capillary electrophoresis and immobilization steps is the Wes™ Capillary Electrophoresis Immunoassay System (ProteinSimple).

[0024] In carrying out the methods of the present invention, each capillary is immunoprobed with a first reagent having binding specificity for at least one activatable antibody. Typically, the first reagent is a primary antibody. Often, the first reagent comprises an anti-idiotypic (id) antibody or antigen-binding fragment thereof. When the MM and CM of an activatable antibody are bound to the light chain of the activatable antibody, an anti-idiotypic antibody or antigen-binding fragment thereof that binds to the variable light (VL) region of the activatable antibody is typically used. Often, in these embodiments, the anti-idiotypic antibody or antigen-binding fragment thereof has binding specificity for a VL CDR selected from the group consisting of VL CDR1, VL CDR2, and VL CDR3. When the MM and CM of an activatable antibody are bound to the heavy chain of the activatable antibody, an anti-idiotypic antibody or antigen-binding fragment thereof that binds to the variable heavy (VH) region of the activatable antibody is typically used. In these embodiments, the anti-idiotype antibody or antigen-binding fragment thereof often has binding specificity for a VH CDR selected from the group consisting of VH CDR1, VH CDR2, and VH CDR3. In some embodiments, it may be desirable to use a combination of two or more anti-idiotype antibody species (or antigen-binding fragments thereof). Exemplary anti-id antibodies and their use in the methods of the invention are described in the Examples below.

[0025] Detection of the first reagent can be achieved in various ways. For example, in one embodiment, step v) further comprises immunoprobing each capillary with an additional second reagent that specifically binds to or recognizes the first reagent. In this embodiment, each capillary is loaded with the second reagent. Typically, the second reagent comprises a secondary antibody that specifically binds to the first reagent.

[0026] In some embodiments, the first and / or second reagents are detectably labeled. As used herein, the term "detectable label" refers to a moiety that can be detected directly or indirectly, such as, for example, a fluorescent label, a reporter enzyme (e.g., used in combination with a chemiluminescent substrate, a colorimetric substrate, etc.). Exemplary reporter enzymes include, for example, peroxidases (e.g., horseradish peroxidase (HRP)), alkaline phosphatase, etc. Exemplary detectably labeled second reagents suitable for use in the practice of the present invention include HRP-conjugated anti-mouse secondary antibodies, HRP-conjugated anti-goat secondary antibodies, HRP-conjugated anti-human secondary antibodies, etc. In many cases, a chemiluminescent substrate is added to provide the final detectable signal. Suitable chemiluminescent substrate systems are known in the art and include, for example, luminol + peroxide.

[0027] In other embodiments, the second reagent is not detectably labeled (e.g., not conjugated to a detectable label such as a reporter enzyme). In this embodiment, the second reagent is typically a secondary antibody that normally binds to a first binding tag of the set of first and second binding tags, and the first binding tag can bind to a second binding tag. The method further includes step v) of loading each capillary with a third (tertiary) reagent that specifically binds to the second reagent. The third reagent typically includes a second binding tag and a detectable label, such as a reporter enzyme or fluorescent label. Exemplary first and second binding tags include biotin and streptavidin, streptavidin and biotin, biotin and avidin, and avidin and biotin, respectively. This "tertiary detection method" is believed to enhance the signal associated with the activatable antibody and activatable antibody species, thereby facilitating the detection and quantification steps. Exemplary second and third reagents used in this embodiment include a second reagent that is a secondary antibody conjugated to streptavidin, and a third reagent that is a reporter enzyme conjugated to biotin (e.g., HRP-conjugated biotin). A chemiluminescence system is typically used to generate the signal that is ultimately detected (e.g., luminol + peroxide). This method is shown in Example 11 herein.

[0028] In some embodiments, the at least one detectable reagent in step v) comprises at least a first reagent specific for at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, and a second reagent that specifically binds to or recognizes the first reagent, wherein the second reagent comprises a detectable label.

[0029] In some embodiments, step v) comprises quantifying the level of detectable label in each capillary or population of capillaries.

[0030] In some embodiments, the first reagent in step iv) is an antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof. In some embodiments, the second reagent in step iv) is a detectably labeled secondary antibody that specifically binds to the first reagent. In some embodiments, the first reagent in step iv) is a primary antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, and the second reagent in step iv) is a detectably labeled secondary antibody that specifically binds to the primary antibody or antigen-binding fragment thereof. In some embodiments, the detectable label is conjugated to the second reagent. In some embodiments, the detectable label is horseradish peroxidase (HRP).

[0031] In some embodiments, the primary reagent, secondary reagent, and / or tertiary reagent, or each of the primary reagent, secondary reagent, and tertiary reagent, is an antibody or antigen-binding fragment thereof. In some embodiments, the antibody or antigen-binding fragment thereof that binds to the target is a monoclonal antibody, a domain antibody, a single-chain antibody, a Fab fragment, a F(ab')2 fragment, an scFv, an scAb, a dAb, a single-domain heavy-chain antibody, or a single-domain light-chain antibody. In some embodiments, such an antibody or antigen-binding fragment thereof that binds to the target is a murine, other rodent, chimeric, humanized, or fully human monoclonal antibody.

[0032] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof is generated using methods described herein, e.g., in Example 1.

[0033] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a variable heavy chain complementarity determining region 1 (CDRH1) comprising the amino acid sequence SYGMS (SEQ ID NO: 438); a variable heavy chain complementarity determining region 2 (CDRH2) comprising the amino acid sequence TISPSGIYTYYPVTVKG (SEQ ID NO: 439); a variable heavy chain complementarity determining region 3 (CDRH3) comprising the amino acid sequence HHPNYGSTYLYYIDY (SEQ ID NO: 440); a variable light chain complementarity determining region 1 (CDRL1) comprising the amino acid sequence KSSQSVFSSSNQKNYLA (SEQ ID NO: 441); a variable light chain complementarity determining region 2 (CDRL2) comprising the amino acid sequence WAFTRES (SEQ ID NO: 442); and a variable light chain complementarity determining region 3 (CDRL3) comprising the amino acid sequence YQYLSSLT (SEQ ID NO: 443).

[0034] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429.

[0035] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0036] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 429 and a variable light chain comprising the amino acid sequence of SEQ ID NO: 431.

[0037] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429.

[0038] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0039] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 429, and an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable light chain comprising the amino acid sequence of SEQ ID NO: 431.

[0040] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:444.

[0041] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO:445.

[0042] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 444 and a light chain comprising the amino acid sequence of SEQ ID NO: 445.

[0043] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a heavy chain comprising the amino acid sequence of SEQ ID NO:444.

[0044] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a light chain comprising the amino acid sequence of SEQ ID NO:445.

[0045] In some embodiments, a primary antibody that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a heavy chain comprising the amino acid sequence of SEQ ID NO: 444, and an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a light chain comprising the amino acid sequence of SEQ ID NO: 445.

[0046] In some embodiments, the detectable label is attached to the second reagent. In some embodiments, the detectable label is a fluorescent label, such as HRP, and step v) comprises detecting the level of chemiluminescence in each capillary or population of capillaries.

[0047] In some embodiments, the methods provided herein are used to quantify the activation of one or more activatable antibodies in a biological sample. For example, activation can be calculated as a percentage based on the total amount of detected and activated activatable antibody species. In some embodiments, the methods provided herein are used to compare the amount of activated activatable antibody or activatable antibody-based therapeutic and the amount of intact activatable antibody or activatable antibody-based therapeutic in a biological sample. In some embodiments, the methods provided herein are used to profile, stratify, or classify in vivo protease activity in a biological sample. Attributes of the signal peak resulting from the detection step (i.e., corresponding to the detected signal relative to molecular weight) can be used as a basis for quantifying the level of the first reagent (i.e., detected directly or indirectly via a detectably labeled secondary or detectably labeled tertiary reagent). For example, peak height or area under the curve and other similar methods may be utilized. Typically, step v) involves quantifying the level of the first reagent in each capillary or population of capillaries and comparing the level of the first reagent, detected either directly or indirectly, to a standard curve of activatable antibody and activated activatable antibody, the generation of which is shown in Example 13 below.

[0048] As described herein, in some embodiments, the activatable antibody-based therapeutic is a conjugated activatable antibody, a multispecific activatable antibody, a conjugated multispecific activatable antibody, or any combination thereof.

[0049] In some embodiments, the primary reagent, the secondary reagent, or both the primary and secondary reagents are antibodies or antigen-binding fragments thereof. In some embodiments, the target-binding antibodies or antigen-binding fragments thereof are monoclonal antibodies, domain antibodies, single-chain antibodies, Fab fragments, F(ab')2 fragments, scFvs, scAbs, dAbs, single-domain heavy-chain antibodies, or single-domain light-chain antibodies. In some embodiments, such target-binding antibodies or antigen-binding fragments thereof are murine, other rodent, chimeric, humanized, or fully human monoclonal antibodies.

[0050] The methods of the present invention can be used to detect and quantify activation of activatable antibodies having any of a variety of structures. The typical difference between the structure of an intact activatable antibody structure and that of an activated / cleaved activatable antibody structure is a relatively small difference in molecular weight. Detection and quantification can be achieved from even the most complex biological samples. For example, in some embodiments, the present disclosure provides methods for qualitatively and / or quantitatively analyzing activatable antibody therapeutic activation in biological samples, including tissue and / or plasma samples, using a capillary-based immunoassay platform. The methods provided herein are useful with activatable antibody-based therapeutics, including, for example, activatable antibodies, conjugated activatable antibodies, multispecific activatable antibodies, conjugated multispecific activatable antibodies, or any combination thereof. Unless otherwise specified, all disclosures regarding activatable antibodies suitable for use in the methods provided herein are also applicable to and suitable for other activatable antibody-based therapeutics, including, by non-limiting example, activatable antibodies, conjugated activatable antibodies, multispecific activatable antibodies, conjugated multispecific activatable antibodies, or any combination thereof.

[0051] In some embodiments, the present disclosure provides methods for qualitatively and / or quantitatively analyzing the activation of an activatable antibody therapeutic having an antibody or antigen-binding fragment thereof (AB) that specifically binds a target, a masking moiety (MM) linked to the light chain of the AB such that the activatable antibody inhibits binding of the AB to the target when the activatable antibody is in an uncleaved state, and a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease. In some embodiments, the methods are used to quantify or otherwise compare at least (i) levels of activated activatable antibody in which the CM has been cleaved and the MM is not linked to the light chain of the AB, and (ii) levels of intact activatable antibody in which the MM and CM are linked to the light chain of the AB.

[0052] In some embodiments, the activatable antibody and / or AB of the conjugated activatable antibody that specifically binds the target is an antibody. In some embodiments, the target-binding antibody or antigen-binding fragment thereof is a monoclonal antibody, domain antibody, single-chain antibody, Fab fragment, F(ab')2 fragment, scFv, scAb, dAb, single-domain heavy chain antibody, or single-domain light chain antibody. In some embodiments, such target-binding antibody or antigen-binding fragment thereof is a murine, other rodent, chimeric, humanized, or fully human monoclonal antibody.

[0053] An activatable antibody in its activated state binds a target and comprises (i) an antibody or antigen-binding fragment thereof (AB) that specifically binds the target; (ii) a masking moiety (MM) linked to the AB such that the AB inhibits binding of the AB to the target when the activatable antibody is in an uncleaved state; and (iii) a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease.

[0054] In some embodiments, the activatable antibody in its uncleaved state has the following structural arrangement from N-terminus to C-terminus: MM-CM-AB or AB-CM-MM.

[0055] In some embodiments, the activatable antibody comprises a linking peptide between the MM and the CM.

[0056] In some embodiments, the activatable antibody comprises a linking peptide between the CM and the AB.

[0057] In some embodiments, the activatable antibody comprises a first connecting peptide (LP1) and a second connecting peptide (LP2), and the activatable antibody in its uncleaved state has the following structural arrangement from N-terminus to C-terminus: MM-LP1-CM-LP2-AB or AB-LP2-CM-LP1-MM. In some embodiments, the two connecting peptides need not be identical to each other.

[0058] In some embodiments, at least one of LP1 or LP2 is (GS) n , (GGS) n , (GSGGS) n (SEQ ID NO: 339) and (GGGS) n (SEQ ID NO: 340), wherein n is at least one integer and, in some embodiments, does not exceed 20.

[0059] In some embodiments, at least one of LP1 or LP2 comprises an amino acid sequence selected from the group consisting of GGSG (SEQ ID NO: 341), GGSGG (SEQ ID NO: 342), GSGSG (SEQ ID NO: 343), GSGGG (SEQ ID NO: 344), GGGSG (SEQ ID NO: 345), SSSG (SEQ ID NO: 346) and GGGSSGGS (SEQ ID NO: 449).

[0060] In some embodiments, LP1 comprises the amino acid sequence GSSGGSGGSGGSG (SEQ ID NO: 347), GSSGGSGGSGG (SEQ ID NO: 348), GSSGGSGGSGGS (SEQ ID NO: 349), GSSGGSGGSGGSGGGS (SEQ ID NO: 350), GSSGGSGGSG (SEQ ID NO: 351), or GSSGGSGGSGS (SEQ ID NO: 352).

[0061] In some embodiments, LP2 comprises the amino acid sequence GSS, GGS, GGGS (SEQ ID NO: 353), GSSGT (SEQ ID NO: 354), or GSSG (SEQ ID NO: 355).

[0062] In some embodiments, the activatable antibody comprises an antibody or antigen-binding fragment (AB) thereof that specifically binds a target. In some embodiments, the antibody or antigen-binding fragment thereof that binds the target is a monoclonal antibody, a domain antibody, a single chain, a Fab fragment, a F(ab')2 fragment, an scFv, an scAb, a dAb, a single-domain heavy chain antibody, or a single-domain light chain antibody. In some embodiments, such an antibody or antigen-binding fragment thereof that binds the target is a murine, other rodent, chimeric, humanized, or fully human monoclonal antibody.

[0063] In some embodiments, the MM has a dissociation constant for binding to the AB that is greater than the dissociation constant of the AB to the target.

[0064] In some embodiments, the MM has a dissociation constant for binding to the AB that is less than or equal to the dissociation constant of the AB for the target.

[0065] In some embodiments, the MM has a dissociation constant for binding to the AB that is equivalent to the dissociation constant of the AB to the target.

[0066] In some embodiments, the MM has a dissociation constant for binding to the AB that is less than the dissociation constant of the AB to the target.

[0067] In some embodiments, the dissociation constant (K d) is 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 times or more the dissociation constant of AB to the target, or 1-5, 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 10 The ranges are 0 to 1,000, 100 to 10,000, 100 to 100,000, 100 to 1,000,000, 100 to 10,000,000, 1,000 to 10,000, 1,000 to 100,000, 1,000 to 1,000,000, 1000 to 10,000,000, 10,000 to 100,000, 10,000 to 10,000,000, 100,000 to 1,000,000, or 100,000 to 10,000,000 times.

[0068] In some embodiments, the MM does not interfere with or compete with the AB for binding to the target when the activatable antibody is in a cleaved state.

[0069] In some embodiments, the MM is a polypeptide between about 2 and 40 amino acids in length. In some embodiments, the MM is a polypeptide up to about 40 amino acids in length.

[0070] In some embodiments, the MM polypeptide sequence differs from the sequence of the target. In some embodiments, the MM polypeptide sequence is about 50% identical to any natural binding partner of AB. In some embodiments, the MM polypeptide sequence differs from the sequence of the target and is about 40%, 30%, 25%, 20%, 15%, or 10% identical to the natural binding partner of AB.

[0071] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d) is the K of AB when it is not connected to the MM towards the target. d At least twice as large as

[0072] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d is at least five times larger than

[0073] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d is at least 10 times larger than

[0074] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d is at least 20 times larger than

[0075] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d is at least 40 times larger than

[0076] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d is at least 100 times larger than

[0077] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d is at least 1000 times larger than

[0078] In some embodiments, linking the MM to the AB reduces the ability of the AB to bind the target, thereby reducing the dissociation constant (K d ) is the K of AB when it is not connected to the MM towards the target. d At least 10,000 times larger than

[0079] In some embodiments, in the presence of the target, the MM reduces the ability of the AB to bind the target by at least 90% when the CM is not cleaved compared to when the CM is cleaved, as assayed in vitro using a target displacement assay, such as the assay described in PCT Publication No. WO 2010 / 081173, the contents of which are incorporated herein by reference in their entirety.

[0080] In some embodiments, the protease that cleaves the CM is active, e.g., upregulated or otherwise unregulated, in the diseased tissue, and the protease cleaves the CM in the activatable antibody when the activatable antibody is exposed to the protease.

[0081] In some embodiments, the protease co-localizes with the target in the tissue, and the protease cleaves the CM in the activatable antibody when the activatable antibody is exposed to the protease.

[0082] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant that is at least two-fold greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state (i.e., when the activatable antibody is in the cleaved state), the AB binds the target.

[0083] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant that is at least 5-fold greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state (i.e., when the activatable antibody is in the cleaved state), the AB binds the target.

[0084] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant that is at least 10 times greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state (i.e., when the activatable antibody is in the cleaved state), the AB binds the target.

[0085] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant that is at least 20 times greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state (i.e., when the activatable antibody is in a cleaved state), the AB binds the target.

[0086] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant that is at least 40 times greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state, the AB binds the target.

[0087] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant at least 50 times greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state, the AB binds the target.

[0088] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant at least 100 times greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state, the AB binds the target.

[0089] In some embodiments, the CM is positioned in the activatable antibody such that when the activatable antibody is in an uncleaved state, binding of the activatable antibody to the target is reduced and occurs with a dissociation constant that is at least 200-fold greater than the dissociation constant of unmodified AB binding to the target, while in the cleaved state, the AB binds the target.

[0090] In some embodiments, the CM is a polypeptide up to 15 amino acids in length.

[0091] In some embodiments, a CM is a polypeptide comprising a first cleavable portion (CM1) that is a substrate for at least one matrix metalloprotease (MMP) and a second cleavable portion (CM2) that is a substrate for at least one serine protease (SP). In some embodiments, each of the CM1 and CM2 substrate sequences of the CM1-CM2 substrate is independently a polypeptide up to 15 amino acids in length.

[0092] In some embodiments, the CM is a substrate for at least one protease that is, or is suspected to be, upregulated or otherwise unregulated in cancer.

[0093] In some embodiments, the CM is a substrate for at least one protease selected from the group consisting of matrix metalloproteinases (MMPs), thrombin, neutrophil elastase, cysteine ​​proteases, legumain, and serine proteases, such as matriptase (MT-SP1), and urokinase (uPA). Without being bound by theory, it is believed that these proteases are upregulated or otherwise unregulated in at least one of the cancers.

[0094] Exemplary substrates include, but are not limited to, substrates cleavable by one or more of the following enzymes or proteases listed in Table 4.

[0095] In some embodiments, the CM is selected for use with a particular protease, for example, a protease known to co-localize with the target of the activatable antibody.

[0096] In some embodiments, the CM is a substrate for at least one MMP. Examples of MMPs include those listed in Table 4. In some embodiments, the CM is a substrate for a protease selected from the group consisting of MMP9, MMP14, MMP1, MMP3, MMP13, MMP17, MMP11, and MMP19. In some embodiments, the CM is a substrate for MMP9. In some embodiments, the CM is a substrate for MMP14.

[0097] In some embodiments, the CM is selected from the group consisting of the sequences TGRGPSWV (SEQ ID NO: 356); SARGPSRW (SEQ ID NO: 357); TARGPSFK (SEQ ID NO: 358); LSGRSDNH (SEQ ID NO: 359); GGWHTGRN (SEQ ID NO: 360); HTGRSGAL (SEQ ID NO: 361); PLTGRSGG (SEQ ID NO: 362); AARGPAIH (SEQ ID NO: 363); RGPAFNPM (SEQ ID NO: 364); SSRGPAYL (SEQ ID NO: 365); RGPATPIM (SEQ ID NO: 366); RGPA (SEQ ID NO: 367); GGQPSGMWGW (SEQ ID NO: 368); FPRPLGITGL (SEQ ID NO: 369); VHMPLGFLGP (SEQ ID NO: 370); SPLTGRSG (SEQ ID NO: 371); SAGFSLPA (SEQ ID NO: 372); LAPLGLQRR (SEQ ID NO: 373); SGGPLGVR (SEQ ID NO: 364); Column number 374); PLGL (sequence number 375); LSGRSGNH (sequence number 789); SGRSANPRG (sequence number 790); LSGRSDDH (sequence number 791); LSGRSDIH (sequence number 792); LSGRSDQH (sequence number 793); LSGRSDTH (sequence number 794); LSGRSDYH (sequence number 795); LSGRSDNP (sequence number 796); LSGRSANP (sequence number 797); LSGRSANI (sequence number 798); LSGRSDNI (sequence number 799); MIAPVAYR (sequence number 800); RPSPMWAY (sequence number 801); WATPRPMR (sequence number 802); FRLLDWQW (sequence number 803); ISSGL (sequence number 804); ISSGLLS (sequence number 805); and / or ISSGLL (sequence number 806).

[0098] In some embodiments, the CM comprises the amino acid sequence LSGRSDNH (SEQ ID NO: 359). In some embodiments, the CM comprises the amino acid sequence TGRGPSWV (SEQ ID NO: 356). In some embodiments, the CM comprises the amino acid sequence PLTGRSGG (SEQ ID NO: 362). In some embodiments, the CM comprises the amino acid sequence GGQPSGMWGW (SEQ ID NO: 368). In some embodiments, the CM comprises the amino acid sequence FPRPLGITGL (SEQ ID NO: 369). In some embodiments, the CM comprises the amino acid sequence VHMPLGFLGP (SEQ ID NO: 370). In some embodiments, the CM comprises the amino acid sequence PLGL (SEQ ID NO: 375). In some embodiments, the CM comprises the amino acid sequence SARGPSRW (SEQ ID NO: 357). In some embodiments, the CM comprises the amino acid sequence TARGPSFK (SEQ ID NO: 358). In some embodiments, the CM comprises the amino acid sequence GGWHTGRN (SEQ ID NO: 360). In some embodiments, the CM comprises the amino acid sequence HTGRSGAL (SEQ ID NO: 361). In some embodiments, the CM comprises the amino acid sequence AARGPAIH (SEQ ID NO: 363). In some embodiments, the CM comprises the amino acid sequence RGPAFNPM (SEQ ID NO: 364). In some embodiments, the CM comprises the amino acid sequence SSRGPAYL (SEQ ID NO: 365). In some embodiments, the CM comprises the amino acid sequence RGPATPIM (SEQ ID NO: 366). In some embodiments, the CM comprises the amino acid sequence RGPA (SEQ ID NO: 367). In some embodiments, the CM comprises the amino acid sequence LSGRSGNH (SEQ ID NO: 789). In some embodiments, the CM comprises the amino acid sequence SGRSANPRG (SEQ ID NO: 790). In some embodiments, the CM comprises the amino acid sequence LSGRSDDH (SEQ ID NO: 791). In some embodiments, the CM comprises the amino acid sequence LSGRSDIH (SEQ ID NO: 792). In some embodiments, the CM comprises the amino acid sequence LSGRSDQH (SEQ ID NO: 793). In some embodiments, the CM comprises the amino acid sequence LSGRSDTH (SEQ ID NO: 794). In some embodiments, the CM comprises the amino acid sequence LSGRSDYH (SEQ ID NO: 795).In some embodiments, the CM comprises the amino acid sequence LSGRSDNP (SEQ ID NO: 796). In some embodiments, the CM comprises the amino acid sequence LSGRSANP (SEQ ID NO: 797). In some embodiments, the CM comprises the amino acid sequence LSGRSANI (SEQ ID NO: 798). In some embodiments, the CM comprises the amino acid sequence LSGRSDNI (SEQ ID NO: 799). In some embodiments, the CM comprises the amino acid sequence MIAPVAYR (SEQ ID NO: 800). In some embodiments, the CM comprises the amino acid sequence RPSPMWAY (SEQ ID NO: 801). In some embodiments, the CM comprises the amino acid sequence WATPRPMR (SEQ ID NO: 802). In some embodiments, the CM comprises the amino acid sequence FRLLDWQW (SEQ ID NO: 803). In some embodiments, the CM comprises the amino acid sequence ISSGL (SEQ ID NO: 804). In some embodiments, the CM comprises the amino acid sequence ISSGLLS (SEQ ID NO: 805). In some embodiments, the CM comprises the amino acid sequence and / or ISSGLL (SEQ ID NO: 806).

[0099] In some embodiments, the CM is a substrate for an MMP and comprises the sequence ISSGLSS (SEQ ID NO: 376), QNQALRMA (SEQ ID NO: 377), AQNLLGMV (SEQ ID NO: 378), STFPFGMF (SEQ ID NO: 379), PVGYTSSL (SEQ ID NO: 380), DWLYWPGI (SEQ ID NO: 381), ISSGLLSS (SEQ ID NO: 382), LKAAPRWA (SEQ ID NO: 383), GPSHLLVLT (SEQ ID NO: 384), LPGGLSPW (SEQ ID NO: 385), MGLFSEAG (SEQ ID NO: 386), SPLPLRVP (SEQ ID NO: 387), RMHLRSLG (SEQ ID NO: 388), LAAPLGLL (SEQ ID NO: 389), AVGLLAPP (SEQ ID NO: 390), LLAPSHRA (SEQ ID NO: 391), and / or PAGLWLDP (SEQ ID NO: 392).

[0100] In some embodiments, the CM comprises the amino acid sequence ISSGLSS (SEQ ID NO: 376). In some embodiments, the CM comprises the amino acid sequence QNQALRMA (SEQ ID NO: 377). In some embodiments, the CM comprises the amino acid sequence AQNLLGMV (SEQ ID NO: 378). In some embodiments, the CM comprises the amino acid sequence STFPFGMF (SEQ ID NO: 379). In some embodiments, the CM comprises the amino acid sequence PVGYTSSL (SEQ ID NO: 380). In some embodiments, the CM comprises the amino acid sequence DWLYWPGI (SEQ ID NO: 381). In some embodiments, the CM comprises the amino acid sequence ISSGLLSS (SEQ ID NO: 382). In some embodiments, the CM comprises the amino acid sequence LKAAPRWA (SEQ ID NO: 383). In some embodiments, the CM comprises the amino acid sequence GPSHLVLT (SEQ ID NO: 384). In some embodiments, the CM comprises the amino acid sequence LPGGLSPW (SEQ ID NO: 385). In some embodiments, the CM comprises the amino acid sequence MGLFSEAG (SEQ ID NO: 386). In some embodiments, the CM comprises the amino acid sequence SPLPLRVP (SEQ ID NO: 387). In some embodiments, the CM comprises the amino acid sequence RMHLRSLG (SEQ ID NO: 388). In some embodiments, the CM comprises the amino acid sequence LAAPLGLL (SEQ ID NO: 389). In some embodiments, the CM comprises the amino acid sequence AVGLLAPP (SEQ ID NO: 390). In some embodiments, the CM comprises the amino acid sequence LLAPSHRA (SEQ ID NO: 391). In some embodiments, the CM comprises the amino acid sequence PAGLWLDP (SEQ ID NO: 392).

[0101] In some embodiments, the CM is a substrate for thrombin. In some embodiments, the CM is a substrate for thrombin and comprises the sequence GPRSFGL (SEQ ID NO: 393) or GPRSFG (SEQ ID NO: 394). In some embodiments, the CM comprises the amino acid sequence GPRSFGL (SEQ ID NO: 393). In some embodiments, the CM comprises the amino acid sequence GPRSFG (SEQ ID NO: 394).

[0102] In some embodiments, the CM comprises an amino acid sequence selected from the group consisting of NTLSGRSENHSG (SEQ ID NO: 395); NTLSGRSGNHGS (SEQ ID NO: 396); TSTSGRSAMPRG (SEQ ID NO: 397); TSGRSAMP (SEQ ID NO: 398); VAGRSMRP (SEQ ID NO: 399); VVPEGRRS (SEQ ID NO: 400); ILPRSPAF (SEQ ID NO: 401); MVLGRSLL (SEQ ID NO: 402); QGRAITFI (SEQ ID NO: 403); SPRSIMLA (SEQ ID NO: 404); and SMLRSMPL (SEQ ID NO: 405).

[0103] In some embodiments, the CM comprises the amino acid sequence NTLSGRSENHSG (SEQ ID NO: 395). In some embodiments, the CM comprises the amino acid sequence NTLSGRSGNHGS (SEQ ID NO: 396). In some embodiments, the CM comprises the amino acid sequence TSTSGRSAMPRG (SEQ ID NO: 397). In some embodiments, the CM comprises the amino acid sequence TSGRSANP (SEQ ID NO: 398). In some embodiments, the CM comprises the amino acid sequence VAGRSMRP (SEQ ID NO: 399). In some embodiments, the CM comprises the amino acid sequence VVPEGRRS (SEQ ID NO: 400). In some embodiments, the CM comprises the amino acid sequence ILPRSPAF (SEQ ID NO: 401). In some embodiments, the CM comprises the amino acid sequence MVLGRSLL (SEQ ID NO: 402). In some embodiments, the CM comprises the amino acid sequence QGRAITFI (SEQ ID NO: 403). In some embodiments, the CM comprises the amino acid sequence SPRSIMLA (SEQ ID NO: 404). In some embodiments, the CM comprises the amino acid sequence SMLRSMPL (SEQ ID NO: 405).

[0104] In some embodiments, the CM is a substrate for neutrophil elastase. In some embodiments, the CM is a substrate for a serine protease. In some embodiments, the CM is a substrate for uPA. In some embodiments, the CM is a substrate for legumain. In some embodiments, the CM is a substrate for matriptase. In some embodiments, the CM is a substrate for a cysteine ​​protease. In some embodiments, the CM is a substrate for a cysteine ​​protease such as a cathepsin.

[0105] In some embodiments, the CM is a CM1-CM2 substrate and has the sequences ISSGLLSGRSDNH (SEQ ID NO: 406); ISSGLLSSGGSGGSLSGRSDNH (SEQ ID NO: 407); AVGLLAPPGGTSTSGRSANPRG (SEQ ID NO: 408); TSTSGRSANPRGGGAVGLLAPP (SEQ ID NO: 409); VHMPLGFLGPGGTSTSGRSANPRG (SEQ ID NO: 410); TSTSGRSANPRGGGVHMPLGFLGP (SEQ ID NO: 411); AVGLLAPPGGLSGRSDNH (SEQ ID NO: 412); LSGRSDNHGGAVGLLAPP (SEQ ID NO: 413); VHMPLGFLGPGGLSGRSDNH (SEQ ID NO: 414); LSGRSDNHGGVHMPLGFLGP (SEQ ID NO: 415); LSGRSDNHGGSGGSISSGLLSS (SEQ ID NO: 416); LSGRSGNHGGSGGSISSGLLSS (SEQ ID NO: 417); ISSGLLSSGGSGGSLSGRSGNH (SEQ ID NO: 418); LSGRSDNHGGSGGSQNQALRMA (SEQ ID NO: 419); QNQALRMAGGSGGSLSGRSDNH (SEQ ID NO: 420 ;LSGRSGNHGGSGGSQNQALRMA (SEQ ID NO: 421);QNQALRMAGGSGGSLSGRSGNH (SEQ ID NO: 422);ISSGLLSGRSGNH (SEQ ID NO: 423);ISSGLLSGRSANPRG (SEQ ID NO: 680);AVGLLAPPTSGRSANPRG (SEQ ID NO: 681);AVGLLAPPSGRSANPRG (SEQ ID NO: 682);ISSGLLSGRSDDH (SEQ ID NO: 683);ISSGLLSGRSDIH (SEQ ID NO: 684);ISSGLLSGRSDQH (SEQ ID NO: 685);ISSGLLSSG RSDTH (SEQ ID NO: 686); ISSGLLSLSGRSDYH (SEQ ID NO: 687); ISSGLLSLSGRSNP (SEQ ID NO: 688); ISSGLLSLSGRSAMP (SEQ ID NO: 689); ISSGLLSLSGRSNI (SEQ ID NO: 690); AVGLLAPPGGLSGRSDDH (SEQ ID NO: 691); AVGLLAPPGGLSGRSDIH (SEQ ID NO: 692); AVGLLAPPGGLSGRSDQH (SEQ ID NO: 693); AVGLLAPPGGLSGRSDTH (SEQ ID NO: 694); AVGLLAPPGGLSGRSDYH (SEQ ID NO: 695);AVGLLAPPGGLSGRSDNP (SEQ ID NO: 696); AVGLLAPPGGLSGRSANP (SEQ ID NO: 697); AVGLLAPPGGLSGRSANI (SEQ ID NO: 698); ISSGLLSGRSDNI (SEQ ID NO: 713); AVGLLAPPGGLSGRSDNI (SEQ ID NO: 714); GLSGRSDNHGGAVGLLAPP (SEQ ID NO: 807); and / or GLSGRSDNHGGVHMPLGFLGP (SEQ ID NO: 808).

[0106] In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDNH (SEQ ID NO:406), which is also referred to herein as substrate 2001. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSSGGSGGSLSGRSDNH (SEQ ID NO:407), which is also referred to herein as substrate 1001 / LP' / 0001. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGTSTSGRSANPRG (SEQ ID NO:408), which is also referred to herein as substrate 2015 and / or substrate 1004 / LP' / 0003. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence TSTSGRSANPRGGGAVGLLAPP (SEQ ID NO:409), which is also referred to herein as substrate 0003 / LP' / 1004. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence VHMPLGFLGPGGTSTSGRSANPRG (SEQ ID NO:410), which is also referred to herein as substrate 1003 / LP' / 0003. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence TSTSGRSANPRGGGVHMPLGFLGP (SEQ ID NO:411), which is also referred to herein as substrate 0003 / LP' / 1003. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDNH (SEQ ID NO:412), which is also referred to herein as substrate 3001 and / or substrate 1004 / LP' / 0001. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence LSGRSDNHGGAVGLLAPP (SEQ ID NO:413), which is also referred to herein as substrate 0001 / LP' / 1004. LP' used in this CM1-CM2 substrate is the amino acid sequence GG.In some embodiments, the CM1-CM2 substrate comprises the sequence VHMPLGFLGPGGLSGRSDNH (SEQ ID NO:414), which is also referred to herein as substrate 1003 / LP' / 0001. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence LSGRSDNHGGVHMPLGFLGP (SEQ ID NO:415), which is also referred to herein as substrate 001 / LP' / 1003. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence LSGRSDNHGSGGSISSGLLSS (SEQ ID NO:416), which is also referred to herein as substrate 0001 / LP' / 1001. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence LSGRSGNHGGSGGSISSGLLSS (SEQ ID NO:417), which is also referred to herein as substrate 0002 / LP' / 1001. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSSGGSGGSLSGRSGNH (SEQ ID NO:418), which is also referred to herein as substrate 1001 / LP' / 0002. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence LSGRSDNHGGSGGSQNQALRMA (SEQ ID NO:419), which is also referred to herein as substrate 0001 / LP' / 1002. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence QNQALRMAGGSGGSLSGRSDNH (SEQ ID NO:420), which is also referred to herein as substrate 1002 / LP' / 0001. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037).In some embodiments, the CM1-CM2 substrate comprises the sequence LSGRSGNHGGSGGSQNQALRMA (SEQ ID NO:421), also referred to herein as substrate 0002 / LP' / 1002. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence QNQALRMAGGSGGSLSGRSGNH (SEQ ID NO:422), also referred to herein as substrate 1002 / LP' / 0002. The LP' used in this CM1-CM2 substrate is the amino acid sequence GGSGGS (SEQ ID NO:1037). In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSGNH (SEQ ID NO:423), also referred to herein as substrate 2002. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSANPRG (SEQ ID NO:680), also referred to herein as substrate 2003. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPTSGRSANPRG (SEQ ID NO:681), also referred to herein as substrate 2004. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPSGRSANPRG (SEQ ID NO:682), also referred to herein as substrate 2005. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDDH (SEQ ID NO:683), also referred to herein as substrate 2006. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLLSGRSDIH (SEQ ID NO:684), also referred to herein as substrate 2007. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDQH (SEQ ID NO:685), also referred to herein as substrate 2008. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDTH (SEQ ID NO:686), also referred to herein as substrate 2009. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDYH (SEQ ID NO: 687), which is also referred to herein as substrate 2010.In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDNP (SEQ ID NO:688), which is also referred to herein as substrate 2011. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSANP (SEQ ID NO:689), which is also referred to herein as substrate 2012. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSANI (SEQ ID NO:690), which is also referred to herein as substrate 2013. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDDH (SEQ ID NO:691), which is also referred to herein as substrate 3006. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDIH (SEQ ID NO:692), which is also referred to herein as substrate 3007. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDQH (SEQ ID NO:693), which is also referred to herein as substrate 3008. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDTH (SEQ ID NO:694), which is also referred to herein as substrate 3009. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDYH (SEQ ID NO:695), which is also referred to herein as substrate 3010. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDNP (SEQ ID NO:696), which is also referred to herein as substrate 3011. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSANP (SEQ ID NO:697), which is also referred to herein as substrate 3012. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSANI (SEQ ID NO:698), which is also referred to herein as substrate 3013. In some embodiments, the CM1-CM2 substrate comprises the sequence ISSGLLSGRSDNI (SEQ ID NO:713), which is also referred to herein as substrate 2014. In some embodiments, the CM1-CM2 substrate comprises the sequence AVGLLAPPGGLSGRSDNI (SEQ ID NO:714), which is also referred to herein as substrate 3014.In some embodiments, the CM1-CM2 substrate comprises the sequence GLSGRSDNHGGAVGLLAPP (SEQ ID NO: 807), which is also referred to herein as substrate 0001 / LP' / 1004. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG. In some embodiments, the CM1-CM2 substrate comprises the sequence GLSGRSDNHGGVHMPLGFLGP (SEQ ID NO: 808), which is also referred to herein as substrate 0001 / LP' / 1003. The LP' used in this CM1-CM2 substrate is the amino acid sequence GG.

[0107] In some embodiments, the CM is a substrate for at least two proteases. In some embodiments, each protease is selected from the group consisting of those shown in Table 4. In some embodiments, the CM is a substrate for at least two proteases, one of which is selected from the group consisting of MMP, thrombin, neutrophil elastase, cysteine ​​proteases, uPA, legumain, and matriptase, and the other protease is selected from the group consisting of those shown in Table 4. In some embodiments, the CM is a substrate for at least two proteases selected from the group consisting of MMP, thrombin, neutrophil elastase, cysteine ​​proteases, uPA, legumain, and matriptase.

[0108] In some embodiments, an activatable antibody comprises at least a first CM and a second CM. In some embodiments, the first CM and the second CM are each polypeptides approximately 15 amino acids in length. In some embodiments, the first CM and the second CM in an uncleaved activatable antibody have the following structural arrangement from N-terminus to C-terminus: MM-CM1-CM2-AB or AB-CM2-CM1-MM. In some embodiments, at least one of the first CM and the second CM is a polypeptide that functions as a substrate for a protease selected from the group consisting of MMP, thrombin, neutrophil elastase, cysteine ​​protease, uPA, legumain, and matriptase in the target tissue. In some embodiments, the first CM is cleaved by a first cleavage agent selected from the group consisting of MMP, thrombin, neutrophil elastase, cysteine ​​protease, uPA, legumain, and matriptase in the target tissue, and the second CM is cleaved by a second cleavage agent in the target tissue. In some embodiments, the other protease is selected from the group consisting of those shown in Table 4. In some embodiments, the first cleaving agent and the second cleaving agent are the same protease selected from the group consisting of MMP, thrombin, neutrophil elastase, cysteine ​​protease, uPA, legumain, and matriptase, and the first CM and the second CM are different substrates of that enzyme. In some embodiments, the first cleaving agent and the second cleaving agent are the same protease selected from the group consisting of those shown in Table 4. In some embodiments, the first cleaving agent and the second cleaving agent are different proteases. In some embodiments, the first cleaving agent and the second cleaving agent are co-localized in the target tissue. In some embodiments, the first CM and the second CM are cleaved by at least one cleaving agent in the target tissue.

[0109] In some embodiments, after a protease cleaves the CM, the activatable antibody is exposed to and cleaved by the protease such that the activated antibody, in its activated or cleaved state, comprises a light chain amino acid sequence that includes at least a portion of the LP2 and / or CM sequence.

[0110] In some embodiments, the activatable antibody is conjugated to one or more agents.

[0111] In some embodiments, the agent is a toxin or a fragment thereof. In some embodiments, the agent is a microtubule inhibitor. In some embodiments, the agent is a nucleic acid damaging agent. In some embodiments, the agent is selected from the group consisting of dolastatin or a derivative thereof, auristatin or a derivative thereof, maytansinoid or a derivative thereof, duocarmycin or a derivative thereof, calicheamicin or a derivative thereof, and pyrrolobenzodiazepine or a derivative thereof. In some embodiments, the agent is auristatin E or a derivative thereof. In some embodiments, the agent is monomethyl auristatin E (MMAE). In some embodiments, the agent is monomethyl auristatin D (MMAD). In some embodiments, the agent is a maytansinoid selected from the group consisting of DM1 and DM4. In some embodiments, the agent is the maytansinoid DM4. In some embodiments, the agent is a duocarmycin. In some embodiments, the agent is attached to AB via a linker. In some embodiments, the linker by which the agent is attached to AB comprises an SPDB moiety, a vc moiety, or a PEG2-vc moiety. In some embodiments, the linker and toxin attached to the AB comprise a SPDB-DM4 moiety, a vc-MMAD moiety, a vc-MMAE moiety, a vc-duocarmycin, or a PEG2-vc-MMAD moiety. In some embodiments, the linker is a cleavable linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the agent is a detectable moiety. In some embodiments, the detectable moiety is a diagnostic agent.

[0112] In some embodiments, the agent conjugated to the AB or to the AB of the activatable antibody is a therapeutic agent. In some embodiments, the agent is an anti-tumor agent. In some embodiments, the agent is a toxin or a fragment thereof. As used herein, a fragment of a toxin is a fragment that retains toxic activity. In some embodiments, the agent is conjugated to the AB via a cleavable linker. In some embodiments, the agent is conjugated to the AB via a linker comprising at least one CM1-CM2 substrate sequence. In some embodiments, the agent is conjugated to the AB via a non-cleavable linker. In some embodiments, the agent is conjugated to the AB via a linker that is cleavable in the intracellular or lysosomal environment. In some embodiments, the agent is a microtubule inhibitor. In some embodiments, the agent is a nucleic acid damaging agent, such as a DNA alkylating agent, a DNA cleaving agent, a DNA cross-linking agent, a DNA intercalator, or other DNA damaging agent. In some embodiments, the agent is an agent selected from the group listed in Table 5. In some embodiments, the agent is a dolastatin. In some embodiments, the agent is an auristatin or a derivative thereof. In some embodiments, the agent is auristatin E or a derivative thereof. In some embodiments, the agent is monomethylauristatin E (MMAE). In some embodiments, the agent is monomethylauristatin D (MMAD). In some embodiments, the agent is a maytansinoid or a maytansinoid derivative. In some embodiments, the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or a derivative thereof. In some embodiments, the agent is a calicheamicin or a derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine. In some embodiments, the agent is a pyrrolobenzodiazepine dimer.

[0113] In some embodiments, the activatable antibody is conjugated to one or more equivalents of an agent. In some embodiments, the activatable antibody is conjugated to 1 equivalent of an agent. In some embodiments, the activatable antibody is conjugated to 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 equivalents of an agent. In some embodiments, the activatable antibody is part of a mixture of activatable antibodies having a homogenous equivalent number of conjugated agents. In some embodiments, the activatable antibody is part of a mixture of activatable antibodies having a heterogeneous equivalent number of conjugated agents. In some embodiments, the mixture of activatable antibodies is such that the average number of agents conjugated to each activatable antibody is 0-1, 1-2, 2-3, 3-4, 4-5, 5-6, 6-7, 7-8, 8-9, 9-10, and 10 or more. In some embodiments, the mixture of activatable antibodies is such that the average number of agents conjugated to each activatable antibody is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more.

[0114] In some embodiments, the activatable antibody comprises one or more site-specific amino acid sequence modifications such that the number of lysine and / or cysteine ​​residues is increased or decreased relative to the original amino acid sequence of the activatable antibody, thus, in some embodiments, correspondingly increasing or decreasing the number of agents that can be bound to the activatable antibody, or, in some embodiments, restricting the binding of agents to the activatable antibody in a site-specific manner. In some embodiments, the modified activatable antibody is modified with one or more non-natural amino acids in a site-specific manner, thus, in some embodiments, restricting the binding of agents to only the non-natural amino acid sites.

[0115] In some embodiments, the agent is an anti-inflammatory agent.

[0116] In some embodiments, the activatable antibody also comprises a detectable moiety. In some embodiments, the detectable moiety is a diagnostic agent.

[0117] In some embodiments, the activatable antibody is an activatable antibody to which a therapeutic agent is conjugated. In some embodiments, the activatable antibody is not conjugated to an agent. In some embodiments, the activatable antibody comprises a detectable label. In some embodiments, the detectable label is located at the AB. In some embodiments, measuring the level of the activatable antibody in a subject or sample is accomplished using a secondary reagent that specifically binds to the activating antibody, which reagent comprises a detectable label. In some embodiments, the secondary reagent is an antibody that comprises a detectable label.

[0118] In some embodiments, the detectable label includes an imaging agent, a contrast agent, an enzyme, a fluorescent label, a chromophore, a dye, one or more metal ions, or a ligand-based label. In some embodiments, the imaging agent comprises a radioisotope. In some embodiments, the radioisotope is indium or technetium. In some embodiments, the imaging agent comprises iodine, gadolinium, or iron oxide. In some embodiments, the enzyme comprises horseradish peroxidase, alkaline phosphatase, or β-galactosidase. In some embodiments, the fluorescent label comprises yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), green fluorescent protein (GFP), modified red fluorescent protein (mRFP), red fluorescent protein tdimer2 (RFP tdimer2), HCRED, or a europium derivative. In some embodiments, the luminescent label is an N-methylacridium derivative. In some embodiments of these methods, the label comprises an AlexaFluor® label, such as AlexaFluor® 680 or AlexaFluor® 750. In some embodiments, the ligand-based label comprises biotin, avidin, streptavidin, or one or more haptens.

[0119] In some embodiments, the activatable antibody also comprises a signal peptide. In some embodiments, the signal peptide is attached to the activatable antibody via a spacer. In some embodiments, the spacer is attached to the activatable antibody in the absence of a signal peptide. In some embodiments, the spacer is linked directly to the MM of the activatable antibody. In some embodiments, the spacer is linked directly to the MM of the activatable antibody in the N- to C-terminal structural arrangement of spacer-MM-CM-AB. An example of a spacer linked directly to the N-terminus of the MM of an activatable antibody is QGQSGQ (SEQ ID NO: 424). Other examples of spacers linked directly to the N-terminus of the MM of an activatable antibody include QGQSGQG (SEQ ID NO: 645), QGQSG (SEQ ID NO: 646), QGQS (SEQ ID NO: 647), QGQ (SEQ ID NO: 648), QG (SEQ ID NO: 649), and Q. Other examples of spacers directly linked to the N-terminus of the MM of an activatable antibody include GQSGQG (SEQ ID NO: 666), QSGQG (SEQ ID NO: 667), SGQG (SEQ ID NO: 668), GQG (SEQ ID NO: 669), and G. In some embodiments, no spacer is linked to the N-terminus of the MM. In some embodiments, the spacer comprises at least the amino acid sequence QGQSGQ (SEQ ID NO: 424). In some embodiments, the spacer includes at least the amino acid sequence QGQSGQG (SEQ ID NO: 645). In some embodiments, the spacer comprises at least the amino acid sequence QGQSG (SEQ ID NO: 646). In some embodiments, the spacer comprises at least the amino acid sequence QGQS (SEQ ID NO: 647). In some embodiments, the spacer comprises at least the amino acid sequence QGQ (SEQ ID NO: 648). In some embodiments, the spacer comprises at least the amino acid sequence QG (SEQ ID NO: 649). In some embodiments, the spacer comprises at least amino acid residue Q. In some embodiments, the spacer comprises at least the amino acid sequence GQSGQG (SEQ ID NO: 666). In some embodiments, the spacer comprises at least the amino acid sequence QSGQG (SEQ ID NO: 667).In some embodiments, the spacer comprises at least the amino acid sequence SGQG (SEQ ID NO: 668). In some embodiments, the spacer comprises at least the amino acid sequence GQG (SEQ ID NO: 669). In some embodiments, the spacer comprises at least the amino acid sequence G. In some embodiments, the spacer is absent.

[0120] In some embodiments, the activatable antibody and / or conjugated activatable antibody is monospecific. In some embodiments, the activatable antibody and / or conjugated activatable antibody is multispecific, such as, for non-limiting example, bispecific or trifunctional. In some embodiments, the activatable antibody and / or conjugated activatable antibody is formulated as part of a pro-bispecific T cell engager (BITE) molecule. In some embodiments, the activatable antibody and / or conjugated activatable antibody is formulated as part of a pro-chimeric antigen receptor (CAR) modified T cell or other engineered receptor.

[0121] In some embodiments, the activatable antibody or antigen-binding fragment thereof is incorporated into a multispecific activatable antibody or antigen-binding fragment thereof, where at least one arm of the multispecific activatable antibody specifically binds a target. In some embodiments, the activatable antibody or antigen-binding fragment thereof is incorporated into a bispecific antibody or antigen-binding fragment thereof, where at least one arm of the bispecific activatable antibody specifically binds a target.

[0122] In some embodiments, the activatable antibody is a multispecific activatable antibody and / or a conjugated multispecific activatable antibody. The multispecific activatable antibody and / or conjugated multispecific activatable antibody comprises at least (i) a first antibody or antigen-binding fragment thereof (AB1) that specifically binds a first target linked to a first masking moiety (MM1), such that linkage of MM1 reduces the ability of AB1 to bind the first target, and (ii) a second antibody or antigen-binding fragment thereof (AB2) that specifically binds a second target linked to a second masking moiety (MM2), such that linkage of MM2 reduces the ability of AB2 to bind the second target. In some embodiments, MM1 and / or MM2 are linked to the respective antibody or antigen-binding fragment thereof (AB1 or AB2) via a sequence that includes a substrate for a protease, e.g., a protease that co-localizes with the first target, the second target, or both the first and second targets at a treatment site in a subject. In some embodiments, the first target, the second target, or both the first and second targets are mammalian targets, such as, for example, human targets. Suitable MM1, MM2, CM1, and / or CM2 include any of the MMs and / or CMs described above in connection with the activatable antibodies and / or conjugated activatable antibodies used in the compositions and methods of the present disclosure.

[0123] As a non-limiting example, AB of the activatable antibody is a binding partner of any target listed in Table 1. As a non-limiting example, AB1, AB2, or both AB1 and AB2 of the multispecific activatable antibody are binding partners of any target listed in Table 1. [Table 1] TIFF0007779882000002.tif140162

[0124] As a non-limiting example, the antibody or antigen-binding fragment, and / or AB of the activatable antibody is or is derived from an antibody listed in Table 2. As a non-limiting example, the AB of the activatable antibody, AB1 of the multispecific activatable antibody, and / or AB2 of the multispecific activatable antibody is or is derived from an antibody listed in Table 2. [Table 2] TIFF0007779882000004.tif99162

[0125] The present disclosure also provides an isolated antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, wherein the antibody or antigen-binding fragment thereof comprises a variable heavy chain complementarity determining region 1 (CDRH1) comprising the amino acid sequence SYGMS (SEQ ID NO: 438); a variable heavy chain complementarity determining region 2 (CDRH2) comprising the amino acid sequence TISPSGIYTYYPVTVKG (SEQ ID NO: 439); a variable heavy chain complementarity determining region 3 (CDRH3) comprising the amino acid sequence HHPNYGSTYLYYIDY (SEQ ID NO: 440); a variable light chain complementarity determining region 1 (CDRL1) comprising the amino acid sequence KSSQSVFSSSNQKNYLA (SEQ ID NO: 441); a variable light chain complementarity determining region 2 (CDRL2) comprising the amino acid sequence WAFTRES (SEQ ID NO: 442); and a variable light chain complementarity determining region 3 (CDRL3) comprising the amino acid sequence YQYLSSLT (SEQ ID NO: 443).

[0126] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429.

[0127] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0128] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429 and a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0129] In some embodiments, the antibody or antigen-binding fragment thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429.

[0130] In some embodiments, the antibody or antigen-binding fragment thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0131] In some embodiments, the antibody or antigen-binding fragment thereof comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 429, and an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to a variable light chain comprising the amino acid sequence of SEQ ID NO: 431.

[0132] The present disclosure also provides kits for practicing any of the methods provided herein.

[0133] The present disclosure provides methods and kits for qualitatively and / or quantitatively analyzing activation and other characteristics of activatable antibody therapeutic activation in biological samples, including tissue and / or biological fluid samples. In one embodiment, the present invention provides a kit comprising: (i) activatable antibody standard curve reagent; (ii) activated activatable antibody standard curve reagent; (iii) an anti-id primary antibody or antigen-binding fragment thereof having binding specificity for an activatable antibody. In some embodiments, the anti-idiotypic (id) antibody or antigen-binding fragment thereof has binding specificity for a VL CDR selected from the group consisting of VL CDR1, VL CDR2, and VL CDR3. In other embodiments, the anti-idiotypic antibody or antigen-binding fragment thereof has binding specificity for a VH CDR selected from the group consisting of VH CDR1, VH CDR2, and VH CDR3. In some embodiments, the kit includes a combination of two or more anti-idiotypic antibody species (or antigen-binding fragments thereof). The standard curve reagents are relatively pure activatable antibodies and activated activatable antibodies in solution, ready for dilution, or in solid form.

[0134] An activatable antibody typically comprises at least (i) an antibody or antigen-binding fragment thereof (AB) that specifically binds a target; (ii) a masking moiety (MM) linked to the AB such that the activatable antibody inhibits binding of the AB to the target when the activatable antibody is in an uncleaved state; and (iii) a cleavable moiety (CM) linked to the AB, wherein the CM is a polypeptide that functions as a substrate for a protease. Activatable antibodies are generally activated in the presence of the protease for which the CM substrate serves as a substrate, and the protease cleaves the CM substrate. It would be useful to be able to qualitatively and / or quantitatively measure characteristics of an activatable antibody in a biological sample, such as the activation level of the activatable antibody in the biological sample, the total amount of activated, i.e., cleaved, activatable antibody, and / or intact, i.e., inactivated, activatable antibody in the biological sample, or any combination or correlation thereof. Such methods are useful for monitoring the effectiveness of activatable antibodies and activatable antibody-based therapies at any stage of development and / or therapeutic treatment. For example, in some embodiments, the methods and kits provided herein are useful for testing the effectiveness of activatable antibodies and activatable antibody-based therapeutics prior to administration to a subject in need thereof and / or during a treatment regimen, and for monitoring the effectiveness of the activatable antibodies and activatable antibody-based therapeutics throughout and / or after the administration period. In some embodiments, the methods and kits provided herein are useful for providing retrospective analysis of activatable antibodies and activatable antibody-based therapeutics.

[0135] In some embodiments, the present disclosure provides methods for qualitatively and / or quantitatively analyzing activatable antibody therapeutic activation in biological samples, including tissue and / or plasma samples, using a capillary-based immunoassay platform. In some embodiments, the methods provided herein are used to quantify the activation of one or more activatable antibodies in a biological sample. In some embodiments, the methods provided herein are used to profile, stratify, or classify in vivo protease activity in a biological sample.

[0136] In some embodiments, the present disclosure provides methods for qualitatively and / or quantitatively analyzing the activation of an activatable antibody therapeutic having an antibody or antigen-binding fragment thereof (AB) that specifically binds a target, a masking moiety (MM) linked to the light chain of the AB such that the activatable antibody inhibits binding of the AB to the target when the activatable antibody is in an uncleaved state, and a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease. In some embodiments, the methods are used to quantify or otherwise compare at least (i) levels of activated activatable antibody in which the CM has been cleaved and the MM is not linked to the light chain of the AB, and (ii) levels of intact activatable antibody in which the MM and CM are linked to the light chain of the AB.

[0137] In some embodiments, the present disclosure provides methods for qualitatively and / or quantitatively analyzing the activation of an activatable antibody therapeutic having an antibody or antigen-binding fragment thereof (AB) that specifically binds a target, a masking moiety (MM) linked to the heavy chain of the AB such that the activatable antibody inhibits binding of the AB to the target when the activatable antibody is in an uncleaved state, and a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease. In some embodiments, the methods are used to quantify or otherwise compare the levels of at least (i) activated activatable antibody in which the CM has been cleaved and the MM is not linked to the heavy chain of the AB, and (ii) the levels of intact activatable antibody in which the MM and CM are linked to the heavy chain of the AB.

[0138] In some embodiments, the disclosure provides methods for qualitatively and / or quantitatively analyzing the activation of an activatable antibody therapeutic having an antibody or antigen-binding fragment (AB) that specifically binds a target; a first masking moiety (MM1) linked to the light chain of AB such that MM1 inhibits binding of AB to the target when the activatable antibody is in an uncleaved state; a first cleavable moiety (CM1) linked to the light chain AB, wherein CM1 is a polypeptide that functions as a substrate for a protease; a second masking moiety (MM2) linked to the heavy chain of AB such that MM2 inhibits binding of AB to the target when the activatable antibody is in an uncleaved state; and a second cleavable moiety (CM2) linked to the light chain AB, wherein CM2 is a polypeptide that functions as a substrate for a protease. In some embodiments, these methods are used to quantify or otherwise compare at least (i) levels of activated activatable antibodies in which at least one of CM1 and / or CM2 has been cleaved such that at least one of MM1 and / or MM2 is not linked to AB, and (ii) levels of intact activatable antibodies in which at least one of MM1 and CM1 and / or MM2 and CM2 is linked to AB.

[0139] In some embodiments, the present disclosure provides a method for quantifying the activation level of an activatable antibody-based therapeutic, the method comprising: i) loading at least one capillary or population of capillaries with a stacking matrix and a separation matrix; ii) contacting the loaded capillary or population of loaded capillaries with a biological sample; iii) separating intact activatable antibody or intact activatable antibody-based therapeutic from activated activatable antibody or activated activatable antibody-based therapeutic in the biological sample in each capillary; iv) immobilizing intact activatable antibody or intact activatable antibody-based therapeutic and activated activatable antibody or intact activatable antibody-based therapeutic in each capillary; v) immunoprobing each capillary with at least one detectable reagent specific for at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof; and vi) quantifying the level of detectable reagent in each capillary or population of capillaries.

[0140] In some embodiments, the present disclosure provides a method for quantifying the activation level of an activatable antibody-based therapeutic, the method comprising: i) loading at least one capillary or population of capillaries with a stacking matrix and a separation matrix; ii) contacting the loaded capillary or population of loaded capillaries with a biological sample; iii) separating high molecular weight (MW) components of the biological sample from low molecular weight (MW) components of the biological sample in each capillary; iv) immobilizing the high MW and low MW components in each capillary; v) immunoprobing each capillary with at least one detectable reagent specific to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof; and vi) quantifying the level of detectable reagent in each capillary or population of capillaries.

[0141] In some embodiments, the at least one detectable reagent in step v) comprises at least a first reagent specific for at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, and a second reagent that specifically binds to or recognizes the first reagent, wherein the second reagent comprises a detectable label.

[0142] In some embodiments, step vi) comprises quantifying the level of detectable label in each capillary or population of capillaries.

[0143] In some embodiments, step ii) comprises loading about 1-500 ng of biological sample, or any value and / or range between about 1-500 ng of biological sample. In some embodiments, step ii) comprises loading about 5-40 ng of biological sample. One skilled in the art will appreciate that the loading amount of biological sample may vary depending on the affinity of the detectable reagent or first reagent used in the method, and that the higher the affinity of the detectable reagent or first reagent, the lower the loading amount of biological sample may be.

[0144] In some embodiments, the biological sample is prepared using one or more buffers in a quantity sufficient to result in a separation of molecular weights. In some embodiments, the biological sample is prepared using one or more SDS-containing buffers in a quantity sufficient to result in a separation of molecular weights. In some embodiments, the biological sample is prepared using one or more buffers in a quantity sufficient to result in a separation of native proteins, including activatable antibodies and / or activatable antibody-based therapeutics, in the biological sample. In some embodiments, the biological sample is prepared using one or more buffers in a quantity sufficient to result in a separation of the sample using any reagent suitable for separation.

[0145] In some embodiments, step iii) comprises using UV light to immobilize high-MW and low-MW components of the biological sample. In some embodiments, any suitable immobilization agent is used in step iii) of the methods provided herein.

[0146] In some embodiments, the first reagent in step iv) is an antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof.

[0147] In some embodiments, the second reagent in step iv) is a detectably labeled secondary antibody that specifically binds to the first reagent.

[0148] In some embodiments, the first reagent in step iv) is a primary antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, and the second reagent in step v) is a detectably labeled secondary antibody that specifically binds to the primary antibody or antigen-binding fragment thereof.

[0149] In some embodiments, the detectable label is attached to a second reagent.

[0150] In some embodiments, the detectable label is a fluorescent label and step vi) comprises detecting the level of chemiluminescence in each capillary or population of capillaries.

[0151] In some embodiments, the detectable label is horseradish peroxidase (HRP).

[0152] In some embodiments, the biological sample is a bodily fluid. In some embodiments, the bodily fluid is blood, plasma, or serum. In some embodiments, the biological sample is diseased tissue. In some embodiments, the diseased tissue is a lysate. In some embodiments, the diseased tissue is tumor tissue.

[0153] In some embodiments, the methods provided herein are used to compare the amount of activated activatable antibody or activatable antibody-based therapeutic and the amount of intact activatable antibody or activatable antibody-based therapeutic in a biological sample, hi some embodiments, the activatable antibody-based therapeutic is a conjugated activatable antibody, a multispecific activatable antibody, a conjugated multispecific activatable antibody, or any combination thereof.

[0154] The present disclosure also provides antibodies or antigen-binding fragments thereof that specifically bind to activatable antibodies and / or activatable antibody-based therapeutics, such as conjugated activatable antibodies, multispecific activatable antibodies, conjugated multispecific activatable antibodies, or any combination thereof.

[0155] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable heavy chain complementarity determining region 1 (CDRH1) comprising the amino acid sequence SYGMS (SEQ ID NO: 438); a variable heavy chain complementarity determining region 2 (CDRH2) comprising the amino acid sequence TISPSGIYTYYPVTVKG (SEQ ID NO: 439); a variable heavy chain complementarity determining region 3 (CDRH3) comprising the amino acid sequence HHPNYGSTYLYYIDY (SEQ ID NO: 440); a variable light chain complementarity determining region 1 (CDRL1) comprising the amino acid sequence KSSQSVFSSSNQKNYLA (SEQ ID NO: 441); a variable light chain complementarity determining region 2 (CDRL2) comprising the amino acid sequence WAFTRES (SEQ ID NO: 442); and a variable light chain complementarity determining region 3 (CDRL3) comprising the amino acid sequence YQYLSSLT (SEQ ID NO: 443).

[0156] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429.

[0157] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0158] In some embodiments, the antibody or antigen-binding fragment thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO:429 and a variable light chain comprising the amino acid sequence of SEQ ID NO:431.

[0159] In some embodiments, the antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:444.

[0160] In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO:445.

[0161] In some embodiments, the antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:444 and a light chain comprising the amino acid sequence of SEQ ID NO:445.

[0162] The methods provided herein are useful for quantifying activatable antibodies, conjugated activatable antibodies, multispecific activatable antibodies, and / or conjugated multispecific activatable antibodies.

[0163] Activatable antibodies and / or conjugated activatable antibodies include antibodies or antigen-binding fragments (AB) that specifically bind a target linked to a masking moiety (MM), such that the linking of the MM reduces the ability of the antibody or antigen-binding fragment to bind to the target. In some embodiments, the MM is linked via a sequence that includes a substrate for a protease, e.g., a protease that co-localizes with the target at the treatment site in a subject. In some embodiments, the target is a mammalian target, e.g., a human target.

[0164] The multispecific activatable antibody and / or conjugated multispecific activatable antibody comprises at least (i) an AB1 that specifically binds a first target linked to a first masking moiety (MM1), such that linking the MM1 reduces the ability of the first antibody or antigen-binding fragment thereof (AB1) to bind the first target, and (ii) an AB2 that specifically binds a second target linked to MM2, such that linking the second masking moiety (MM2) reduces the ability of the second antibody or antigen-binding fragment thereof (AB2) to bind the second target. In some embodiments, MM1 and / or MM2 are linked to the respective antibody or antigen-binding fragment thereof (AB1 or AB2) via a sequence that includes a substrate for a protease, e.g., a protease that is co-localized with the first target, the second target, a treatment site of a subject, or both the first target and the second target. In some embodiments, the first target, the second target, or both the first and second targets are mammalian targets, such as, for example, human targets.

[0165] The activatable antibodies provided herein include a masking moiety. In some embodiments, the masking moiety is an amino acid sequence that is bound or attached to the antibody and is positioned within the activatable antibody construct, thereby reducing the antibody's ability to specifically bind to a target. Suitable masking moieties are identified using any of a variety of known techniques. For example, peptide masking moieties are identified using the method described in PCT Publication No. WO 2009 / 025846 by Daugherty et al., the contents of which are incorporated herein by reference in their entirety.

[0166] The activatable antibodies provided herein comprise a cleavable moiety. In some embodiments, the cleavable moiety comprises an amino acid sequence that is a substrate for a protease, typically an extracellular protease. Suitable substrates are identified using any of a variety of known techniques. For example, peptide substrates are identified using the methods described in U.S. Patent No. 7,666,817 to Daugherty et al., U.S. Patent No. 8,563,269 to Stagliano et al., and PCT Publication No. WO 2014 / 026136 to La Porte et al., the contents of each of which are incorporated herein by reference in their entirety (see also Boulware et al., "Evolutionary optimization of peptide substrates for proteases that exhibit rapid hydrolysis kinetics," Biotechnol Bioeng. 106.3 (2010):339-46).

[0167] Exemplary substrates include, but are not limited to, substrates cleavable by one or more of the following enzymes or proteases listed in Table 4. [Table 3] TIFF0007779882000006.tif51162

[0168] The methods provided herein are useful for quantifying the activation of activatable antibodies containing a cleavable moiety that functions as a substrate for a protease. The activatable antibodies described herein are designed to overcome the limitations of antibody therapy, particularly antibody therapy, which is known to be at least somewhat toxic in vivo. Target-mediated toxicity is a major limitation to the development of therapeutic antibodies. The activatable antibodies provided herein are designed to address the toxicity associated with target inhibition in normal tissues by conventional therapeutic antibodies. These activatable antibodies remain masked until proteolytically activated at the disease site. Starting with an antibody as the parent therapeutic antibody, the activatable antibodies of the present invention were modified by linking the antibody to an inhibitory mask via a linker that incorporates a protease substrate.

[0169] When the AB is modified with a MM and in the presence of a target, the specific binding of the AB to the target is reduced or inhibited compared to the specific binding of an AB that is not modified with a MM or the specific binding of the parent AB to the target.

[0170] K of MM-modified AB against target d is the K of the unmodified AB or parent AB against the target dat least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or more times or 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 00-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times larger. Conversely, the binding affinity of the MM-modified AB to the target is at least 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000, or 50,000,000 times greater, or 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1, 000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower.

[0171] The dissociation constant of MM with AB (K d ) is generally the K of AB against the target d K of MM against AB is larger thand is the K of AB against the target d The binding affinity of the MM to the AB may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000, or even 10,000,000 times greater than the binding affinity of the MM to the AB. Conversely, the binding affinity of the MM to the AB is generally lower than the binding affinity of the AB to the target. The binding affinity of the MM to the AB may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000, or even 10,000,000 times lower than the binding affinity of the AB to the target.

[0172] In some embodiments, the dissociation constant (K d ) is the K of AB against the target d In some embodiments, the dissociation constant of MM for AB (K d ) is about the dissociation constant of AB to the target. In some embodiments, the dissociation constant (K d ) is equal to the dissociation constant of AB for the target.

[0173] In some embodiments, the dissociation constant (K d ) is smaller than the dissociation constant of AB for the target.

[0174] In some embodiments, the dissociation constant (K d ) is greater than the dissociation constant of AB for the target.

[0175] In some embodiments, M M is the K d The K of binding to AB is d It has.

[0176] In some embodiments, M M is the K d is greater than or equal to K of binding to AB d It has.

[0177] In some embodiments, M M is the K d K of binding to AB is approximately equal to d It has.

[0178] In some embodiments, M M is the K d K of binding to AB is smaller than d It has.

[0179] In some embodiments, M M is the K d The larger the K of binding to AB d It has.

[0180] In some embodiments, M M is the K d K of binding to AB that is 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, or 1,000 times greater than d In some embodiments, the MM has a K d K of binding to AB that is 1-5, 2-5, 2-10, 5-10, 5-20, 5-50, 5-100, 10-100, 10-1,000, 20-100, 20-1,000, or 100-1,000 times greater than d It has.

[0181] In some embodiments, the MM has a lower affinity for binding to the AB than the affinity of binding of the AB to the target.

[0182] In some embodiments, the MM has an affinity for binding to the AB that is comparable to the affinity of binding of the AB to the target.

[0183] In some embodiments, the MM has an affinity for binding to the AB that is approximately equal to the affinity of binding of the AB to the target.

[0184] In some embodiments, the MM has an affinity for binding to the AB that is about the same as the affinity of binding of the AB to the target.

[0185] In some embodiments, the MM has an affinity for binding to the AB that is greater than the affinity of binding of the AB to the target.

[0186] In some embodiments, the MM has an affinity for binding to AB that is 2, 3, 4, 5, 10, 25, 50, 100, 250, 500, or 1,000 times less than the affinity of binding of AB to the target. In some embodiments, the MM has an affinity for binding to AB that is 1-5, 2-5, 2-10, 5-10, 5-20, 5-50, 5-100, 10-100, 10-1,000, 20-100, 20-1,000, or 100-1,000 times less than the affinity of binding of AB to the target. In some embodiments, the MM has an affinity for binding to AB that is 2-20 times less than the affinity of binding of AB to the target. In some embodiments, MM that is not covalently linked to AB and at equimolar concentration with AB does not inhibit binding of AB to the target.

[0187] When the AB is modified with a MM and in the presence of a target, the specific binding of the AB to the target is reduced or inhibited compared to the specific binding of an AB not modified with a MM or the specific binding of the parent AB to the target. When compared to the binding of an AB that is not modified with a MM or the binding of the parent AB to a target, the ability of the AB to bind a target when modified with a MM may be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or even 100% for at least 2 hours, 4 hours, 6 hours, 8 hours, 12 hours, 28 hours, 24 hours, 30 hours, 36 hours, 48 ​​hours, 60 hours, 72 hours, 84 hours, or 96 hours, or 5 days, 10 days, 15 days, 30 days, 45 days, 60 days, 90 days, 120 days, 150 days, or 180 days, or 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, or 12 months or more, as measured in an in vivo or in vitro assay.

[0188] The MM inhibits binding of the AB to the target. The MM binds the antigen-binding domain of the AB and inhibits binding of the AB to the target. The MM can sterically inhibit binding of the AB to the target. The MM can allosterically inhibit binding of the AB to the target. In these embodiments, when the AB is modified or linked to the MM and in the presence of the target, there is no or substantially no binding of the AB to the target, or at least 2 hours, 4 hours, 6 hours, 8 hours, 12 hours, 28 hours, 24 hours, 30 hours, 36 hours, 48 ​​hours, 60 hours, 72 hours, 84 hours, or 96 hours, or 5 days, 10 days, 15 days, 30 days, 45 days, 60 days, 90 days, 120 days, 150 days, or 180 days, or 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, or 7 months, as measured in an in vivo or in vitro assay. , 8 months, 9 months, 10 months, 11 months, or 12 months or more, there is about 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the AB to the target compared to binding of the AB unmodified by the MM, the parent AB, or the AB not linked to the MM to the target.

[0189] When an AB is linked to or modified by an MM, the MM "masks," reduces, or inhibits the specific binding of the AB to a target. When an AB is linked to or modified by an MM, such linkage or modification may cause a conformational change that reduces or inhibits the ability of the AB to specifically bind to its target.

[0190] The AB linked to or modified by the MM can be represented by the following formula (in the order from the amino (N) terminal region to the carboxyl (C) terminal region): (MM)-(AB) (AB)-(MM) (MM)-L-(AB) (AB)-L-(MM) wherein MM is a masking moiety, AB is an antibody or antibody fragment thereof, and L is a linker. In many embodiments, it may be desirable to insert one or more linkers, e.g., flexible linkers, into the composition to provide flexibility.

[0191] In certain embodiments, the MM is not a natural binding partner of AB. In some embodiments, the MM contains no or substantially no homology to any natural binding partner of AB. In some embodiments, the MM is about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to any natural binding partner of AB. In some embodiments, the MM is about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% identical to any natural binding partner of AB. In some embodiments, the MM is about 25% identical to any natural binding partner of AB. In some embodiments, the MM is about 50% identical to any natural binding partner of AB. In some embodiments, the MM is about 20% identical to any natural binding partner of AB. In some embodiments, the MM is about 10% identical to any natural binding partner of AB.

[0192] In some embodiments, an activatable antibody comprises an AB modified by a MM and also comprises one or more cleavable moieties (CM). Such an activatable antibody exhibits activatable / switchable binding to the target of the AB. An activatable antibody generally comprises an antibody or antibody fragment (AB) modified by or linked to a masking moiety (MM) and a modifiable or cleavable moiety (CM). In some embodiments, the CM comprises an amino acid sequence that functions as a substrate for at least one protease.

[0193] The activatable antibody elements are arranged such that the MM and CM are positioned such that, in a cleaved (or relatively active) state and in the presence of a target, the AB binds the target, while the activatable antibody is in an uncleaved (or relatively inactive) state in the presence of a target, reducing or inhibiting specific binding of the AB to its target. Specific binding of the AB to a target can be reduced by the MM inhibiting or masking the ability of the AB to specifically bind its target.

[0194] K of AB modified by MM and CM against the target d is the K of the AB or parent AB unmodified by MM and CM against the target dof at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or more, or 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 00-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times larger. Conversely, the binding affinity of an AB modified with MM and CM for a target may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or more, or 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10- 1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times less.

[0195] When the AB is modified with MM and CM and in the presence of a target but not in the presence of a modifying agent (e.g., at least one protease), the specific binding of the AB to the target is reduced or inhibited compared to the specific binding of the AB not modified with MM and CM, or of the parent AB, to the target. The ability of the AB to bind a target when modified with MM and CM, when compared to the binding of the parent AB or the binding of the AB not modified with MM and CM, to the target, can be measured in vivo or in vivo. It may be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and even 100% for at least 2 hours, 4 hours, 6 hours, 8 hours, 12 hours, 28 hours, 24 hours, 30 hours, 36 hours, 48 ​​hours, 60 hours, 72 hours, 84 hours, or 96 hours, or for 5 days, 10 days, 15 days, 30 days, 45 days, 60 days, 90 days, 120 days, 150 days, or 180 days, or for 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, or 12 months or more as measured in an in vitro assay.

[0196] As used herein, the term cleaved state refers to the state of an activatable antibody after modification of the CM by at least one protease. As used herein, the term uncleaved state refers to the state of an activatable antibody without cleavage of the CM by a protease. As noted above, the term "activatable antibody" is used herein to refer to an activatable antibody in both its uncleaved (native) state and its cleaved state. It will be apparent to those skilled in the art that in some embodiments, a cleaved activatable antibody lacks the MM due to cleavage of the CM by a protease, resulting in the release of at least the MM (e.g., when the MM is not covalently attached to the activatable antibody (e.g., a disulfide bond between cysteine ​​residues)).

[0197] Activatable or switchable means that when the activatable antibody is in an inhibited, masked, or uncleaved state (i.e., a first conformation), the activatable antibody exhibits a first level of binding to the target, and when in the uninhibited, unmasked, and / or cleaved state (i.e., a second conformation), the activatable antibody exhibits a second level of binding to the target, where the second level of target binding is greater than the first level of binding. Generally, the access of the target to the AB of the activatable antibody is greater in the presence of a cleaving agent, i.e., a protease, that can cleave the CM than in the absence of such a cleaving agent. Thus, when the activatable antibody is in the uncleaved state, the AB can be inhibited from target binding or masked from target binding (i.e., the first conformation is such that the AB cannot bind the target), and in the cleaved state the AB is not inhibited from target binding or is not masked from target binding.

[0198] The CM and AB of an activatable antibody are selected so that the AB represents the binding moiety of a given target and the CM represents a substrate for a protease. In some embodiments, the protease colocalizes with the target at a treatment or diagnostic site of a subject. As used herein, colocalization refers to being in the same location or relatively close by. In some embodiments, the protease cleaves the CM, resulting in an activating antibody that binds to the target located near the cleavage site. The activatable antibodies disclosed herein find particular use, for example, in proteases that can cleave any site in the CM, i.e., where the protease is present at relatively higher levels in target-containing tissue at a treatment or diagnostic site than in tissue at a non-treatment site (e.g., healthy tissue). In some embodiments, the CM of the present disclosure is also cleaved by one or more other proteases. In some embodiments, it is one or more other proteases that colocalize with the target and are responsible for cleaving the CM in vivo.

[0199] In some embodiments, if the AB is not masked or inhibited from binding to the target, the activatable antibody results in reduced toxicity and / or adverse side effects that may result from binding of the AB at non-treated sites.

[0200] In general, an activatable antibody can be designed by selecting an AB of interest and constructing the remainder of the activatable antibody such that, when conformationally constrained, the MM results in masking of the AB or reduced binding of the AB to the target. To achieve this functional characteristic, structural design criteria can be considered.

[0201] Activatable antibodies are provided that exhibit a switchable phenotype with a desirable dynamic range of target binding between inhibited and uninhibited conformations. Dynamic range generally refers to the ratio of (a) the maximum detectable level of a parameter under a first set of conditions to (b) the minimum detectable value of the parameter under a second set of conditions. For example, in the context of an activatable antibody, dynamic range refers to the ratio of (a) the maximum detectable level of target protein binding to the activatable antibody in the presence of at least one protease capable of cleaving the CM of the activatable antibody to (b) the minimum detectable level of target protein binding to the activatable antibody in the absence of the protease. The dynamic range of an activatable antibody can be calculated as the ratio of the dissociation constant of the activatable antibody cleaving agent (e.g., enzyme) treatment to the dissociation constant of the activatable antibody cleaving agent treatment. The greater the dynamic range of the activatable antibody, the better the switchable phenotype of the activatable antibody. Activatable antibodies with relatively high dynamic range values ​​(e.g., greater than 1) exhibit a more desirable switching phenotype, such that binding of the target protein by the activatable antibody occurs to a greater extent (e.g., occurs primarily) in the presence of a cleaving agent (e.g., an enzyme) capable of cleaving the CM of the activatable antibody than in the absence of the cleaving agent.

[0202] Activatable antibodies can be provided in a variety of structural configurations. Exemplary formulas for activatable antibodies are provided below. It is specifically contemplated that the order of AB, MM, and CM from N-terminus to C-terminus within an activatable antibody can be reversed. It is also specifically contemplated that CM and MM can overlap in the amino acid sequence, for example, such that CM is contained within MM.

[0203] For example, an activatable antibody can be represented by the following formula (from the amino (N) terminal region to the carboxyl (C) terminal region): (MM)-(CM)-(AB) (AB)-(CM)-(MM) where MM is a masking moiety, CM is a cleavable moiety, and AB is an antibody or fragment thereof. Note that although MM and CM are shown as separate components in the above formula, in all exemplary embodiments (including formulas) disclosed herein, it is contemplated that the amino acid sequences of MM and CM may overlap, e.g., such that CM is fully or partially contained within MM. Additionally, the above formula provides for additional amino acid sequences that can be positioned N-terminal or C-terminal to the activatable antibody element.

[0204] In certain embodiments, the MM is not a natural binding partner of AB. In some embodiments, the MM contains no or substantially no homology to any natural binding partner of AB. In some embodiments, the MM is about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to any natural binding partner of AB. In some embodiments, the MM is about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% identical to any natural binding partner of AB. In some embodiments, the MM is about 50% identical to any natural binding partner of AB. In some embodiments, the MM is about 25% identical to any natural binding partner of AB. In some embodiments, the MM is about 20% identical to any natural binding partner of AB. In some embodiments, the MM is about 10% identical to any natural binding partner of AB.

[0205] In some embodiments, the activatable antibody comprises one or more linkers, e.g., flexible linkers, in the activatable antibody construct to confer flexibility to one or more of the MM-CM junction, the CM-AB junction, or both. For example, the AB, MM, and / or CM may not contain a sufficient number of residues (e.g., Gly, Ser, Asp, Asn, particularly Gly and Ser, particularly Gly) to provide the desired flexibility. Thus, the switchable phenotype of such an activatable antibody construct may benefit from the introduction of one or more amino acids to provide a flexible linker. Additionally, as described below, when the activatable antibody is provided as a conformationally constrained construct, a flexible linker may be operatively inserted to facilitate the formation and maintenance of a cyclic structure in the uncleaved activatable antibody.

[0206] For example, in certain embodiments, the activatable antibody comprises one of the following formulas (the formulas below represent the amino acid sequence from either N-terminal to C-terminal or C-terminal to N-terminal): (MM)-L1-(CM)-(AB) (MM)-(CM)-L2-(AB) (MM)-L1-(CM)-L2-(AB) wherein MM, CM, and AB are as defined above. wherein L1 and L2 are each independently and optionally present or absent, the same or different flexible linkers comprising at least one flexible amino acid (e.g., Gly). In addition, the above formula provides for additional amino acid sequences that can be positioned N-terminal or C-terminal to the activatable antibody element. Examples include, but are not limited to, targeting moieties (e.g., ligands for receptors on cells present in target tissues) and serum half-life extending moieties (e.g., polypeptides that bind serum proteins such as immunoglobulins (e.g., IgG) or serum albumins (e.g., human serum albumin (HAS))).

[0207] CM is approximately 0.001 to 1500 x 10 4 M -1 S -1 , or at least 0.001, 0.005, 0.01, 0.05, 0.1, 0.5, 1, 2.5, 5, 7.5, 10, 15, 20, 25, 50, 75, 100, 125, 150, 200, 250, 500, 750, 1000, 1250, or 1500x10 4 M -1 S -1 In some embodiments, the CM is specifically cleaved by at least one protease at a rate of about 100,000 M -1 S -1 In some embodiments, the CM is specifically cleaved at a rate of about 1x10 2 ~approx. 1x10 6 M -1 S -1 (i.e., approximately 1x10 2 ~approx. 1x10 6 M -1S -1 ) is specifically cleaved at a rate of

[0208] In the case of specific cleavage by an enzyme, contact occurs between the enzyme and the CM. When an activatable antibody, including an AB linked to a MM and a CM, is in the presence of a target and sufficient enzymatic activity, the CM can be cleaved. Sufficient enzymatic activity refers to the enzyme's ability to contact the CM and perform cleavage. It is easy to imagine that an enzyme can be near a CM but unable to cleave it due to other cellular factors or protein modifications of the enzyme.

[0209] Linkers suitable for use in the compositions described herein generally provide flexibility to the modified AB or activatable antibody to facilitate inhibition of AB binding to a target. Such linkers are commonly referred to as flexible linkers. Suitable linkers can be readily selected and can be of any of a variety of suitable lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, 2 to 15 amino acids, 3 to 12 amino acids, 4 to 10 amino acids, 5 to 9 amino acids, 6 to 8 amino acids, or 7 to 8 amino acids, and can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in length.

[0210] Exemplary flexible linkers include glycine polymers (G), glycine-serine polymers (e.g., (GS), (GSGGS) (SEQ ID NO: 339), and (GGGS) (SEQ ID NO: 340), where n is at least one integer and, in some embodiments, 20 or less, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured and can function as neutral tethers between components. Glycine has access to much more phi-psi space than alanine and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). Exemplary flexible linkers include, but are not limited to, Gly-Gly-Ser-Gly (SEQ ID NO: 341), Gly-Gly-Ser-Gly-Gly (SEQ ID NO: 342), Gly-Ser-Gly-Ser-Gly (SEQ ID NO: 343), Gly-Ser-Gly-Gly-Gly (SEQ ID NO: 344), Gly-Gly-Gly-Ser-Gly (SEQ ID NO: 345), Gly-Ser-Ser-Ser-Gly (SEQ ID NO: 346), etc. Those skilled in the art will recognize that the design of an activatable antibody may include a fully or partially flexible linker, whereby the linker may include a flexible linker and one or more moieties that confer a less flexible structure to result in the desired activatable antibody structure.

[0211] The present disclosure also provides compositions and methods for quantifying activatable antibodies modified to allow attachment of one or more agents to one or more cysteine ​​residues in the AB without impairing the activity (e.g., masking, activation, or binding activity) of the activatable antibody. In some embodiments, the activatable antibody is modified to allow attachment of one or more agents to one or more cysteine ​​residues in the AB without reducing or otherwise interfering with one or more disulfide bonds in the MM. For example, in some embodiments, the compositions and methods provided herein can be practiced using an activatable antibody conjugated to one or more agents, e.g., any of a variety of therapeutic, diagnostic, and / or prophylactic agents, without any agent(s) conjugated to the MM of the activatable antibody. The compositions and methods provided herein are used with conjugated activatable antibodies in which the MM retains the ability to effectively and efficiently mask the AB of the uncleaved activatable antibody. The compositions and methods provided herein are used with conjugated activatable antibodies in which the activatable antibody is still activated, i.e., cleaved, in the presence of a protease capable of cleaving the CM.

[0212] An activatable antibody has at least one point of attachment to an agent, although not all possible points of attachment are available for attachment to an agent in the methods and compositions provided herein. In some embodiments, one or more points of attachment are sulfur atoms involved in a disulfide bond. In some embodiments, one or more points of attachment are sulfur atoms involved in an interchain disulfide bond. In some embodiments, one or more points of attachment are sulfur atoms involved in an interchain sulfide bond, but not an intrachain disulfide bond. In some embodiments, one or more points of attachment are sulfur atoms of cysteine ​​or other amino acid residues that contain sulfur atoms. Such residues may occur naturally in the antibody structure or may be incorporated into the antibody by site-directed mutagenesis, chemical conversion, or misincorporation of unnatural amino acids.

[0213] The compositions and methods provided herein can also be used to conjugates of an activatable antibody having one or more interchain disulfide bonds in AB and one or more intrachain disulfide bonds in MM, in which case a drug reactive with free thiols is provided. In these embodiments, the method generally involves partially reducing the interchain disulfide bonds of the activatable antibody with a reducing agent, such as TCEP, and attaching a drug reactive with free thiols to the partially reduced activatable antibody. As used herein, the term partial reduction refers to a situation in which an activatable antibody is contacted with a reducing agent and fewer than all disulfide bonds, e.g., fewer than all available binding sites, are reduced. In some embodiments, less than 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5% of all possible binding sites are reduced.

[0214] In still other embodiments, the compositions and methods provided herein are used in combination with methods for reducing and conjugating an agent, such as a drug, to an activatable antibody, thereby conferring selectivity in agent placement. In these embodiments, the methods generally involve partially reducing the activatable antibody with a reducing agent so that the masking portion of the activatable antibody or any binding sites on other portions of the activatable antibody other than the AB are not reduced, and then conjugating the agent to the interchain thiol in the AB. The binding site(s) are selected to allow for the desired placement of the agent so that binding can occur at the desired site. An example of a reducing agent is TCEP. Reduction reaction conditions, such as the ratio of reducing agent to activatable antibody, the length of incubation, the temperature during incubation, and the pH of the reduction reaction solution, are determined by identifying conditions that produce a conjugated activatable antibody whose MM retains its ability to effectively and efficiently mask the AB of the uncleaved activatable antibody. The ratio of reducing agent to activatable antibody varies depending on the activatable antibody. In some embodiments, the ratio of reducing agent to activatable antibody is in the range of about 20:1 to 1:1, about 10:1 to 1:1, about 9:1 to 1:1, about 8:1 to 1:1, about 7:1 to 1:1, about 6:1 to 1:1, about 5:1 to 1:1, about 4:1 to 1:1, about 3:1 to 1:1, about 2:1 to 1:1, about 20:1 to 1:1.5, about 10:1 to 1:1.5, about 9:1 to 1:1.5, about 8:1 to 1:1.5, about 7:1 to 1:1.5, about 6:1 to 1:1.5, about 5:1 to 1:1.5, about 4:1 to 1:1.5, about 3:1 to 1:1.5, about 2:1 to 1:1.5, about 1.5:1 to 1:1.5, or about 1:1 to 1:1.5. In some embodiments, the ratio is in the range of about 5:1 to 1:1. In some embodiments, the ratio is in the range of about 5:1 to 1.5:1. In some embodiments, the ratio is in the range of about 4:1 to 1:1. In some embodiments, the ratio is in the range of about 4:1 to 1.5:1. In some embodiments, the ratio is in the range of about 8:1 to about 1:1. In some embodiments, the ratio is in the range of about 2.5:1 to 1:1.

[0215] In some embodiments, the compositions and methods provided herein are used in combination with a method that reduces the interchain disulfide bond in the AB of an activatable antibody and binds an agent, e.g., a thiol-containing agent such as a drug, to the resulting interchain thiol to selectively position the agent(s) on the AB. In these embodiments, the method generally involves partially reducing the AB with a reducing agent to form at least two interchain thiols without forming all possible interchain thiols in the activatable antibody, and binding the agent to the interchain thiols of the partially reduced AB. For example, the AB of an activatable antibody is partially reduced at about 37°C for about 1 hour with a desired ratio of reducing agent to activating antibody. In some embodiments, the ratio of reducing agent to activatable antibody is in the range of about 20:1 to 1:1, about 10:1 to 1:1, about 9:1 to 1:1, about 8:1 to 1:1, about 7:1 to 1:1, about 6:1 to 1:1, about 5:1 to 1:1, about 4:1 to 1:1, about 3:1 to 1:1, about 2:1 to 1:1, about 20:1 to 1:1.5, about 10:1 to 1:1.5, about 9:1 to 1:1.5, about 8:1 to 1:1.5, about 7:1 to 1:1.5, about 6:1 to 1:1.5, about 5:1 to 1:1.5, about 4:1 to 1:1.5, about 3:1 to 1:1.5, about 2:1 to 1:1.5, about 1.5:1 to 1:1.5, or about 1:1 to 1:1.5. In some embodiments, the ratio is in the range of about 5:1 to 1:1. In some embodiments, the ratio is in the range of about 5:1 to 1.5:1. In some embodiments, the ratio is in the range of about 4:1 to 1:1. In some embodiments, the ratio is in the range of about 4:1 to 1.5:1. In some embodiments, the ratio is in the range of about 8:1 to about 1:1. In some embodiments, the ratio is in the range of about 2.5:1 to 1:1.

[0216] The thiol-containing reagent can be, for example, cysteine ​​or N-acetylcysteine. The reducing agent can be, for example, TCEP. In some embodiments, the reduced activatable antibody can be purified prior to conjugation, for example, using column chromatography, dialysis, or diafiltration. Alternatively, the reduced antibody is not purified after partial reduction and prior to conjugation.

[0217] In some embodiments, the compositions and methods provided herein are used with a partially reduced activatable antibody in which at least one interchain disulfide bond of the activatable antibody has been reduced with a reducing agent without disrupting the intrachain disulfide bonds of the activatable antibody, the activatable antibody comprising an antibody or antigen-binding fragment thereof (AB) that specifically binds a target, a masking moiety (MM) that inhibits binding of the AB of the uncleaved activatable antibody to its target, and a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease. In some embodiments, the MM is linked to the AB via the CM. In some embodiments, one or more intrachain disulfide bonds of the activatable antibody are not disrupted by the reducing agent. In some embodiments, one or more intrachain disulfide bonds of the MM in the activatable antibody are not disrupted by the reducing agent. In some embodiments, the uncleaved activatable antibody has the following structural configuration from N-terminus to C-terminus: MM-CM-AB or AB-CM-MM. In some embodiments, the reducing agent is TCEP.

[0218] In still other embodiments, the compositions and methods provided herein are used in conjunction with methods for reducing an agent, e.g., a drug, and attaching it to an activatable antibody to provide selectivity in agent placement by providing an activatable antibody with a defined number and location of lysine and / or cysteine ​​residues. In some embodiments, the defined number of lysine and / or cysteine ​​residues is greater than or less than the number of corresponding residues in the amino acid sequence of the parent antibody or activatable antibody. In some embodiments, a defined number of lysine and / or cysteine ​​residues can result in a defined number of agent equivalents that can be attached to the antibody or activatable antibody. In some embodiments, a defined number of lysine and / or cysteine ​​residues can result in a defined number of agent equivalents that can be attached to the antibody or activatable antibody in a site-specific manner. In some embodiments, the modified activatable antibody is modified with one or more unnatural amino acids in a site-specific manner, thus, in some embodiments, restricting agent attachment to only the unnatural amino acid sites. In some embodiments, an antibody or activatable antibody having a defined number and positions of lysine and / or cysteine ​​residues may be partially reduced with a reducing agent as discussed herein, such that any binding sites on the masking moiety or other non-AB portions of the activatable antibody are not reduced, and the agent is attached to the interchain thiols in the AB.

[0219] In some embodiments, the compositions and methods provided herein are used with a partially reduced activatable antibody in which at least one interchain disulfide bond in the activatable antibody has been reduced with a reducing agent without disrupting any intrachain disulfide bonds of the activatable antibody, the activatable antibody comprising an antibody or antigen-binding fragment thereof (AB) that specifically binds to a target, a masking moiety (MM) that inhibits binding of the AB of the uncleaved activatable antibody to its target, and a cleavable moiety (CM) linked to the AB, the CM being a polypeptide that functions as a substrate for a protease. In some embodiments, the MM is linked to the AB via the CM. In some embodiments, one or more intrachain disulfide bonds of the activatable antibody are not disrupted by the reducing agent. In some embodiments, one or more intrachain disulfide bonds of the MM in the activatable antibody are not disrupted by the reducing agent. In some embodiments, the activatable antibody in its uncleaved state has the following structural configuration from N-terminus to C-terminus: MM-CM-AB or AB-CM-MM. In some embodiments, the reducing agent is TCEP.

[0220] In some embodiments, the compositions and methods provided herein are used with activatable antibodies that also include an agent conjugated to the activatable antibody. In some embodiments, the conjugated agent is a therapeutic agent, such as an anti-inflammatory agent and / or an anti-neoplastic agent. In such embodiments, the agent is conjugated to a carbohydrate moiety of the activatable antibody. For example, in some embodiments, the carbohydrate moiety is positioned outside the antigen-binding region of the antibody or antigen-binding fragment in the activatable antibody. In some embodiments, the agent is conjugated to a sulfhydryl group of the antibody or antigen-binding fragment in the activatable antibody.

[0221] In some embodiments, the agent is a cytotoxic agent such as a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or a fragment thereof), or a radioactive isotope (i.e., a radioconjugate).

[0222] In some embodiments, the agent is a detectable moiety, such as a label or other marker. For example, the agent is or includes a radiolabeled amino acid, one or more biotinyl moieties detectable by marked avidin (e.g., streptavidin containing a fluorescent marker or an enzymatic activity detectable by optical or calorimetric methods), or one or more radioisotopes or radionuclides, one or more fluorescent labels, one or more enzymatic labels, and / or one or more chemiluminescent agents. In some embodiments, the detectable moiety is attached by a spacer molecule.

[0223] In some embodiments, the compositions and methods provided herein are used in conjunction with an immunoconjugate comprising an antibody conjugated to a cytotoxic agent, such as a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or a fragment thereof), or a radioactive isotope (i.e., a radioconjugate). Suitable cytotoxic agents include, for example, dolastatin and its derivatives (e.g., auristatin E, AFP, MMAF, MMAE, MMAD, DMAF, DMAE). For example, the agent is monomethylauristatin E (MMAE) or monomethylauristatin D (MMAD). In some embodiments, the agent is an agent selected from the group listed in Table 5. In some embodiments, the agent is a dolastatin. In some embodiments, the agent is an auristatin or a derivative thereof. In some embodiments, the agent is auristatin E or a derivative thereof. In some embodiments, the agent is monomethylauristatin E (MMAE). In some embodiments, the agent is monomethylauristatin D (MMAD). In some embodiments, the agent is a maytansinoid or a maytansinoid derivative. In some embodiments, the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or a derivative thereof. In some embodiments, the agent is a calicheamicin or a derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine. In some embodiments, the agent is a pyrrolobenzodiazepine dimer.

[0224] In some embodiments, the agent is linked to AB using a maleimidocaproyl-valine-citrulline linker or a maleimidoPEG-valine-citrulline linker. In some embodiments, the agent is linked to AB using a maleimidocaproyl-valine-citrulline linker. In some embodiments, the agent is linked to AB using a maleimidoPEG-valine-citrulline linker. In some embodiments, the agent is linked to AB using a maleimidoPEG-valine-citrulline linker. In some embodiments, the agent is monomethyl auristatin D (MMAD) linked to AB using a maleimidoPEG-valine-citrulline-para-aminobenzyloxycarbonyl linker, this linker payload construct is referred to herein as "vc-MMAD." In some embodiments, the agent is monomethyl auristatin E (MMAE) linked to AB using a maleimidoPEG-valine-citrulline-para-aminobenzyloxycarbonyl linker, this linker payload construct is referred to herein as "vc-MMAE." In some embodiments, the agent is linked to AB using a maleimidoPEG-valine-citrulline linker. In some embodiments, the agent is monomethyl auristatin D (MMAD) linked to AB using a bis-maleimide PEG-valine-citrulline-para-aminobenzyloxycarbonyl linker; this linker-payload construct is referred to herein as "PEG2-vc-MMAD." The structures of vc-MMAD, vc-MMAE, and PEG2-vc-MMAD are shown below: [ka] [ka] [ka]

[0225] In some embodiments, the compositions and methods provided herein are used with a conjugated activatable antibody comprising an activatable antibody linked to a monomethyl auristatin D (MMAD) payload, the activatable antibody comprising an antibody or antigen-binding fragment thereof (AB) that specifically binds to a target, a masking moiety (MM) that inhibits binding of the AB to the target in the uncleaved state of the activatable antibody, and a cleavable moiety (CM) conjugated to the AB, the CM being a polypeptide that functions as a substrate for at least one MMP protease.

[0226] In some embodiments, the MMAD-linked activatable antibody may be conjugated using any of several methods for attaching an agent to the AB: (a) attachment to a carbohydrate moiety of the AB, or (b) attachment to a sulfhydryl group of the AB, or (c) attachment to an amino group of the AB, or (d) attachment to a carboxylate group of the AB.

[0227] In some embodiments, the MMAD payload is attached to AB via a linker. In some embodiments, the MMAD payload is attached to a cysteine ​​in AB via a linker. In some embodiments, the MMAD payload is attached to a lysine in AB via a linker. In some embodiments, the MMAD payload is attached to another residue of AB, such as a residue disclosed herein, via a linker. In some embodiments, the linker is a thiol-containing linker. In some embodiments, the linker is a cleavable linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker is selected from the group consisting of linkers shown in Tables 6 and 7. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimidocaproyl-valine-citrulline linker. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimidoPEG-valine-citrulline linker. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimidocaproyl-valine-citrulline-para-aminobenzyloxycarbonyl linker. In some embodiments, the activatable antibody and the MMAD payload are linked via a maleimide PEG-valine-citrulline-para-aminobenzyloxycarbonyl linker. In some embodiments, the MMAD payload is conjugated to the AB using the partial reduction and conjugation techniques disclosed herein.

[0228] In some embodiments, the polyethylene glycol (PEG) component of the linker of the present disclosure is formed from two ethylene glycol monomers, three ethylene glycol monomers, four ethylene glycol monomers, five ethylene glycol monomers, six ethylene glycol monomers, seven ethylene glycol monomers, eight ethylene glycol monomers, nine ethylene glycol monomers, or at least ten ethylene glycol monomers. In some embodiments of the present disclosure, the PEG component is a branched polymer. In some embodiments of the present disclosure, the PEG component is an unbranched polymer. In some embodiments, the PEG polymer component is functionalized with an amino group or derivative thereof, a carboxyl group or derivative thereof, or both an amino group or derivative thereof and a carboxyl group or derivative thereof.

[0229] In some embodiments, the PEG component of a linker of the present disclosure is an aminotetraethyleneglycol carboxyl group or a derivative thereof. In some embodiments, the PEG component of a linker of the present disclosure is an aminotriethyleneglycol carboxyl group or a derivative thereof. In some embodiments, the PEG component of a linker of the present disclosure is an aminodiethyleneglycol carboxyl group or a derivative thereof. In some embodiments, the amino derivative is an amide bond formation between the amino group and the carboxyl group to which the amino group is attached. In some embodiments, the carboxyl derivative is an amide bond formation between the carboxyl group and the amino group to which the carboxyl group is attached. In some embodiments, the carboxyl derivative is an ester bond formation between the carboxyl group and the hydroxyl group to which the carboxyl group is attached.

[0230] Enzymatically active toxins and fragments that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alphasarcin, Aleurites fordii protein, dianthin protein, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogenin, restrictocin, phenomycin, enomycin, and the trichothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include: 212 Bi, 131 I, 131 In, 90 Y, and 186 Re is an example.

[0231] Conjugates of antibodies and cytotoxic agents are prepared using a variety of bifunctional protein coupling agents, such as N-succinimidyl-3-(2-pyridyldithiol)propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bisazide compounds (such as bis(p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as triene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, ricin immunotoxins can be prepared as described in Vitetta et al., Science 238:1098 (1987). Carbon-14 labeled 1-isothiocyanatobenzyl-3-methyldiethylenetriaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugating radionucleotides to antibodies (see WO 94 / 11026).

[0232] Table 5 lists some exemplary pharmaceutical agents that can be used in the disclosure described herein, but is by no means meant to be an exhaustive list. [Table 4] TIFF0007779882000011.tif216162

[0233] Those skilled in the art will recognize that a wide variety of possible moieties can be attached to antibodies generated according to the present disclosure (see, e.g., "Conjugate Vaccines," in Contributions to Microbiology and Immunology, JM Cruse and RE Lewis, Jr. (eds.), Carger Press, New York (1989), the entire contents of which are incorporated herein by reference).

[0234] Linkage can be achieved by any chemical reaction that bonds two molecules, so long as the antibody and other moiety retain their respective activities. This linkage can involve many chemical mechanisms, such as covalent bonding, affinity binding, intercalation, coordinate bonding, and complex formation. However, in some embodiments, the linkage is a covalent bond. Covalent bonding can be achieved either by direct condensation of existing side chains or by the incorporation of an external crosslinking molecule. Many bivalent or polyvalent linking agents are useful for linking protein molecules, such as the antibodies of the present disclosure, to other molecules. For example, representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzene, and hexamethylenediamine. This list is not intended to be exhaustive of the various classes of coupling agents known in the art, but is illustrative of the more common coupling agents (see Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984); Jansen et al., Immunological Reviews 62:185-216 (1982); and Vitetta et al., Science 238:1098 (1987)).

[0235] In some embodiments, the compositions and methods provided herein are used with conjugated activatable antibodies that have been modified for site-specific conjugation via modified amino acid sequences inserted into or otherwise included in the activatable antibody sequence. These modified amino acid sequences are designed to allow for controlled placement and / or dosage of conjugating agents within the conjugated activatable antibody. For example, activatable antibodies can be engineered to contain cysteine ​​substitutions at positions on the light and heavy chains that provide reactive thiol groups and do not adversely affect protein folding and assembly or alter antigen binding. In some embodiments, activatable antibodies can be engineered to include or otherwise incorporate one or more non-natural amino acid residues within the activatable antibody to provide suitable sites for conjugation. In some embodiments, activatable antibodies can be engineered to include or otherwise incorporate enzymatically activatable peptide sequences within the activatable antibody sequence.

[0236] Suitable linkers are described in the literature (see, e.g., Ramakrishnan, S. et al., Cancer Res. 44:201-208 (1984) (describing the use of (M-maleimidobenzoyl-N-hydroxysuccinimide ester)). See also U.S. Pat. No. 5,030,719, which describes the use of halogenated acetylhydrazide derivatives linked to antibodies via oligopeptide linkers. In some embodiments, suitable linkers include (i) EDC (1-ethyl-3-(3-dimethylamino-propyl)carbodiimide hydrochloride); (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6[3-(2-pyridyldithio)propionamido]hexanoate (Pierce Chem. Co., Cat. No. 21651G); (iv) sulfo-LC-SPDP (sulfosuccinimidyl-6[3-(2-pyridyldithio)-propianamido]hexanoate (Pierce Chem. Co. Cat. No. 2165-G); and (v) sulfo-NHS (N-hydroxysulfosuccinimide) coupled to EDC. Chem. Co., catalog number 24510. Additional linkers include, but are not limited to, SMCC ((succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate), sulfo-SMCC (sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate), SPDB (N-succinimidyl-4-(2-pyridyldithio)butanoate), or sulfo-SPDB (N-succinimidyl-4-(2-pyridyldithio)-2-sulfobutanoate).

[0237] The above linkers contain components with different properties, resulting in conjugates with different physicochemical properties. For example, sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NHS ester-containing linkers are less soluble than sulfo-NHS esters. Furthermore, the linker SMPT contains a sterically hindered disulfide bond, which may result in conjugates with improved stability. Disulfide bonds are generally less stable than other bonds due to in vitro cleavage, resulting in fewer available conjugates. Sulfo-NHS, in particular, can enhance the stability of carbodiimide couplings. Carbodiimide couplings (e.g., EDC) when used in combination with sulfo-NHS form esters that are more resistant to hydrolysis than the carbodiimide coupling reaction alone.

[0238] In some embodiments, the linker is cleavable. In some embodiments, the linker is non-cleavable. In some embodiments, there are two or more linkers. The two or more linkers can all be the same, i.e., cleavable or non-cleavable, or the two or more linkers can be different, i.e., at least one is cleavable and at least one is non-cleavable.

[0239] The agent can be attached to the AB using any of several methods: (a) attachment to the carbohydrate moiety of the AB, or (b) attachment to a sulfhydryl group of the AB, or (c) attachment to an amino group of the AB, or (d) attachment to a carboxylate group of the AB. In some embodiments, the AB can be covalently attached to the agent via an intermediate linker having at least two reactive groups (one to react with the AB and the other to react with the agent). The linker, which can comprise any compatible organic compound, can be selected so that reaction with the AB (or agent) does not adversely affect the reactivity and selectivity of the AB. Furthermore, attachment of the linker to the agent will not destroy the activity of the agent. Linkers suitable for reaction with oxidized antibodies or oxidized antibody fragments include those containing an amine selected from the group consisting of primary amine groups, secondary amine groups, hydrazine groups, hydrazide groups, hydroxylamine groups, phenylhydrazine groups, semicarbazide groups, and thiosemicarbazide groups. Such reactive functional groups may be present as part of the structure of the linker or may be introduced by suitable chemical modification of a linker that does not contain such groups.

[0240] According to the present disclosure, linkers suitable for attachment to the reduced AB include those having specific reactive groups capable of reacting with sulfhydryl groups on the reduced antibody or fragment. Such reactive groups include, but are not limited to, reactive haloalkyl groups (e.g., haloacetyl groups), p-mercuribenzoate groups, and groups capable of Michael-type addition reactions (e.g., including maleimides and groups of the type described by Mitra and Lawton, 1979, J. Amer. Chem. Soc. 101:3097-3110).

[0241] According to the present disclosure, linkers suitable for attachment to non-oxidized and non-reduced Abs include linkers with specific functional groups that can react with primary amino groups present on unmodified lysine residues in Abs. Such reactive groups include, but are not limited to, NHS carboxylic acid or carbonate, sulfo-NHS carboxylic acid or carbonate, 4-nitrophenyl carboxylic acid or carbonate, pentafluorophenyl carboxylic acid or carbonate, acylimidazole, isocyanate, and isothiocyanate.

[0242] According to the present disclosure, suitable linkers for attachment to non-oxidized or non-reduced Abs include those with specific functional groups capable of reacting with carboxylic acid groups present on aspartic acid or glutamic acid residues in Abs activated with a suitable reagent. Suitable activation reagents include EDC, with or without added NHS or sulfo-NHS, and other dehydrating agents that utilize carboxamide formation. In these cases, suitable functional groups present on the linker include primary and secondary amines, hydrazines, hydroxylamines, and hydrazides.

[0243] The agent can be attached to the linker before or after the linker is attached to the AB. In certain applications, it may be desirable to first generate an AB-linker intermediate in which the linker does not contain the associated agent. Depending on the specific application, the specific agent can then be covalently attached to the linker. In some embodiments, the AB is first attached to the MM, CM and associated linker, and then attached to the linker for the purpose of binding.

[0244] Branched Linkers: In certain embodiments, branched linkers are utilized that have multiple sites for attaching agents. In the case of multi-site linkers, a single covalent attachment to AB results in an AB linker intermediate that can attach agents at multiple sites. These sites can be aldehyde or sulfhydryl groups, or any chemical site to which an agent can be attached.

[0245] In some embodiments, higher specific activity (or higher ratio of agent to AB) can be achieved by attaching a single-site linker at multiple sites on the AB. These multiple sites can be introduced into the AB by either of two methods. In the first method, multiple aldehyde and / or sulfhydryl groups can be generated in the same AB. In the second method, a single "branched linker" with multiple functional sites for subsequent attachment to a linker can be attached to a single aldehyde or sulfhydryl on the AB. The functional sites on the branched or multi-site linker can be aldehyde or sulfhydryl groups, or any chemical site to which a linker can be attached. Even higher specific activity can be achieved by combining these two approaches, i.e., attaching a multi-site linker to multiple sites on the AB.

[0246] Cleavable linkers: Peptide linkers susceptible to cleavage by enzymes of the complement system, such as, but not limited to, u-plasminogen activator, tissue plasminogen activator, trypsin, plasmin, or another enzyme with proteolytic activity, can be used in one embodiment of the present disclosure. According to one method of the present disclosure, the agent is attached via a linker susceptible to cleavage by complement. The antibody is selected from a class that can activate complement. Thus, the antibody-agent conjugate activates the complement cascade and releases the agent at the target site. According to another method of the present disclosure, the agent is attached via a linker susceptible to cleavage by an enzyme with proteolytic activity, such as u-plasminogen activator, tissue plasminogen activator, plasmin, or trypsin. These cleavable linkers are useful in conjugated activatable antibodies that include exotoxins, such as, for example, any of the exotoxins listed in Table 5, as non-limiting examples.

[0247] Non-limiting examples of cleavable linker sequences are shown in Table 6. [Table 5]

[0248] Additionally, the agent can be attached to the AB via a disulfide bond (e.g., a disulfide bond of a cysteine ​​molecule). Many tumors naturally release high levels of glutathione (a reducing agent), which reduces the disulfide bond and results in the subsequent release of the agent at the delivery site. In some embodiments, the reducing agent that modifies the CM also modifies the linker of the attached activatable antibody.

[0249] Spacer and cleavable elements: In some embodiments, it may be necessary to construct the linker in such a way as to optimize the spacing between the agent and the activatable antibody AB. This can be achieved by using linkers with the general structure: W-(CH2)nQ During the ceremony, W is either --NH--CH2-- or --CH2--; Q is an amino acid or peptide, n is an integer from 0 to 20; This can be achieved by the use of a linker such as

[0250] In some embodiments, the linker may comprise a spacer element and a cleavable element. The spacer element serves to position the cleavable element away from the AB core so that the cleavable element is more accessible to the enzyme responsible for cleavage. Certain branched linkers described above may function as spacer elements.

[0251] It should be understood throughout this discussion that the attachment of a linker to an agent (or the attachment of a spacer element to a cleavable element, or the attachment of a cleavable element to an agent) does not require a particular mode of attachment or reaction: any reaction that results in a product of suitable stability and biological compatibility is acceptable.

[0252] Selection of serum complement and linker: According to one method of the present disclosure, if release of an agent is desired, an AB, a class of antibody capable of activating complement, is used. The resulting conjugate retains both the ability to bind antigen and the ability to activate the complement cascade. Thus, according to this embodiment of the present disclosure, the agent is attached to one end of a cleavable linker or cleavable element, and the other end of the linker group is attached to a specific site on the AB. For example, if the agent has a hydroxy or amino group, it can be attached to the carboxy terminus of a peptide, amino acid, or other appropriately selected linker via an ester or amide bond, respectively. For example, such agents can be attached to a linker peptide via a carbodiimide reaction. If the agent contains functional groups that interfere with attachment to the linker, these interfering functional groups can be blocked before attachment and then unblocked once the product conjugate or intermediate is produced. The opposite or amino terminus of the linker can then be used directly or after further modification for attachment to an AB capable of activating complement.

[0253] The linker (or spacer element of the linker) can be of any desired length, and one end can be covalently attached to a specific site on the AB of the activatable antibody. The other end of the linker or spacer element can be attached to an amino acid or peptide linker.

[0254] Thus, when these conjugates bind to an antigen in the presence of complement, the amide or ester bond attaching the agent to the linker is cleaved, resulting in release of the active agent. When administered to a subject, these conjugates achieve delivery and release of the agent at the target site and are particularly effective for in vivo delivery of pharmaceutical agents, antibiotics, antimetabolites, antiproliferative agents, and the like, including but not limited to those listed in Table 5.

[0255] Release linkers that do not activate complement: In yet another application of targeted delivery, release of an agent without complement activation is desirable because activation of the complement cascade ultimately lyses target cells. Therefore, this approach is useful when delivery and release of an agent must be achieved without killing the target cells. This is the goal when delivery of cellular mediators, such as hormones, enzymes, corticosteroids, neurotransmitters, genes, or enzymes, to target cells is desired. These conjugates can be prepared by attaching an agent to an AB that is incapable of activating complement via a linker that is mildly susceptible to cleavage by serum proteases. When this conjugate is administered to an individual, antigen-antibody complexes are rapidly formed, while cleavage of the agent occurs slowly, resulting in release of the compound at the target site.

[0256] Biochemical Crosslinkers: In some embodiments, certain biochemical crosslinkers can be used to conjugate an activatable antibody to one or more therapeutic agents. Crosslinking reagents form molecular bridges that link functional groups of two different molecules. To link two different proteins in a stepwise fashion, heterobifunctional crosslinkers can be used, which eliminates undesired homopolymer formation.

[0257] Peptidyl linkers cleavable by lysosomal proteases, such as Val-Cit, Val-Ala, or other dipeptides, are also useful. Additionally, acid-labile linkers, such as bis-sialyl ethers, can be used that are cleavable in the low pH environment of the lysosome. Other suitable linkers include cathepsin-labile substrates, particularly those that function optimally at acidic pH.

[0258] Exemplary heterobifunctional crosslinkers are referenced in Table 7. [Table 6]

[0259] Non-cleavable linker or direct attachment: In some embodiments of the present disclosure, the conjugate may be designed so that the agent is delivered to the target but not released. This may be achieved by attaching the agent to the AB directly or via a non-cleavable linker.

[0260] These non-cleavable linkers can include amino acids, peptides, D-amino acids, or other organic compounds that can be modified by the methods described herein to contain a functional group that can then be used for attachment to AB. The general formula for such organic linkers is: W-(CH2)nQ, During the ceremony, W is either --NH--CH2-- or --CH2--; Q is an amino acid or peptide, n is an integer of 0 to 20.

[0261] Non-cleavable conjugates: In some embodiments, a compound can be attached to an AB that does not activate complement. When an AB that cannot activate complement is used, this attachment can be achieved using a linker that is susceptible to cleavage by activated complement, or using a linker that is not susceptible to cleavage by activated complement.

[0262] The antibody disclosed herein can also be formulated as immunoliposome.Liposomes containing antibodies can be prepared by methods known in the art, such as those described in Epstein et al., Proc.Natl.Acad.Sci.USA, 82:3688 (1985); Hwang et al., Proc.Natl.Acad.Sci.USA, 77:4030 (1980); and U.S. Patent Nos. 4,485,045 and 4,544,545.Liposomes with extended circulation time are disclosed in U.S. Patent No. 5,013,556.

[0263] Particularly useful liposomes can be generated by reverse-phase evaporation using a lipid composition containing phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes of the desired diameter. Fab' fragments of the antibody of the present disclosure can be coupled to liposomes as described in Martin et al., J. Biol. Chem., 257:286-288 (1982) via a disulfide exchange reaction.

[0264] Definition: Unless otherwise defined, scientific and technical terms used in connection with this disclosure shall have the meanings commonly understood by those of ordinary skill in the art. The term "a" or "an" entity refers to one or more of that entity. For example, a compound refers to one or more compounds. Thus, the terms "a," "an," "one or more," and "at least one" may be used interchangeably. Furthermore, unless otherwise required by context, singular terms shall include plural terms, and plural terms shall include the singular. Generally, the nomenclature and techniques utilized in connection with cell and tissue culture, molecular biology, and protein and oligo- or polynucleotide chemistry and hybridization described herein are those well known and commonly used in the art. Standard techniques are used for recombinant DNA, oligonucleotide synthesis, tissue culture, and transformation (electroporation, lipofection, etc.). Enzymatic reactions and purification techniques are performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The foregoing techniques and procedures are generally carried out according to conventional methods well known in the art and as described in the various general and more specific references cited and discussed throughout this specification. See Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1989)). The nomenclature utilized in connection with analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein, and the laboratory procedures and techniques thereof, are those well known and commonly used in the art. Standard techniques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, delivery, and treatment of patients.

[0265] As utilized in accordance with the present disclosure, the following terms, unless otherwise indicated, shall be understood to have the following meanings:

[0266] As used herein, the term "antibody" refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen-binding site that specifically binds (immunoreacts with) an antigen. "Specifically binds" or "immunoreacts" or "immunospecifically binds" means that the antibody reacts with one or more antigenic determinants of a desired antigen and does not react with, or with a much lower affinity (K d >10 -6 ) means binding. Antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, domain antibodies, single chain, Fab and F(ab')2 fragments, scFv, and a Fab expression library.

[0267] The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" chain (approximately 25 kDa) and one "heavy" chain (approximately 50-70 kDa). The amino-terminal portion of each chain contains a variable region of approximately 100-110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Generally, antibody molecules obtained from humans belong to one of the following classes: IgG, IgM, IgA, IgE, and IgD, which differ from each other depending on the nature of the heavy chain present in the molecule. Specific classes also have subclasses, such as IgG1 and IgG2. Furthermore, in humans, light chains can be kappa or lambda chains.

[0268] As used herein, the term "monoclonal antibody" (mAb) or "monoclonal antibody composition" refers to a population of antibody molecules containing only one molecular species of antibody molecule, consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity-determining regions (CDRs) of a monoclonal antibody are identical in all molecules of the population. MAbs contain an antigen-binding site capable of immunoreacting with a particular epitope of an antigen characterized by a unique binding affinity for it.

[0269] The term "antigen-binding site" or "binding portion" refers to the portion of an immunoglobulin molecule involved in antigen binding. The antigen-binding site is formed by amino acid residues from the N-terminal variable ("V") regions of the heavy ("H") and light ("L") chains. Three highly divergent stretches within the V regions of the heavy and light chains, called "hypervariable regions," are interposed between adjacent, more conserved stretches known as "framework regions" or "FRs." Thus, the term "FR" refers to the amino acid sequences naturally found between and adjacent to the hypervariable regions in immunoglobulins. In an antibody molecule, the three hypervariable regions of the light chain and the three hypervariable regions of the heavy chain are positioned relative to each other in three-dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions" or "CDRs." The assignment of amino acids to each domain follows the definitions of the Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)) or Chothia & Lesk J. Mol. Biol. 196:901-917 (1987), Chothia et al., Nature 342:878-883 (1989).

[0270] As used herein, the term "epitope" includes any protein determinant capable of specific binding to an immunoglobulin, scFv, or T-cell receptor. The term "epitope" includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. Epitope determinants are typically composed of chemically active surface groupings of molecules, such as amino acids or sugar side chains, and typically have specific three-dimensional structural characteristics, as well as specific charge characteristics. For example, antibodies can be generated against N- or C-terminal peptides of a polypeptide. An antibody is said to specifically bind an antigen if the dissociation constant is 1 μM or less, in some embodiments, 100 nM or less, and in some embodiments, 10 nM or less.

[0271] As used herein, the terms "specific binding," "immunological binding," and "immunological binding characteristics" refer to the type of non-covalent interaction that occurs between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific. The strength or affinity of an immunological binding interaction is determined by the dissociation constant (K d ) and smaller K d represents a higher affinity. The immunological binding properties of a selected polypeptide can be quantified using methods well known in the art. One such method involves measuring the rates of formation and dissociation of the antigen-binding site / antigen complex, which depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that affect the rates in both directions equally. Thus, the "on-rate constant" (K on ) and "off rate constant" (K off Both the K and K can be determined by calculating the concentration and the actual rates of association and dissociation (see Nature 361:185-87 (1993)). off / K on The ratio of α to β cancels all parameters unrelated to affinity and also accounts for the dissociation constant K d (See generally Davies et al. (1990) Annual Rev Biochem 59:439-473.) An antibody of the present disclosure is said to specifically bind to a target if it has a binding constant (Kd) of 1 μM or less, in some embodiments 100 nM or less, in some embodiments 10 nM or less, and in some embodiments 100 pM or less to about 1 pM, as measured by an assay such as a radioligand binding assay or similar assay known to one of skill in the art.

[0272] As used herein, the term "isolated polynucleotide" means a polynucleotide of genomic, cDNA, or synthetic origin, or some combination thereof, and by its origin an "isolated polynucleotide" means that (1) the "isolated polynucleotide" is not associated with all or a portion of a polynucleotide found in nature, (2) it is operably linked to a polynucleotide with which it is not naturally linked, or (3) it does not occur in nature as part of a larger sequence. Polynucleotides according to the present disclosure include nucleic acid molecules encoding heavy chain immunoglobulin molecules as set forth herein, and nucleic acid molecules encoding light chain immunoglobulin molecules as set forth herein.

[0273] The term "isolated protein" as referred to herein means a protein of cDNA, recombinant RNA, or synthetic origin, or some combination thereof; by its origin or source of derivation, an "isolated protein" is (1) unrelated to proteins found in nature, (2) free from other proteins of the same source, e.g., free from mouse proteins, (3) expressed by cells from a different species, or (4) not naturally occurring.

[0274] The term "polypeptide" is used herein as a generic term to refer to naturally occurring proteins, fragments, or analogs of a polypeptide sequence. Naturally occurring protein fragments and analogs are therefore species of the polypeptide genus. Polypeptides according to the present disclosure include heavy chain immunoglobulin molecules as set forth herein, and light chain immunoglobulin molecules as set forth herein, as well as antibody molecules formed by combinations including heavy chain immunoglobulin molecules and light chain immunoglobulin molecules, such as kappa light chain immunoglobulin molecules, and vice versa, and fragments and analogs thereof.

[0275] The term "naturally occurring" as applied to an object herein refers to an object that can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (such as a virus) that can be isolated from a natural source and that has not been intentionally modified by humans in the laboratory or otherwise is naturally occurring.

[0276] As used herein, the term "operably linked" refers to the positioning of the components so described, and is in a relationship permitting them to function in their intended manner. A control sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.

[0277] The term "control sequence" as used herein refers to polynucleotide sequences necessary for the expression and processing of coding sequences to which they are ligated. The nature of such control sequences varies depending on the host organism in prokaryotes, but generally includes a promoter, a ribosomal binding site, and a transcription termination sequence in eukaryotes; generally, such control sequences include a promoter and a transcription termination sequence. The term "control sequence" is intended to include at least all components whose presence is essential for expression and processing, and may also include additional components whose presence is beneficial, such as leader sequences and fusion partner sequences. The term "polynucleotide" referred to herein means a nucleotide of at least 10 bases in length, ribonucleotides or deoxynucleotides, or modified forms of either type of nucleotide. This term includes single-stranded and double-stranded forms of DNA.

[0278] The term oligonucleotide, as referred to herein, includes naturally occurring nucleotides and modified nucleotides linked together by naturally occurring and non-naturally occurring oligonucleotide linkages. Oligonucleotides are a subset of polynucleotides generally comprising lengths of 200 bases or less. In some embodiments, oligonucleotides are 10-60 bases in length, and in some embodiments, 12, 13, 14, 15, 16, 17, 18, 19, or 20-40 bases in length. Oligonucleotides are typically single-stranded, e.g., for probes; however, oligonucleotides may also be double-stranded, e.g., for use in constructing gene mutants. Oligonucleotides of the present disclosure may be either sense or antisense oligonucleotides.

[0279] The term "naturally occurring nucleotides" referred to herein includes deoxyribonucleotides and ribonucleotides. The term "modified nucleotides" referred to herein includes nucleotides having modified or substituted sugar groups, etc. The term "oligonucleotide linkage" referred to herein includes oligonucleotide linkages such as phosphorothioate, phosphorodithioate, phosphoroseleroleate, phosphorodiselenoate, phosphoroanilothioate, phosphoraniladate, phosphoronmidate, etc. See, for example, LaPlanche et al., Nucl. Acids Res. 14:9081 (1986); Stec et al., J. Am. Chem. Soc. 106:6077 (1984); Stein et al., Nucl. Acids Res. 16:3209 (1988); Zon et al., Anti Cancer Drug Design 6:539 (1991); Zon et al., Oligonucleotides and Analogues: A Practical Approach, pp. 87-108 (F. Eckstein, ed., Oxford University Press, Oxford, England (1991)); Stec et al., U.S. Patent No. 5,151,510; Uhlmann and Peyman Chemical Reviews 90:543 (1990). Oligonucleotides can optionally contain a label for detection.

[0280] As used herein, the 20 conventional amino acids and their abbreviations follow conventional usage. See Immunology-A Synthesis (2nd ed., E.S. Golub and D.R. Green, eds., Sinauer Associates, Sunderland, Mass. (1991)). Stereoisomers of the 20 conventional amino acids, α-, α-disubstituted amino acids, N-alkyl amino acids, non-natural amino acids such as lactic acid, and other non-conventional amino acids (e.g., D-amino acids) may also be suitable components of the polypeptides of the present disclosure. Examples of non-conventional amino acids include 4-hydroxyproline, γ-carboxyglutamic acid, ε-N,N,N-trimethyllysine, ε-N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, σ-N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline). In the polypeptide notation used herein, the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy-terminal direction, in accordance with standard usage and convention.

[0281] Similarly, unless otherwise specified, the left-hand end of a single-stranded polynucleotide sequence is the 5' end, and the left-hand direction of a double-stranded polynucleotide sequence is referred to as the 5' direction. The direction of 5' to 3' addition of the nascent RNA transcript is referred to as the transcription direction, and the region of the sequence on the DNA strand that has the same sequence as the RNA and is 5' to the 5' end of the RNA transcript is referred to as the "upstream sequence," and the region of the sequence on the DNA strand that has the same sequence as the RNA and is 3' to the 3' end of the RNA transcript is referred to as the "downstream sequence."

[0282] As applied to polypeptides, the term "substantially identical" means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 80% sequence identity, in some embodiments at least 90% sequence identity, in some embodiments at least 95% sequence identity, and in some embodiments at least 99% sequence identity.

[0283] In some embodiments, residue positions that are not identical differ by conservative amino acid substitutions.

[0284] As discussed herein, minor changes in the amino acid sequence of an antibody or immunoglobulin molecule are considered to be encompassed by the present disclosure, provided that the changes in amino acid sequence maintain at least 75%, in some embodiments at least 80%, 90%, 95%, and in some embodiments, 99% integrity. Conservative amino acid substitutions are particularly contemplated. Conservative substitutions are those made within a family of amino acids that are related in their side chains. Genetically encoded amino acids are generally classified into the following families: (1) acidic amino acids are aspartic acid and glutamic acid; (2) basic amino acids are lysine, arginine, and histidine; (3) nonpolar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan; and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, and tyrosine. Hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine. Hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine, and valine. Other amino acid families include: (i) the aliphatic hydroxy family, serine and threonine; (ii) the amide-containing family, asparagine and glutamine; (iii) the aliphatic family, alanine, valine, leucine, isoleucine; and (iv) the aromatic family, phenylalanine, tryptophan, and tyrosine. For example, it is reasonable to predict that the isolated substitution of leucine with isoleucine or valine, aspartate with glutamate, threonine with serine, or similar substitution of an amino acid with a structurally related amino acid will not have a significant effect on the binding or properties of the resulting molecule, especially when the substitution does not involve an amino acid in the framework region. Whether an amino acid change results in a functional peptide can be readily determined by assaying the specific activity of the polypeptide derivative, assays which are described in detail herein.Fragments or analogs of antibodies or immunoglobulin molecules can be readily prepared by those skilled in the art. Preferred amino and carboxy termini of fragments or analogs occur near the boundaries of functional domains. Structural and functional domains can be identified by comparing nucleotide and / or amino acid sequence data with public or proprietary sequence databases. In some embodiments, computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and / or function. Methods for identifying protein sequences that fold into known three-dimensional structures are known. Bowie et al., Science 253:164 (1991). Thus, the foregoing examples demonstrate that those skilled in the art can recognize sequence motifs and structural conformations that can be used to define structural and functional domains in accordance with the present disclosure.

[0285] Suitable amino acid substitutions are those that (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinity, and (5) confer or alter other physicochemical or functional properties of such analogs. Analogs may include various muteins of sequences other than the naturally occurring peptide sequence. For example, single or multiple amino acid substitutions (e.g., conservative amino acid substitutions) can be made in the naturally occurring sequence (e.g., in a portion of the polypeptide outside the domain(s) that form intermolecular contacts). Conservative amino acid substitutions should not substantially alter the structural characteristics of the parent sequence (e.g., the substituted amino acid should not tend to disrupt helices occurring in the parent sequence or other types of secondary structure characteristic of the parent sequence). Art-recognized examples of polypeptide secondary and tertiary structure are described in Proteins, Structures and Molecular Principles (Creighton, ed., W.H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, NY (1991)); and Thornton et al., Nature 354:105 (1991).

[0286] As used herein, the term "polypeptide fragment" refers to a polypeptide having an amino- and / or carboxy-terminal deletion and / or one or more internal deletions, but the remaining amino acid sequence is identical to the corresponding positions in a naturally occurring sequence deduced, for example, from a full-length cDNA sequence. Fragments are typically at least 5, 6, 8, or 10 amino acids in length, in some embodiments at least 14 amino acids in length, in some embodiments at least 20 amino acids in length, usually at least 50 amino acids in length, and in some embodiments at least 70 amino acids in length. As used herein, the term "analog" refers to a polypeptide composed of a segment of at least 25 amino acids that has substantial identity to a portion of the deduced amino acid sequence and has specific binding to a target under suitable binding conditions. Typically, a polypeptide analog contains conservative amino acid substitutions (or additions or deletions) with respect to the naturally occurring sequence. Analogs are typically at least 20 amino acids in length, in some embodiments at least 50 amino acids in length or longer, and can often be as long as a full-length naturally occurring polypeptide.

[0287] The term "agent" is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract from biological materials.

[0288] As used herein, the term "label" or "labeled" refers to the incorporation of a detectable marker, for example, by incorporation of a radiolabeled amino acid or attachment to a polypeptide of a biotinyl moiety that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods). In certain circumstances, the label or marker can also be therapeutic. Various methods of labeling polypeptides and glycoproteins are known in the art and can be used. Examples of polypeptide labels include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H, 14 C. 15 N,35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), fluorescent labels (e.g., FITC, rhodamine, lanthanide fluorophores), enzymatic labels (e.g., horseradish peroxidase, p-galactosidase, luciferase, alkaline phosphatase), chemiluminescence, biotin groups, and predetermined polypeptide epitopes recognized by secondary reporters (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal-binding domains, epitope tags). In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance. As used herein, the term "pharmaceutical agent or drug" refers to a chemical compound or composition capable of inducing a desired therapeutic effect when appropriately administered to a patient.

[0289] Other chemical terms herein are used in accordance with conventional usage in the art as exemplified in The McGraw-Hill Dictionary of Chemical Terms (Parker, S., ed., McGraw-Hill, San Francisco (1985)).

[0290] As used herein, "substantially pure" means that the target species is the predominant species present (i.e., it is more abundant, on a molar basis, than any other individual species in the composition); in some embodiments, a substantially purified fraction is a composition in which the target species constitutes at least about 50 percent (on a molar basis) of all macromolecular species present.

[0291] Generally, a substantially pure composition comprises greater than about 80 percent, and in some embodiments greater than about 85%, 90%, 95%, and 99% of all macromolecular species present in the composition. In some embodiments, the target species is purified to essential homogeneity (contaminating species cannot be detected in the composition by conventional detection methods), in which the composition consists essentially of a single macromolecular species.

[0292] The term patient includes human and veterinary subjects.

[0293] The antibodies and / or activatable antibodies of the present disclosure specifically bind a given target, e.g., a human target protein. The present disclosure also includes antibodies and / or activatable antibodies that bind to the same epitope as the antibodies and / or activatable antibodies described herein. The present disclosure also includes antibodies and / or antibody-activatable antibodies that compete with the antibodies and / or activatable antibodies described herein for binding to a target. The present disclosure also includes antibodies and / or antibody-activatable antibodies that cross-compete with the antibodies and / or activatable antibodies described herein for binding to a target.

[0294] Those skilled in the art will recognize that whether a monoclonal antibody (e.g., a murine monoclonal antibody or a humanized antibody) has the same specificity as the monoclonal antibody used in the methods described herein can be determined without undue experimentation by determining whether the former prevents the latter from binding to its target. If the monoclonal antibody being tested competes with the monoclonal antibody of the present disclosure, the two monoclonal antibodies will bind to the same epitope or closely related epitopes, as indicated by reduced binding by the monoclonal antibody of the present disclosure. An alternative method for determining whether a monoclonal antibody has the specificity of the monoclonal antibody of the present disclosure is to preincubate the monoclonal antibody of the present disclosure with the target, then add the monoclonal antibody being tested to determine whether the ability of the monoclonal antibody being tested to bind the target is inhibited. If the monoclonal antibody being tested is inhibited, it likely has the same or a functionally equivalent epitope specificity as the monoclonal antibody of the present disclosure.

[0295] Multispecific activatable antibodies The present disclosure also provides methods and compositions using multispecific activatable antibodies. The multispecific activatable antibodies provided herein are multispecific antibodies that recognize a target and at least one or more different antigens or epitopes and include at least one masking moiety (MM) linked to at least one antigen- or epitope-binding domain of the multispecific antibody, such that the linkage of the MM reduces the ability of the antigen- or epitope-binding domain to bind its target. In some embodiments, the MM is linked to the antigen- or epitope-binding domain of the multispecific antibody via a cleavable moiety (CM) that functions as a substrate for at least one protease. The activatable multispecific antibodies provided herein are stable in circulation, are activated at the intended therapeutic and / or diagnostic site but not in normal, i.e., healthy, tissue, and, when activated, exhibit target binding at least comparable to that of the corresponding unmodified multispecific antibody.

[0296] In some embodiments, the multispecific activatable antibody is designed to engage an immune effector cell, also referred to herein as an immune effector cell-engaging multispecific activatable antibody. In some embodiments, the multispecific activatable antibody is designed to engage a leukocyte, also referred to herein as a leukocyte-engaging multispecific activatable antibody. In some embodiments, the multispecific activatable antibody is designed to engage a T cell, also referred to herein as a T cell-engaging multispecific activatable antibody. In some embodiments, the multispecific activatable antibody engages a surface antigen on a leukocyte, such as on a T cell, a natural killer (NK) cell, a bone marrow mononuclear cell, a macrophage, and / or another immune effector cell. In some embodiments, the immune effector cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. In some embodiments, the immune effector cell is an NK cell. In some embodiments, the immune effector cell is a mononuclear cell, such as a bone marrow mononuclear cell. In some embodiments, multispecific activatable antibodies are designed to bind to or interact with multiple targets and / or multiple epitopes, and are also referred to herein as multi-antigen targetable antibodies. As used herein, the terms "target" and "antigen" are used interchangeably.

[0297] In some embodiments, the immune effector cell-engaging multispecific activatable antibody of the present disclosure comprises a targeting antibody or antigen-binding fragment thereof that binds a target, and an immune effector cell-engaging antibody or antigen-binding portion thereof, wherein at least one of the targeting antibody or antigen-binding fragment thereof and / or the immune effector cell-engaging antibody or antigen-binding portion thereof is masked. In some embodiments, the immune effector cell-engaging antibody or antigen-binding fragment thereof comprises a first antibody or antigen-binding fragment thereof (AB1) that binds a first immune effector cell-engaging target, wherein AB1 is attached to a masking moiety (MM1), such that conjugation of MM1 reduces the ability of AB1 to bind the first target. In some embodiments, the targeting antibody or antigen-binding fragment thereof comprises a second antibody or antigen-binding fragment thereof (AB2), which comprises a second antibody or antigen-binding fragment thereof that binds the target, wherein AB2 is attached to a masking moiety (MM2), such that conjugation of MM2 reduces the ability of AB2 to bind the target. In some embodiments, the immune effector cell-engaging antibody or antigen-binding fragment thereof comprises a first antibody or antigen-binding fragment thereof (AB1) that binds a first immune effector cell-engaging target, where AB1 is attached to a masking moiety (MM1), such that the attachment of MM1 reduces the ability of AB1 to bind the first target; and the targeting antibody or antigen-binding fragment thereof comprises a second antibody or fragment thereof comprising a second antibody or antigen-binding fragment thereof (AB2) that binds the target, where AB2 is attached to a masking moiety (MM2), such that the attachment of MM2 reduces the ability of AB2 to bind the target. In some embodiments, the non-immune effector cell-engaging antibody is a cancer-targeting antibody. In some embodiments, the non-immune cell effector antibody is an IgG. In some embodiments, the immune effector cell-engaging antibody is an scFv. In some embodiments, the targeting antibody (e.g., non-immune cell effector antibody) is an IgG and the immune effector cell-engaging antibody is an scFv. In some embodiments, the immune effector cells are leukocytes. In some embodiments, the immune effector cells are T cells. In some embodiments, the immune effector cells are NK cells. In some embodiments, the immune effector cells are bone marrow mononuclear cells.

[0298] In some embodiments, the T cell-engaging multispecific activatable antibody of the present disclosure comprises a targeting antibody or antigen-binding fragment thereof and a T cell-engaging antibody or antigen-binding portion thereof, wherein at least one of the targeting antibody or antigen-binding fragment thereof and / or the T cell-engaging antibody or antigen-binding portion thereof is masked. In some embodiments, the T cell-engaging antibody or antigen-binding fragment thereof comprises a first antibody or antigen-binding fragment thereof (AB1) that binds to a first T cell-engaging target, wherein AB1 is attached to a masking moiety (MM1), such that conjugation of MM1 reduces the ability of AB1 to bind the first target. In some embodiments, the targeting antibody or antigen-binding fragment thereof comprises a second antibody or antigen-binding fragment thereof (AB2) that comprises a second antibody or antigen-binding fragment thereof that binds the target, wherein AB2 is attached to a masking moiety (MM2), such that conjugation of MM2 reduces the ability of AB2 to bind the target. In some embodiments, the T cell-engaging antibody or antigen-binding fragment thereof comprises a first antibody or antigen-binding fragment thereof (AB1) that binds a first T cell-engaging target, where AB1 is attached to a masking moiety (MM1), such that ligation of MM1 reduces the ability of AB1 to bind the first target, and the targeting antibody or antigen-binding fragment thereof comprises a secondary antibody or fragment thereof comprising a second antibody or antigen-binding fragment thereof (AB2) that binds the target, where AB2 is attached to a masking moiety (MM2), such that ligation of MM2 reduces the ability of AB2 to bind the target.

[0299] In some embodiments of immune effector cell-engaging multispecific activatable antibodies, one antigen is the target and another antigen is typically a stimulatory or inhibitory receptor present on the surface of T cells, natural killer (NK) cells, myelomonocytic cells, macrophages, and / or other immune effector cells, including, but not limited to, B7-H4, BTLA, CD3, CD4, CD8, CD16a, CD25, CD27, CD28, CD32, CD56, CD137, CTLA-4, GITR, HVEM, ICOS, LAG3, NKG2D, OX40, PD-1, TIGIT, TIM3, or VISTA. In some embodiments, the antigen is a stimulatory receptor present on the surface of T cells or NK cells, examples of such stimulatory receptors include, but are not limited to, CD3, CD27, CD28, CD137 (also referred to as 4-1BB), GITR, HVEM, ICOS, NKG2D, and OX40. In some embodiments, the antigen is an inhibitory receptor present on the surface of a T cell, examples of which include, but are not limited to, BTLA, CTLA-4, LAG3, PD-1, TIGIT, TIM3, and NK-expressed KIR. The antibody domain that confers specificity for a T cell surface antigen may be replaced by a ligand or ligand domain that binds to a T cell receptor, an NK cell receptor, a macrophage receptor, and / or other immune effector cell receptor, such as, but not limited to, B7-1, B7-2, B7H3, PDL1, PDL2, or TNFSF9.

[0300] In some embodiments, the T cell-engaging multispecific activatable antibody comprises an anti-CD3 epsilon (CD3ε, also referred to herein as CD3e and CD3), scFv, and a targeting antibody or antigen-binding fragment thereof, wherein at least one of the anti-CD3ε scFv and / or the targeting antibody or antigen-binding portion thereof is masked. In some embodiments, the CD3ε scFv comprises a first antibody or antigen-binding fragment thereof (AB1) that binds CD3ε, wherein AB1 is attached to a masking moiety (MM1), such that ligation of MM1 reduces the ability of AB1 to bind CD3ε. In some embodiments, the targeting antibody or antigen-binding fragment thereof comprises a second antibody or antigen-binding fragment thereof (AB2), which comprises a second antibody or antigen-binding fragment thereof that binds the target, wherein AB2 is attached to a masking moiety (MM2), such that ligation of MM2 reduces the ability of AB2 to bind the target. In some embodiments, the CD3ε scFv comprises a first antibody or antigen-binding fragment thereof (AB1) that binds to CD3ε, where AB1 is attached to a masking moiety (MM1), such that attachment of MM1 reduces the ability of AB1 to bind CD3ε, and the targeting antibody or antigen-binding fragment thereof comprises a second antibody or antigen-binding fragment thereof (AB2) that binds the target, where AB2 is attached to a masking moiety (MM2), such that attachment of MM2 reduces the ability of AB2 to bind the target.

[0301] In some embodiments, the multi-antigen targeting antibody and / or multi-antigen targeting activatable antibody comprises at least a first antibody or antigen-binding fragment thereof that binds a first target and / or a first epitope and a second antibody or antigen-binding fragment thereof that binds a second target and / or a second epitope. In some embodiments, the multi-antigen targeting antibody and / or multi-antigen targeting activatable antibody binds two or more different targets. In some embodiments, the multi-antigen targeting antibody and / or multi-antigen targeting activatable antibody binds two or more different epitopes on the same target. In some embodiments, the multi-antigen targeting antibody and / or multi-antigen targeting activatable antibody binds a combination of two or more different targets and two or more different epitopes on the same target.

[0302] In some embodiments, the multispecific activatable antibody comprising an IgG has a masked IgG variable domain. In some embodiments, the multispecific activatable antibody comprising an scFv has a masked scFv domain. In some embodiments, the multispecific activatable antibody has both an IgG variable domain and an scFv domain, and at least one of the IgG variable domains is linked to a masking moiety. In some embodiments, the multispecific activatable antibody has both an IgG variable domain and an scFv domain, and at least one of the scFv domains is linked to a masking moiety. In some embodiments, the multispecific activatable antibody has both an IgG variable domain and an scFv domain, and at least one of the IgG variable domains is linked to a masking moiety and at least one of the scFv domains is linked to a masking moiety. In some embodiments, the multispecific activatable antibody has both an IgG variable domain and an scFv domain, and each of the IgG variable domain and the scFv domain is linked to its own masking moiety. In some embodiments, one antibody domain of the multispecific activatable antibody has specificity for a target antigen and another antibody domain has specificity for a T cell surface antigen. In some embodiments, one antibody domain of the multispecific activatable antibody has specificity for a target antigen and another antibody domain has specificity for a different target antigen, hi some embodiments, one antibody domain of the multispecific activatable antibody has specificity for an epitope of the target antigen and another antibody domain has specificity for a different epitope of the target antigen.

[0303] In multispecific activatable antibodies, scFvs can be fused to the carboxyl terminus of the heavy chain of an IgG activatable antibody, to the carboxyl terminus of the light chain of an IgG activatable antibody, or to the carboxyl terminus of both the heavy and light chains of an IgG activatable antibody. In multispecific activatable antibodies, scFvs can be fused to the amino terminus of the heavy chain of an IgG activatable antibody, to the amino terminus of the light chain of an IgG activatable antibody, or to the amino terminus of both the heavy and light chains of an IgG activatable antibody. In multispecific activatable antibodies, scFvs can be fused to any combination of one or more carboxyl termini and one or more amino termini of an IgG activatable antibody. In some embodiments, a masking moiety (MM) linked to a cleavable moiety (CM) is attached to the antigen-binding domain of an IgG and masks that domain. In some embodiments, a masking moiety (MM) linked to a cleavable moiety (CM) is attached to the antigen-binding domain of at least one scFv and masks that domain. In some embodiments, a masking moiety (MM) linked to a cleavable moiety (CM) is attached to the antigen-binding domain of an IgG, masking that domain, and a masking moiety (MM) linked to a cleavable moiety (CM) is attached to the antigen-binding domain of at least one scFv, masking that domain.

[0304] The present disclosure provides examples of multispecific activatable antibody constructs including, but not limited to: (VL-CL)2:(VH-CH1-CH2-CH3-L4-VH*-L3-VL*-L2-CM-L1-MM)2; (VL-CL)2:(VH-CH1-CH2-CH3-L4-VL*-L3-VH*-L2-CM-L1-MM)2; (MM-L1-CM-L2-VL-CL)2:(VH-CH1-CH2-CH3-L4-VH*-L3-VL*)2; (MM-L1-CM-L2-VL-CL)2:(VH-CH1-CH2-CH3-L4-VL*-L3-VH*)2; (VL-CL)2:(MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; (VL-CL)2:(MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2; (MM-L1-CM-L2-VL-CL)2:(VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; (MM-L1-CM-L2-VL-CL)2:(VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM)2:(VH-CH1-CH2-CH3)2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM)2:(VH-CH1-CH2-CH3)2; (MM-L1-CM-L2-VL*-L3-VH*-L4-VL-CL)2:(VH-CH1-CH2-CH3)2; (MM-L1-CM-L2-VH*-L3-VL*-L4-VL-CL)2:(VH-CH1-CH2-CH3)2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM)2:(MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM)2:(MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM)2:(MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM)2:(MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2;(VL-CL-L4-VH*-L3-VL*)2:(MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VH*-L3-VL*)2:(MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VL*-L3-VH*)2:(MM-L1-CM-L2-VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; (VL-CL-L4-VL*-L3-VH*)2:(MM-L1-CM-L2-VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2;( VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM)2:(VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2;( VL-CL-L4-VH*-L3-VL*-L2-CM-L1-MM)2:(VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2;(V L-CL-L4-VL*-L3-VH*-L2-CM-L1-MM)2:(VL*-L3-VH*-L4-VH-CH1-CH2-CH3)2; is (VL-CL-L4-VL*-L3-VH*-L2-CM-L1-MM)2:(VH*-L3-VL*-L4-VH-CH1-CH2-CH3)2. VL and VH represent the light and heavy variable domains of a first specificity contained in an IgG, VL* and VH* represent the variable domains of a second specificity contained in an scFv, L1 is a linker peptide connecting the masking moiety (MM) and the cleavable moiety (CM), L2 is a linker peptide connecting the cleavable moiety (CM) and the antibody, L3 is a linker peptide connecting the variable domains of the scFv, L4 is a linker peptide connecting the antibody of the first specificity to the antibody of the second specificity, CL is a light chain constant domain, and CH1, CH2, and CH3 are heavy chain constant domains. The first and second specificities can be directed against any antigen or epitope;

[0305] In some embodiments of T cell-engaging multispecific activatable antibodies, one antigen is the target and another antigen is typically a stimulatory (also referred to herein as activating) or inhibitory receptor present on the surface of T cells, natural killer (NK) cells, myelomonocytic cells, macrophages, and / or other immune effector cells, such as, but not limited to, B7-H4, BTLA, CD3, CD4, CD8, CD16a, CD25, CD27, CD28, CD32, CD56, CD137 (also referred to as TNFRSF9), CTLA-4, GITR, HVEM, ICOS, LAG3, NKG2D, OX40, PD-1, TIGIT, TIM3, or VISTA. The antibody domain that confers specificity for a T cell surface antigen may be replaced by a ligand or ligand domain that binds to a T cell receptor, NK cell receptor, macrophage receptor, and / or other immune effector cell receptor.

[0306] In some embodiments, the targeting antibody is an antibody disclosed herein. In some embodiments, the targeting antibody can be in the form of an activatable antibody. In some embodiments, the scFv can be in the form of a Pro-scFv (see, e.g., WO 2009 / 025846, WO 2010 / 081173).

[0307] In some embodiments, the scFv is specific for binding to CD3ε and comprises or is derived from an antibody or fragment thereof that binds CD3ε, e.g., CH2527, FN18, H2C, OKT3, 2C11, UCHT1, or V9. In some embodiments, the scFv is specific for binding CTLA-4 (also referred to herein as CTLA and CTLA4).

[0308] In some embodiments, the anti-CTLA-4 scFv has the amino acid sequence: GGGSGGGGSGSGGGSGGGGSGGGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPLTFGGGTKVEIKRSGGSTITSYNVYYTKLSSSGTQVQLVQTGGGVVQPGRSLRLSCAASGSTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCATNSLYWYFDLWGRGTLVTVSSAS (SEQ ID NO: 643) Includes:

[0309] In some embodiments, the anti-CTLA-4 scFv comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to the amino acid sequence of SEQ ID NO:643.

[0310] In some embodiments, the anti-CD3ε scFv has the amino acid sequence: GGGSGGGGSGSGGGSGGGGSGGGQVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSGGGGSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINR (SEQ ID NO: 644) Includes:

[0311] In some embodiments, the anti-CD3ε scFv comprises an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to the amino acid sequence of SEQ ID NO:644.

[0312] In some embodiments, the scFv is specific for binding one or more T cells, one or more NK cells, and / or one or more macrophages. In some embodiments, the scFv is specific for binding a target selected from the group consisting of B7-H4, BTLA, CD3, CD4, CD8, CD16a, CD25, CD27, CD28, CD32, CD56, CD137, CTLA-4, GITR, HVEM, ICOS, LAG3, NKG2D, OX40, PD-1, TIGIT, TIM3, or VISTA.

[0313] In some embodiments, the multispecific activatable antibody also includes an agent conjugated to AB. In some embodiments, the agent is a therapeutic agent. In some embodiments, the agent is an anti-tumor agent. In some embodiments, the agent is a toxin or a fragment thereof. In some embodiments, the agent is conjugated to the multispecific activatable antibody via a linker. In some embodiments, the agent is conjugated to AB via a cleavable linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the agent is a microtubule inhibitor. In some embodiments, the agent is a nucleic acid damaging agent, such as a DNA alkylating agent or a DNA intercalating agent, or other DNA damaging agent. In some embodiments, the linker is a cleavable linker. In some embodiments, the agent is an agent selected from the group listed in Table 5. In some embodiments, the agent is a dolastatin. In some embodiments, the agent is an auristatin or a derivative thereof. In some embodiments, the agent is auristatin E or a derivative thereof. In some embodiments, the agent is monomethylauristatin E (MMAE). In some embodiments, the agent is monomethylauristatin D (MMAD). In some embodiments, the agent is a maytansinoid or a maytansinoid derivative. In some embodiments, the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or a derivative thereof. In some embodiments, the agent is a calicheamicin or a derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine. In some embodiments, the agent is a pyrrolobenzodiazepine dimer.

[0314] In some embodiments, the multispecific activatable antibody also comprises a detectable moiety. In some embodiments, the detectable moiety is a diagnostic agent.

[0315] In some embodiments, the multispecific activatable antibody naturally contains one or more disulfide bonds. In some embodiments, the multispecific activatable antibody can be engineered to contain one or more disulfide bonds.

[0316] The present disclosure also provides isolated nucleic acid molecules encoding the multispecific activatable antibodies described herein, as well as vectors comprising these isolated nucleic acid sequences. The present disclosure provides methods of producing multispecific activatable antibodies by culturing cells under conditions that result in expression of the activatable antibodies, where the cells comprise such nucleic acid molecules. In some embodiments, the cells comprise such vectors.

[0317] The present disclosure also provides methods of producing a multispecific activatable antibody of the present disclosure by (a) culturing cells containing a nucleic acid construct encoding the multispecific activatable antibody under conditions that result in expression of the multispecific activatable antibody, and (b) recovering the multispecific activatable antibody. Suitable ABs, MMs, and / or CMs include any of the ABs, MMs, and / or CMs disclosed herein.

[0318] The present disclosure also provides multispecific activatable antibodies and / or multispecific activatable antibody compositions comprising at least a first antibody or antigen-binding fragment thereof (AB1) that specifically binds a first target or a first epitope and a second antibody or antigen-binding fragment thereof (AB2) that binds a second target or a second epitope, wherein at least AB1 is linked or attached to a masking moiety (MM1), such that the linkage of MM1 reduces the ability of AB1 to bind its target. In some embodiments, MM1 is linked to AB1 via a first cleavable moiety (CM1) sequence that includes a substrate for a protease, e.g., a protease that co-localizes with the target of AB1 at a therapeutic or diagnostic site in a subject. The multispecific activatable antibodies provided herein are stable in circulation, are activated at the intended therapeutic and / or diagnostic site but not in normal, i.e., healthy, tissue, and, upon activation, exhibit target binding of AB1 at least comparable to that of the corresponding unmodified multispecific antibody. Suitable ABs, MMs, and / or CMs include any of the ABs, MMs, and / or CMs disclosed herein.

[0319] The present disclosure also provides compositions and methods comprising multispecific activatable antibodies comprising at least a first antibody or antibody fragment (AB1) and a second antibody or antibody fragment (AB2) that specifically bind a target, wherein at least the first AB of the multispecific activatable antibody is linked to a masking moiety (MM1) that reduces the ability of AB1 to bind its target. In some embodiments, each AB is linked to a MM that reduces the ability of its corresponding AB for each target. For example, in embodiments of bispecific activatable antibodies, AB1 is linked to a first masking moiety (MM1) that reduces the ability of AB1 to bind its target, and AB2 is linked to a second masking moiety (MM2) that reduces the ability of AB2 to bind its target. In some embodiments, the multispecific activatable antibody comprises three or more AB regions, and in such embodiments, for each AB in the multispecific activatable antibody, AB1 is linked to a first masking moiety (MM1) that reduces the ability of AB1 to bind its target, AB2 is linked to a second masking moiety (MM2) that reduces the ability of AB2 to bind its target, AB3 is linked to a third masking moiety (MM3) that reduces the ability of AB3 to bind its target, etc. Suitable ABs, MMs, and / or CMs include any of the ABs, MMs, and / or CMs disclosed herein.

[0320] In some embodiments, the multispecific activatable antibody further comprises at least one cleavable moiety (CM) that is a substrate for a protease, the CM linking the MM to the AB. For example, in some embodiments, the multispecific activatable antibody comprises at least a first antibody or antibody fragment (AB1) that specifically binds a target, and a second antibody or antibody fragment (AB2), and at least the first AB in the multispecific activatable antibody is linked via a first cleavable moiety (CM1) to a masking moiety (MM1) that reduces the ability of AB1 to bind its target. In some bispecific activatable antibody embodiments, AB1 is linked via a CM1 to MM1, and AB2 is linked via a second cleavable moiety (CM2) to a second masking moiety (MM2) that reduces the ability of AB2 to bind its target. In some embodiments, the multispecific activatable antibody comprises three or more AB regions, and in some of these embodiments, for each AB in the multispecific activatable antibody, AB1 is linked to MM1 via CM1, AB2 is linked to MM2 via CM2, AB3 is linked to a third masking moiety (MM3) that reduces the ability of AB3 to bind its target via a third cleavable moiety (CM3), etc. Suitable ABs, MMs, and / or CMs include any of the ABs, MMs, and / or CMs disclosed herein.

[0321] Activatable antibodies having a non-binding steric moiety or a binding partner for the non-binding steric moiety In some embodiments, the compositions and methods provided herein are used with activatable antibodies comprising a non-binding steric moiety (NB) or a binding partner (BP) of the non-binding steric moiety, where the BP recruits or attracts the NB to the activatable antibody. Activatable antibodies provided herein include, for example, activatable antibodies comprising a non-binding steric moiety (NB), a cleavable linker (CL), and an antibody or antibody fragment (AB) that binds a target; activatable antibodies comprising a binding partner of the non-binding steric moiety (BP), a CL, and an AB; and BPs to which an NB has been recruited; activatable antibodies comprising a CL and AB that bind a target. An activatable antibody in which the NB is covalently linked to the CL and AB of the activatable antibody or associated through interaction with a BP that is covalently linked to the CL and AB of the activatable antibody is referred to herein as an "NB-containing activatable antibody." Activatable or switchable means that the activatable antibody exhibits a first level of binding to a target when the activatable antibody is in an uninhibited, unmasked, or uncleaved state (i.e., a first conformation), and a second level of binding to a target when the activatable antibody is in an uninhibited, unmasked, and / or cleaved state (i.e., a second conformation, i.e., an activated antibody), where the second level of target binding is greater than the first level of target binding. Activatable antibody compositions may exhibit improved bioavailability and more favorable biodistribution compared to conventional antibody therapeutics.

[0322] In some embodiments, the activatable antibodies result in reduced toxicity and / or adverse side effects that may result from binding at non-therapeutic and / or non-diagnostic sites if the AB is not masked or otherwise inhibited from binding to such sites.

[0323] Activatable antibodies comprising a non-binding steric moiety (NB) can be made using the methods described in PCT Publication No. WO 2013 / 192546, the contents of which are incorporated herein by reference in their entirety.

[0324] Embodiments of the present invention include: 1. A method for quantifying the activation level of an activatable antibody-based therapeutic, the method comprising: i) loading at least one capillary or a population of capillaries with a stacking matrix and a separation matrix; ii) contacting the loaded capillary or population of loaded capillaries with a biological sample; iii) separating high molecular weight (MW) components of the biological sample from low molecular weight (MW) components of the biological sample in each capillary; iv) immobilizing a high MW component and a low MW component in each capillary; v) immunoprobing each capillary with at least one detectable reagent specific for at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof; vi) quantifying the level of detectable reagent in each capillary or population of capillaries; and Includes: 2. The method of embodiment 1, wherein the at least one detectable reagent in step v) comprises at least a first reagent specific for at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, and a second reagent that specifically binds to or recognizes the first reagent, wherein the second reagent comprises a detectable label. 3. The method of embodiment 2, wherein step vi) comprises quantifying the level of detectable label in each capillary or population of capillaries. 4. The method of any one of embodiments 1 to 3, wherein step ii) comprises loading about 1 to 500 ng of biological sample. 5. The method of any one of embodiments 1 to 4, wherein step ii) comprises loading about 5 to 40 ng of biological sample. 6. The method of any one of embodiments 1 to 5, wherein the biological sample is prepared with one or more SDS-containing buffers in an amount sufficient to effect molecular weight separation. 7. The method of any one of embodiments 1 to 6, wherein step iv) comprises using UV light to immobilize high MW and low MW components of the biological sample. 8. The method of any one of embodiments 1 to 7, wherein the first reagent in step v) is an antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof. 9. The method of any one of embodiments 1 to 8, wherein the second reagent of step iv) is a detectably labeled secondary antibody that specifically binds to the first reagent. 10. The method of any one of embodiments 1 to 7, wherein the first reagent in step v) is a primary antibody or antigen-binding fragment thereof that specifically binds to at least one activatable antibody, conjugated activatable antibody, multispecific activatable antibody, conjugated multispecific activatable antibody, or combinations thereof, and the second reagent in step v) is a detectably labeled secondary antibody that specifically binds to the primary antibody or antigen-binding fragment thereof. 11. The method of any one of embodiments 1 to 10, wherein the detectable label is attached to the second reagent. 12. The method of embodiment 11, wherein the detectable label is a fluorescent label and step vi) comprises detecting the level of chemiluminescence in each capillary or population of capillaries. 13. The method of embodiment 12, wherein the detectable label is horseradish peroxidase (HRP). 14. The method of any one of embodiments 1 to 13, wherein the biological sample is a body fluid. 15. The method of embodiment 14, wherein the body fluid is blood, plasma, or serum. 16. The method of any one of embodiments 1 to 13, wherein the biological sample is diseased tissue. 17. The method of embodiment 16, wherein the diseased tissue is a lysate. 18. The method of embodiment 16 or embodiment 17, wherein the diseased tissue is tumor tissue. 19. The method of any one of embodiments 1-18, wherein the amount of activated activatable antibody or activatable antibody-based therapeutic or intact activatable antibody or activatable antibody-based therapeutic is compared. 20. The method of embodiment 19, wherein the activatable antibody-based therapeutic is a conjugated activatable antibody, a multispecific activatable antibody, a conjugated multispecific activatable antibody, or any combination thereof. 21. An isolated antibody or antigen-binding fragment thereof, comprising: a variable heavy chain complementarity determining region 1 (CDRH1) comprising the amino acid sequence SYGMS (SEQ ID NO: 438); a variable heavy chain complementarity determining region 2 (CDRH2) comprising the amino acid sequence TISPSGIYTYYPVTVKG (SEQ ID NO: 439); a variable heavy chain complementarity determining region 3 (CDRH3) comprising the amino acid sequence HHPNYGSTYLYYIDY (SEQ ID NO: 440); a variable light chain complementarity determining region 1 (CDRL1) comprising the amino acid sequence KSSQSVFSSSNQKNYLA (SEQ ID NO: 441); a variable light chain complementarity determining region 2 (CDRL2) comprising the amino acid sequence WAFTRES (SEQ ID NO: 442); and a variable light chain complementarity determining region 3 (CDRL3) comprising the amino acid sequence YQYLSSLT (SEQ ID NO: 443). 22. The antibody or antigen-binding fragment thereof of embodiment 21, wherein the antibody or antigen-binding fragment thereof comprises a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 429. 23. The antibody or antigen-binding fragment thereof of embodiment 21 or embodiment 22, wherein the antibody or antigen-binding fragment thereof comprises a variable light chain comprising the amino acid sequence of SEQ ID NO: 431. 24. An isolated antibody or antigen-binding fragment thereof comprising a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 429. 25. The isolated antibody or antigen-binding fragment thereof of embodiment 24, comprising a variable light chain comprising the amino acid sequence of SEQ ID NO: 431. 26. An isolated antibody or antigen-binding fragment thereof comprising a variable light chain comprising the amino acid sequence of SEQ ID NO: 431. 27. The isolated antibody or antigen-binding fragment thereof of embodiment 26, comprising a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 429.

[0325] The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.

[0326] Example Example 1. Generation of antibodies that bind activated anti-PDL1 activatable antibodies and intact anti-PDL1 activatable antibodies The studies provided herein were designed to generate and evaluate antibodies that bind the anti-PDL1 activatable antibodies of the present disclosure.

[0327] The studies presented herein used an anti-PDL1 activatable antibody designated herein as PL07-2001-C5H9v2, which comprises the heavy chain sequence of SEQ ID NO: 425 and the light chain sequence of SEQ ID NO: 426, as shown below. PL07-2001-C5H9v2 heavy chain amino acid sequence (SEQ ID NO: 425) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSSIWRNGIVTVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKWSAAFDYWGQGT LVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPP CPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT ISKAKGQPREPQVYTLPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG PL07-2001-C5H9v2 light chain amino acid sequence (SEQ ID NO: 426) QGQSGSGIALCPSHFCQLPQTGGGSSGGSGGSGGISSGLLSGRSDNHGGSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPED FATYYCQQDNGYPSTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

[0328] Mice were immunized with the peptide antigen CQQDNGYPSTFGGGT (SEQ ID NO: 427), which contains the VL CDR3 of the anti-PDL1 activatable antibody PL07-2001-C5H9v2 conjugated to the carrier protein keyhole limpet hemocyanin (KLH), by GenScript Biotech Corporation using the procedure shown in Table 3 below. Six 3-month-old mice (three Balb / c and three C56) were immunized according to the following protocol: At the time of each injection, an antigen aliquot was thawed and combined with complete Freund's adjuvant (CFA) for the first injection and incomplete Freund's adjuvant (IFA) for subsequent injections. [Table 7]

[0329] Serum titers against free peptide and counterscreening antigen (human IgG) were assessed in test breeds using standard ELISA procedures. Leads were assessed against full-length activatable antibodies in human plasma by Western blot. These results showed that all mice had comparable titers against their respective immunogens. Antisera were tested against activatable antibody PL07-2001-C5H9v2 in the Wes™ system (ProteinSimple), and two mice were selected for cell fusion.

[0330] Mouse monoclonal antibodies were produced as follows: lymphocytes from two mice were used for hybridoma fusion and seeded into 40 96-well plates (400 million lymphocytes / mouse). Plates were stored in a tissue culture incubator under standard conditions.

[0331] Example 2. Screening of hybridoma clones and characterization of antibodies This example describes the screening and characterization of hybridoma clones and the resulting antibodies generated against the anti-PDL1 activatable antibody PL07-2001-C5H9v2.

[0332] Hybridoma supernatants from the parent clones were screened by GenScript indirect ELISA against a short peptide containing the VL CDR3 of the activatable antibody PL07-2001-C5H9v2. Briefly, GenScript high-binding plates were coated with peptide BSA at a concentration of 1 μg / mL, 100 μL / well. Supernatants were used undiluted. Antisera diluted 1:1000 were used as a positive control. Peroxidase-AffiniPure goat anti-mouse IgG, Fcγ fragment specific (minimal cross-reactivity with human, bovine, or equine serum albumin, also known as min X Hu, Bov, Hrs, Sr, Prot) was used as a secondary. Twenty clones with positive signals were further screened against the anti-PDL1 antibody C5H9v2, the parent antibody of the activatable antibody PL07-2001-C5H9v2, and human IgG at 5 μg / mL. Anti-PDL1 antibody C5H9v2 was coated onto high-binding plates at a concentration of 1 μg / mL, 100 μL / well. Human IgG was coated onto high-binding plates at a concentration of 5 μg / mL, 100 μL / well. Western blot analysis was also performed on these 20 clones using 200 ng of denatured and reduced anti-PDL1 antibody C5H9v2 as the target. As a final screening, the supernatants of the 20 clones were also evaluated using the Wes™ system (ProteinSimple). Briefly, all 20 clones were tested against the single-arm activated activatable antibody PL07-2001-C5H9v2 at 1 μg / mL in 0.1x sample buffer and the single-arm activated activatable antibody PL07-2001-C5H9v2 at 1 μg / mL in 1:100 human plasma. The top six clones, designated 17G1, 18F1, 19H12, and 23H6, 21H10, and 27C1, as assessed by the strength and specificity of binding to the activatable antibody PL07-2001-C5H9v2, were further screened against the one-arm activated activatable antibody PL07-2001-C5H9v2 at 1:100 human plasma concentrations of 0.11 and 0.33 μg / mL.The results are shown in Figures 1A and 1B, which show the screening of activatable antibody PL07-2001-C5H9v2 anti-idiotype (anti-id) clones against the 37% single-arm activated activating antibody PL07-2001-C5H9v2 at 0.11, 0.33, and 1 μg / ml in human plasma at 1:100. Figure 1A is an electropherogram showing 17G1 detection at decreasing concentrations of the single-arm activated activatable antibody PL07-2001-C5H9v2 (1, 0.33, and 0.11 μg / ml). Figure 1B shows the relative activation rates of the top six clones of the single-arm activated activatable antibody PL07-2001-C5H9v2. The relative activation rates are maintained at various concentrations. Clones 21H10 and 27C1 have low affinity, so there is no data for the 0.11 μg / ml concentration.

[0333] Clones 17G1, 18F1, 19H12, and 23H6 were selected for subcloning and characterization. Molecular cloning was performed using the following method: Total RNA was isolated from fresh hybridoma cells harvested by GenScript according to the procedure described in the TRIzol® Reagent Technical Manual (ThermoFisher). Total RNA was then reverse transcribed into cDNA using either an isotype-specific antisense primer or a universal primer according to the procedure described in the PrimeScript™ 1st Strand cDNA Synthesis Kit (Clontech). Variable heavy (VH), variable light (VL), heavy chain (HC), and light chain (LC) antibody fragments were amplified according to GenScript's rapid amplification of cDNA ends (RACE) protocol. Each amplified antibody fragment was cloned into a separate standard cloning vector. Colony PCR was performed to screen for clones with the correct insert size. Five or more colonies with the correct insert size were sequenced for each fragment. The sequences of the different clones were aligned and a consensus sequence was determined.

[0334] The nucleic acid and amino acid sequences of antibody 17G1 are shown below. The 17G1 antibody comprises a variable heavy chain complementarity determining region 1 (CDRH1) comprising the amino acid sequence SYGMS (SEQ ID NO:438); a variable heavy chain complementarity determining region 2 (CDRH2) comprising the amino acid sequence TISPSGIYTYYPVTVKG (SEQ ID NO:439); a variable heavy chain complementarity determining region 3 (CDRH3) comprising the amino acid sequence HHPNYGSTYLYYIDY (SEQ ID NO:440); a variable light chain complementarity determining region 1 (CDRL1) comprising the amino acid sequence KSSQSVFSSSNQKNYLA (SEQ ID NO:441); a variable light chain complementarity determining region 2 (CDRL2) comprising the amino acid sequence WAFTRES (SEQ ID NO:442); and a variable light chain complementarity determining region 3 (CDRL3) comprising the amino acid sequence YQYLSSLT (SEQ ID NO:443). Mature variable heavy region: DNA sequence [FR1]-[CDR1]-[FR2]-[CDR2]-[FR3]-[CDR3]-[FR4] [GAGGTGCAGTTGGTGGAGTCTGGGGGAGACTTAGTGAAGCCTGGAGGGTCCCTGAAAGTCTCCTGTGCAGCCTCTGGATTCACTTTCAGT][AGTTATGGCATGTCT][TGGGTTCGCCAGACTCCAGACAAAAGGCTGGAGTGGGTCGCA][ACCATTAGTCCTAGTGGTATATACACCTACTATCCAGTCACTG TGAAGGGG][CGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTGTACCTGCAAATGAGCAGTCTGAAGTCTGAGGACACAGCCATGTATTTCTGTGCAAGA][CACCATCCAAACTATGGTAGTACGTACCTGTATTATATTGATTAC][TGGGGCCAAGGCACCGCTCTCACAGTCTCCTCA] (SEQ ID NO: 428) Mature variable heavy region: amino acid sequence [FR1]-[CDR1]-[FR2]-[CDR2]-[FR3]-[CDR3]-[FR4] [EVQLVESGGDLVKPGGSLKVSCAASGFTFS][SYGMS][WVRQTPDKRLEWVA][TISPSGIYTYYPVTVKG][RFTISRDNAKNTLYLQMSSLKSEDTAMYFCAR][HHPNYGSTYLYYIDY][WGQGTALTVSS] (SEQ ID NO: 429) Mature heavy chain: amino acid sequence: 17G1_Hc mIgG2a EVQLVESGGDLVKPGGSLKVSCAASGFTFSSYGMSWVRQTPDKRLEWVATISPSGIYTYYPVTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYFCARHHPNYGSTYLYYIDYWG QGTALTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPC PPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK (SEQ ID NO: 444) Mature variable light region: DNA sequence [FR1]-[CDR1]-[FR2]-[CDR2]-[FR3]-[CDR3]-[FR4] [AACATTATGATGACACAGTCGCCATCATCTCTGGCTGTGTCTGCAGGAGAAAAGGTCACTATGGCCTGT][AAGTCCAGTCAAAGTGTTTTTTCCAGTTCAAATCAGAAGAACTACTTGGCC][TGGTACCAGCAGAAACCAGGGCAGTCCTAAAATACTGATCTAC][TGGGCTT TCACTAGGGAATCT][GGTGTCCCTGACCGCTTCTCAGGCAGTGGATCTGGGACAGATTTTACTCTTACCATCAGCAGTGTGCAAGCTGAAGACCTGGCAGTTTATTACTGT][TATCAATACCTCTCCTCACTCACG][TTCGGTGCTGGGACCAAGCTGGAGGTGAAA] (SEQ ID NO: 430) Mature variable light region: amino acid sequence [FR1]-[CDR1]-[FR2]-[CDR2]-[FR3]-[CDR3]-[FR4] [NIMMTQSPSSLAVSAGEKVTMAC][KSSQSVFSSSNQKNYLA][WYQQKPGQSPKILIY][WAFTRES][GVPDRFSGSGSGTDFTLTISSVQAEDLAVYYC][YQYLSSLT][FGAGTKLEVK] (SEQ ID NO: 431) Mature light chain: amino acid sequence: 17G1_Lc mk NIMMTQSPSSLAVSAGEKVTMACKSSQSVFSSSNQKNYLAWYQQKPGQSPKILIYWAFTRESGVPDRFSGSGSGTDFTLTISSVQAEDLAVYYCYQYLSSLTFGAGTKLEVKADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID NO: 445)

[0335] Example 3. Binding specificity of antibodies that bind anti-PDL1 activatable antibodies This example describes the ability of antibodies of the disclosure to bind the anti-PDL1 activatable antibody PL07-2001-C5H9v2.

[0336] To test the specificity of antibody 17G1 binding to the anti-PDL1 activatable antibody PL07-2001-C5H9v2, 160 ng / mL of the single-arm activated anti-PDL1 activatable antibody PL07-2001-C5H9v2 was spiked into either human plasma (1:100 dilution in PBS) or lung tumor lysate. Briefly, tumor homogenates were prepared in Thermo Scientific Pierce™ IP Lysis Buffer (Cat. No. 87788) with the addition of Thermo Scientific Halt™ Protease Inhibitor Single Unit Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). Anti-id antibody 17G1 was also tested against the same plasma and tumors not spiked with the single-arm activated anti-PDL1 activatable antibody PL07-2001-C5H9v2. Chemiluminescence was measured using an HRP-conjugated anti-mouse secondary antibody in combination with luminol and peroxide. Test samples were then analyzed using the Wes™ capillary electrophoresis immunoassay system (ProteinSimple), where separation was performed by SDS-based electrophoresis, also referred to as the Wes™ system. Figures 2A-2D show the high binding specificity of antibody 17G1 to the anti-PDL1 activatable antibody PL07-2001-C5H9v2 spiked into human plasma (Figure 2C) and lung tumor lysate samples (Figure 2D). Figures 2A and 2B show the background binding of antibody 17G1 in human plasma and lung tumor lysate samples, respectively, in the absence of anti-PDL1 activatable antibody PL07-2001-C5H9v2.

[0337] Example 4. Quantification of activated and intact anti-PDL1 activatable antibodies in biological samples This example describes the ability of anti-id antibody 17G1 to detect activated and intact anti-PDL1 activatable antibody PL07-2001-C5H9v2 in plasma and xenograft tumor samples from mice administered anti-PDL1 activatable antibody PL07-2001-C5H9v2.

[0338] The anti-PDL1 activatable antibody PL07-2001-C5H9v2 is cleaved (activated) by multiple serine proteases and matrix metalloproteinases (MMPs) commonly associated with human tumors (LeBeau et al., Imaging a functional tumorigenic biomarker in the transformed epithelium. Proc Natl Acad Sci 2013; 110:93-98; Overall & Kleifeld, 2006, Validating Matrix Metalloproteinases as Drug Targets and Anti-Targets for Cancer Therapy. Nature Review Cancer, 6, 227-239), and designed to have low activity in blood or normal tissues. To assess and measure activation of the activatable antibody in tumor and plasma samples, the samples were analyzed using the Wes™ system, which allows for the detection of intact anti-PDL1 activatable antibody PL07-2001-C5H9v2 and activated anti-PDL1 activatable antibody PL07-2001-C5H9v2 as described herein. Using this system, it was shown that the activatable antibody remains nearly intact (i.e., inactivated) in the circulation but is activated in mouse xenograft tumors.

[0339] In general, the following protocol was used: Mouse xenograft tumor models were grown in 7-8 week old female nude mice by inoculating 3 x 10 cells in 30 µL serum-free medium containing Matrigel (1:1). 6MDA-MB-231-luc2-4D3LN cells were implanted subcutaneously. Body weight and tumor measurements were recorded twice weekly throughout the study period. Tumor volumes between 200 and 500 mm were recorded. 3 After reaching a tumor size of 100 μg / mL, mice were randomized into three groups of comparable mean tumor volume and administered the anti-PDL1 activatable antibody PL07-2001-C5H9v2. Four days after treatment, tumors and plasma (heparin) were collected and stored at -80°C prior to analysis. Tumor homogenates (i.e., lysates) were prepared in Thermo Scientific Pierce™ IP Lysate Buffer (Cat. No. 87788) with the addition of Thermo Scientific Halt™ Protease Inhibitor Single-Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). Protein lysates at approximately 0.8 mg / mL in IP Lysis Buffer with HALT Protease Inhibitor / EDTA and plasma samples diluted 1:100 in PBS were analyzed using the Wes™ system described herein.

[0340] Sample analysis was performed using the Wes™ capillary electrophoresis platform (ProteinSimple) according to the methods described herein. See the Simple Western Size Assay Development Guide (website proteinsimple.com / documents / 042-889_Rev1_Size_Assay_Development_Guide.pdf). In some embodiments, methods can be used to facilitate separation of intact and activated species using any one or more of the following: altering (e.g., increasing or decreasing) stacking time, altering (e.g., increasing or decreasing) sample time, and / or altering (e.g., increasing or decreasing) separation time.

[0341] Typically, one part (e.g., 1 μL) of 5X fluorescence master mix (ProteinSimple) was combined with four parts (e.g., 4 μL) of lysate in a microcentrifuge tube. Anti-PDL1 activatable antibody PL07-2001-C5H9v2 concentrations ranging from 1 ng to 5 μg were used for antibody screening and characterization. For biological samples, including tumor tissue, 0.8 mg / mL of protein lysate in IP lysis buffer containing HALT protease inhibitor / EDTA was used. Plasma samples were diluted 1:100 in PBS. Primary antibodies were used at a concentration of 1.7 ng / mL (diluted in Antibody Diluent 2 (ProteinSimple catalog number 042-203)). HRP-conjugated mouse secondary antibodies (ProteinSimple) were used neat or in combination with luminol and peroxide, and chemiluminescence was measured. Plates containing samples prepared according to the Simple Western Size Assay Development Guide were centrifuged at 2500 rpm (~1000 xg) for 5 minutes at room temperature and then analyzed on the Wes™ system (ProteinSimple).

[0342] Figures 3A and 3B compare the specific detection of intact anti-PDL1 activatable antibody PL07-2001-C5H9v2 and activated anti-PDL1 activatable antibody PL07-2001-C5H9v2 by the anti-idiotypic antibody 17G1 of the present disclosure and the commercially available anti-human IgG A110UK (cynomolgus monkey-adsorbed goat anti-human IgG) from American Qualex. The anti-id antibody 17G1 of the present disclosure was able to detect the anti-PDL1 activatable antibody PL07-2001-C5H9v2 in the plasma of mice treated with as little as 0.1 mg / kg of the anti-PDL1 activatable antibody PL07-2001-C5H9v2 (Figure 3B), compared to a commercially available human IgG antibody that was only able to minimally detect the anti-PDL1 activatable antibody PL07-2001-C5H9v2 in the plasma of mice treated with 10 mg / kg of the anti-PDL1 activatable antibody PL07-2001-C5H9v2 (Figure 3A).

[0343] Figures 4A and 4B show preferential activation of anti-PDL1 activatable antibody PL07-2001-C5H9v2 in tumor samples versus plasma samples. In this study, MDA-MD-231 xenograft mice were treated with 1 mg / kg of anti-PDL1 activatable antibody PL07-2001-C5H9v2. Tumor and plasma samples were collected on day 4 (96 hours). Tumor homogenate and plasma samples were analyzed using the Wes™ system using anti-id 17G1 antibody for detection. Plasma samples exhibited complete anti-PDL1 activatable antibody PL07-2001-C5H9v2 (Figure 4B), whereas the tumor microenvironment activated at least a portion of anti-PDL1 activatable antibody PL07-2001-C5H9v2 (Figure 4A).

[0344] Example 5. Quantification of activated and intact anti-PDL1 activatable antibodies in biological samples This example demonstrates that the method of the present invention can be applied to different heterogeneous tumor types and different administration concentrations.

[0345] Briefly, mouse xenograft tumor models were established by injecting 5x10 cells in 100µL serum-free medium into 7-8 week old female nude mice. 6 The mice were developed by SC transplantation of SAS cells. Body weight and tumor measurements were recorded twice weekly throughout the study period. Tumor volumes between 450 and 550 mm were measured. 3After reaching a tumor size of 100 μg / mL, mice were randomized into three groups of comparable mean tumor volume and administered 0.1 mg / kg of the anti-PDL1 activatable antibody PL07-2001-C5H9v2. Four days after treatment, tumor and plasma (heparin) samples were collected and stored at -80°C prior to analysis. Tumor homogenates (i.e., lysates) were prepared in Thermo Scientific Pierce™ IP Lysate Buffer (Cat. No. 87788) with the addition of Thermo Scientific Halt™ Protease Inhibitor Single-Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). Protein lysates at approximately 0.8 mg / mL in IP Lysis Buffer with HALT Protease Inhibitor / EDTA, and plasma samples diluted 1:250 in PBS, were analyzed according to the method of the present invention using the Wes™ system and the 17G1 antibody for detection. Chemiluminescence was measured using an HRP-conjugated anti-mouse secondary antibody in combination with luminol and peroxide. Figures 5A and 5B show preferential activation of activatable antibody therapeutics in tumor versus plasma samples.

[0346] Example 6. Quantification of activated and intact anti-CD166 activatable antibodies in biological samples This example describes the ability to detect activated anti-CD166 activatable antibody 7614.6-3001-HuCD166 and intact anti-CD166 activatable antibody 7614.6-3001-HuCD166 in plasma samples and xenograft tumor samples from mice administered 7614.6-3001-HuCD166.

[0347] The work presented herein used an anti-CD166 activatable antibody, also referred to herein as 7614.6-3001-HuCD166, which is also referred to as HuCD166-7614.6-3001 and comprises the heavy chain sequence of SEQ ID NO: 432 and the light chain sequence of SEQ ID NO: 433, as shown below. Anti-CD166 activatable antibody sequence: Heavy chain amino acid sequence QITLKESGPTLVKPTQTLTLTCTFSGFSLSTYGMGVGWIRQPPGKALEWLANIWWSEDKHYSPSLKSRLTITKDTSKNQVVLTITNVDPVDTATYYCVQIDYGNDYAFTYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 432) Light chain amino acid sequence LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 433)

[0348] Quantification of activated and intact anti-CD166 activatable antibody 7614.6-3001-HuCD166 was assessed using an anti-human IgG antibody (anti-human IgG (H&L), American Qualex catalog number A110UK) with the Wes™ system. Nude mice were subcutaneously implanted with 5x10e6 H292 cells in serum-free medium mixed 1:1 with Matrigel™. Mice bearing 200-500mm2 H292 xenografts were administered 5mpk of anti-CD166 activatable antibody 7614.6-3001-HuCD166. One day after treatment, tumors and plasma (heparin) were collected and stored at -80°C prior to analysis. Tumor homogenates were prepared in Thermo Scientific Pierce™ IP Lysis Buffer (Cat. No. 87788) with the addition of Thermo Scientific Halt™ Protease Inhibitor Single-Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). Protein lysates at 1 mg / mL in IP Lysis Buffer with HALT Protease Inhibitor / EDTA and plasma samples diluted 1:20 in PBS were analyzed by Wes™ as described herein. Chemiluminescence was measured using an HRP-conjugated anti-mouse secondary antibody in combination with luminol and peroxide. Figures 6A and 6B demonstrate preferential activation in tumor (Figure 6B) compared to plasma (Figure 6A).

[0349] Example 7. Quantification of activated and intact anti-EGFR activatable antibodies in biological samples This example describes the ability to detect activated anti-EGFR activatable antibodies 3954-2001-C225v5 and 3954-3001-C225v5, and intact anti-EGFR activatable antibodies 3954-2001-C225v5 and 3954-3001-C225v5 in plasma samples and xenograft tumor samples from mice administered anti-EGFR activatable antibodies 3954-2001-C225v5 or 3954-3001-C225v5.

[0350] The work presented herein used anti-EGFR activatable antibodies designated herein as 3954-2001-C225v5 and 3954-3001-C225v5. Anti-EGFR activatable antibody 3954-2001-C225v5 comprises the C225v5 heavy chain amino acid sequence of SEQ ID NO:446, as shown below, and a light chain comprising a masking portion comprising the amino acid sequence CISPRGCPDGPYVMY (SEQ ID NO:448), a cleavable portion comprising the amino acid sequence ISSGLLSGRSDNH (SEQ ID NO:406), and the C225v5 light chain antibody sequence comprising SEQ ID NO:447, as shown below. Anti-EGFR activatable antibody 3954-3001-C225v5 comprises the heavy chain sequence of SEQ ID NO: 446 shown below, and a light chain comprising a masking portion comprising the amino acid sequence CISPRGCPDGPYVMY (SEQ ID NO: 448), a cleavable portion comprising the amino acid sequence AVGLLAPPGGLSGRSDNH (SEQ ID NO: 412), and the light chain sequence of SEQ ID NO: 447 shown below. Amino acid sequence of C225v5 heavy chain antibody: [ka] Amino acid sequence of the C225v5 light chain antibody: QILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 447)

[0351] Quantification of activated anti-EGFR activatable antibodies 3954-2001-C225v5 and 3954-3001-C225v5 and intact anti-EGFR activatable antibodies 3954-2001-C225v5 and 3954-3001-C225v5 was assessed by the Wes™ system using an anti-human IgG antibody (anti-human IgG (H&L), American Qualex catalog number A110UK). Nude mice were subcutaneously implanted with 5x10e6 H292 cells in serum-free medium mixed 1:1 with Matrigel™. Mice bearing 200-500mm2 H292 xenografts were administered 25mg / kg of 3954-2001-C225v5 or 3954-3001-C225v5. Tumors and plasma (heparin) were collected 4 days after treatment and stored at -80°C until analysis. Tumor homogenates were prepared in Thermo Scientific Pierce™ IP Lysate Buffer (Cat. No. 87788) with the addition of Thermo Scientific Halt™ Protease Inhibitor Single-Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). Protein lysates at approximately 0.4 mg / mL in IP Lysis Buffer with HALT Protease Inhibitor / EDTA, and plasma samples diluted 1:500 in PBS, were analyzed using the Wes™ System described herein. Chemiluminescence was measured using an HRP-conjugated anti-goat secondary antibody in combination with luminol and peroxide. Figures 7A and 7B demonstrate preferential activation in tumors (Figure 7B) compared to plasma (Figure 7A).

[0352] Example 8. Quantification of activated and intact anti-CD71 activatable antibodies in biological samples This example describes the ability to detect activated anti-CD71 activatable antibody TF02.13-2011-21.12 and the complete anti-CD71 activatable antibody TF02.13-2011-21.12.

[0353] The studies presented herein used an anti-CD71 activatable antibody designated herein as TF02.13-2011-21.12 (also designated 21.12-TF02.13-2011 and huCD71-TF02.13-2011), which comprises the heavy chain sequence of SEQ ID NO: 434 and the light chain sequence of SEQ ID NO: 435, as shown below. Anti-CD71 activatable antibody sequence: Heavy chain amino acid sequence QVQLVQSGAEVKKPGASVKMSCKASGYTFTSYWMHWVRQAPGQGLEWIGAIYPGNSETGYAQKFQGRATLTADTSTSTAYMELSSLRSEDTAVYYCTRENWDPGFAFWGQGTLI TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 434) Light chain amino acid sequence NLCTEHSAALDCRSYGGGSSGGSISSGLLSGRSDNPGGGSDIQMTQSPSSLSASVGDRVTITCSASSSVYYMYWFQQKPGKAPKLWIYSTSNLASGVPSRFSGSGSGTDYTLTISSMQPEDFATYYCQQRRNYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 435)

[0354] Anti-CD71 activatable antibody TF02.13-2011-21.12 was activated overnight at 37°C with 200 nM matriptase (R&D Systems catalog number 3946-SE) and mixed with intact anti-CD71 activatable antibody TF02.13-2011-21.12 in human plasma (bioreclaimation). The mixture was then analyzed by the Wes™ system described herein using supernatants from hybridoma clones derived from mice immunized with a peptide containing CDR1 and CDR3 of the light chain of anti-CD71 activatable antibody TF02.13-2011-21.12, which specifically recognizes anti-CD71 activatable antibody TF02.13-2011-21.12. Chemiluminescence was measured using an HRP-conjugated anti-mouse secondary antibody in combination with luminol and peroxide. FIG. 8 shows the ability to separate pre-activated from intact anti-CD71 activatable antibody TF02.13-2011-21.12 in plasma.

[0355] Example 9. Quantification of activated and intact anti-PD1 activatable antibodies This example describes the ability to detect activating anti-PD1 activatable antibody PD34-2011-A1.5 hIgG4 S228P and the intact anti-PD1 activatable antibody PD34-2011-A1.5 hIgG4 S228P.

[0356] The studies presented herein used an anti-PD1 activatable antibody designated herein as PD34-2011-A1.5 hIgG4 S228P (also designated A1.5-PD34-2011 and 1.5-PD34-2011), which comprises the heavy chain sequence of SEQ ID NO: 436 and the light chain sequence of SEQ ID NO: 437, as shown below. Anti-CD71 activatable antibody sequence: Heavy chain amino acid sequence evqlvesggglvqpggslrlscaasgftfsgyamswvrqapgkglewvayisnsggnahyadsvkgrftisrdnskntlylqmnslraedtavyyctredygtspfvywgqgt lvtvssastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtktytcnvdhkpsntkvdkrveskygppcpp cpapeflggpsvflfppkpkdtlmisrtpevtcvvvdvsqedpevqfnwyvdgvevhnaktkpreeqfnstyrvvsvltvlhqdwlngkeykckvsnkglpssiektiskakgqprepqvytlppsqeemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysrltvdksrwqegnvfscsvmhealhnhytqkslslslgK (SEQ ID NO: 436) Light chain amino acid sequence tsycsiehypcnthhgggssggsissgllsgrsdnPgggsdiqltqspsslsasvgdrvtitcrasesvdaygisfmnwfqqkpgkapklliyaasnqgsgvpsrfsgsgsgtdftltissmqpedfatyycqqskdvpwtfgqgtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec (SEQ ID NO: 437)

[0357] The anti-PD1 activatable antibody PD34-2011-A1.5 hIgG4 S228P was activated with 200 nM MMP14 (R&D Systems catalog number 918-MP) overnight at 37°C and mixed with intact anti-PD1 activatable antibody PD34-2011-A1.5 hIgG4 S228P. The mixture was then analyzed using anti-human IgG (H&L) (American Qualex catalog number A110UK) on the Wes™ system (ProteinSimple) described herein. Chemiluminescence was measured using an HRP-conjugated anti-goat secondary antibody in combination with luminol and peroxide. Figure 9 shows the ability to separate intact anti-PD1 activatable antibody PD34-2011-A1.5 hIgG4 S228P from the corresponding activated (cleaved) activatable antibody.

[0358] Example 10. Quantification of activated and intact anti-CD166-binding activatable antibodies This example describes the ability to detect activated anti-CD166 activatable antibody 7614.6-3001-HuCD166 and intact anti-CD166 activatable antibody 7614.6-3001-HuCD166 linked to the maytansinoid toxin DM4 via an SPDB linker.

[0359] The studies presented herein used a DM4-linked activatable antibody of the anti-CD166 activatable antibody designated herein as 7614.6-3001-HuCD166 (also designated HuCD166-7614.6-3001), which comprises the heavy chain sequence of SEQ ID NO: 432 and the light chain sequence of SEQ ID NO: 433, as shown below. Anti-CD166 activatable antibody sequence: Heavy chain amino acid sequence QITLKESGPTLVKPTQTLTLTCTFSGFSLSTYGMGVGWIRQPPGKALEWLANIWWSEDKHYSPSLKSRLTITKDTSKNQVVLTITNVDPVDTATYYCVQIDYGNDYAFTYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 432) Light chain amino acid sequence LCHPAVLSAWESCSSGGGSSGGSAVGLLAPPGGLSGRSDNHGGSDIVMTQSPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 433)

[0360] Anti-CD166-conjugated activating antibodies were activated with 80 μg / ml matriptase (R&D Systems catalog no. 3946-SE) or 80 μg / ml MMP14 (R&D Systems catalog no. 918-MP) for 2 hours at 37°C and mixed with intact conjugated activatable antibodies. The mixtures were then analyzed on the Wes™ system described above using anti-human IgG (H&L) (American Qualex catalog no. A110UK). Chemiluminescence was measured using an HRP-conjugated anti-goat secondary antibody in combination with luminol and peroxide. Figures 10A and 10B show the ability to separate matriptase-activated (Figure 10A) or MMP14-activated (Figure 10B) conjugated activating antibodies from intact conjugated activatable antibodies.

[0361] Example 11. Tertiary Detection Protocol Signals associated with (intact) activatable antibodies and / or activated (cleaved) activatable antibodies can be amplified using additional antibody detection steps. In this protocol, a secondary antibody not conjugated to horseradish peroxidase (HRP) is used to detect the primary antibody, and a tertiary detection antibody conjugated to HRP is used to amplify the signal. In this example, activatable anti-CD166, 7614.6-3001-HuCD166, was probed with anti-id antibody clone 22B8 (not conjugated to HRP) followed by biotinylated anti-rat IgG Fcγ (Jackson Immunology 112-035-008), then detected with streptavidin-HRP (043-459-2) (i.e., an example of a tertiary detection protocol) or clone 22B8 followed by HRP-conjugated anti-rat IgG Fcγ (Jackson Immunology 112-065-008) (i.e., an example of a two-step protocol). Chemiluminescence was measured using luminol and peroxide reagents. Nude mice were subcutaneously implanted with H292 cells in serum-free medium mixed 1:1 with Matrigel™. Mice bearing H292 xenografts were treated with 5 mg / kg of 7614.6-3001-HuCD166. Tissues were collected on day 4 post-administration. Tumor homogenates were prepared in Thermo Scientific Pierce™ IP Lysis Buffer (Cat. No. 87788) supplemented with Thermo Scientific Halt™ Protease Inhibitor Single-Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). 1.5 mg / mL of protein was analyzed on a Wes™ capillary electrophoresis immunoassay system as described herein.

[0362] Figure 11A shows the magnitude of the chemiluminescent signal associated with molecular species with different molecular weights in a biological sample using a two-step detection protocol. The plot shows the peaks detected for the activated activatable antibody (the cleavage product of 7614.6-3001-HuCD166) and for the intact / activated activatable antibody (intact 7614.6-3001-HuCD166). Figure 11B shows the magnitude of the chemiluminescent signal associated with molecular species with different molecular weights in a biological sample using a tertiary detection protocol. The use of the tertiary detection protocol resulted in much larger signals for both 7614.6-3001-HuCD166 (intact activatable antibody) and its cleavage product (activated activatable antibody). These results demonstrate the amplification of the signal obtained using the tertiary protocol compared to that obtained using the two-step protocol, which facilitates the detection of each species.

[0363] Example 12. Quantification of activated and intact anti-Jagged activatable antibodies in biological samples This example describes the ability to detect activated and intact anti-Jagged activatable antibody 5342-3001-4D11 in tumor samples from mice administered anti-Jagged activatable antibody 5342-3001-4D11.

[0364] The work presented herein used an anti-Jagged activatable antibody designated herein as 5342-3001-4D11. Anti-Jagged activatable antibody 5342-3001-4D11 comprises the heavy chain sequence of SEQ ID NO: 950 and the light chain sequence of SEQ ID NO: 951. Both sets of sequences are shown below: 4D11-heavy chain: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSSIDPEGRQTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDIGGRSAFDYWGQG TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT HTCPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* (Sequence number NO950) 4D11-5342-8504-light chain QGQSGQCNIWLVGGDCRGWQGGSSGGSGGSGGAVGLLAPPGGLSGRSDNHGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTVVAPPLFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (SEQ ID NO: 951)

[0365] Quantification of activated anti-Jagged activatable antibody 5342-3001-4D11 and intact anti-Jagged activatable antibody 5342-3001-4D11 was assessed according to the method of the present invention using the Wes™ system (Protein Simple, and anti-human IgG antibody (anti-human IgG (H&L), American Qualex catalog number A110UK). Nude mice were subcutaneously implanted with BxPC3 cells in serum-free medium mixed 1:1 with Matrigel™ at 200-500 mm. 2 Mice bearing BxPC3 xenografts were administered 10 mg / kg of 5342-3001-4D11. Tumor tissues were collected 4 days after treatment and stored at -80°C until analysis. Tumor homogenates were prepared in Thermo Scientific Pierce™ IP Lysis Buffer (Cat. No. 87788) with the addition of Thermo Scientific Halt™ Protease Inhibitor Single-Use Cocktail Kit (Cat. No. 78430) using a barocycler (Pressure Biosciences). Protein lysates at 1.5 mg / mL in IP Lysis Buffer with HALT Protease Inhibitor / EDTA and plasma samples diluted 1:100 in PBS were analyzed on the Wes™ System. Chemiluminescence was measured using an HRP-conjugated anti-goat secondary antibody in combination with luminol and peroxide. FIG. 12 shows the chemiluminescent signal detected for each species, thus demonstrating the detection of activation of the 5342-3001-4D11 anti-Jagged activatable antibody in tumor tissue.

[0366] Example 13. Quantification of activated and intact anti-PDL1 activatable antibodies in biological samples using a standard curve This example demonstrates a protocol for quantifying intact and activated activatable antibody in a biological sample by generating and using a standard curve.

[0367] Tumor lysate or plasma samples suspected of containing activatable antibody and / or activated activatable antibody are prepared. These samples are assayed using the Wes™ system (ProteinSimple) as described herein, and the results are compared to standard curves of purified recombinant fully activated antibody PL07-2001-C5H9v2 and the corresponding activated antibody. The concentrations of activatable antibody and activated activatable antibody are determined using the standard curves.

[0368] Plasma is diluted from 1:10 to 1:100, and tumor lysate is diluted from 1:1 to 1:10. Capillaries are prepared for standard curve material, and electrophoresis and immunoblotting are performed in parallel with the biological samples. Standard curve samples are prepared using either (1) pooled normal K2-EDTA plasma (see below) for plasma samples or (2) Pierce IP Lysis Buffer (see below). The set of capillaries used for the standard curve contains intact and activated activatable antibodies at the same dilutions as those used to test the samples. Pooled normal donor K2-EDTA plasma (Bioreclamation) is used to generate the standard curve for the plasma samples.

[0369] K2-EDTA plasma from seven human donors was collected and combined in equal volumes to create a normal donor pool. Samples from one subject were not included in the pool due to the milky appearance of the plasma. Tumor lysates were prepared.

[0370] Materials: 10.7 mg / ml intact activatable antibody PL07-2001-C5H9v2, buffer: 8% sucrose, 30 mM NaCl, 0.02% Tween 80, 25 mM succinate pH 6; corresponding activated activatable antibody 11.35 mg / ml, PBS buffer, pH 7.2.

[0371] Dilution series, including one zero / blank sample per curve, were prepared starting from 17,500 ng / ml down to 8 ng / ml (in three-fold increments) in a full-skirt PCR plate (Axygen PCR96FSC; approximately 100 μl well) or a 450 μl V-bottom plate (Axygen P-96-450V-CS; approximately 500 μl well), depending on the volume. Dilutions were stored on ice before loading into a Wes™ system capillary cartridge (ProteinSimple). Anti-id antibody 17G1 (1.3 mg / ml) (see Example 2) was used as the primary antibody at a dilution of 1:1200. Anti-mouse secondary antibody-HRP (naive, ProteinSimple), 10 μl / well, as specified in the vendor's plate layout (part number 042-205).

[0372] Once the samples were prepared and the Wes™ cartridge (ProteinSimple) was loaded with the reagents required for the assay, the samples (biological samples (four replicates) and samples for the standard curve (two replicates, including two zeros / blanks) as well as the biotinylated molecular weight standards from the Wes™ kit (ProteinSimple) were loaded onto the Wes™ cartridge (ProteinSimple).

[0373] The Wes™ system was operated according to the manufacturer's instructions. These results showed that the samples resolved into intact (approximately 38 kD) or "activated" (approximately 35 kD) peaks on the Wes™ platform. The intact and active peaks were then quantified against standard curves prepared for the intact activatable antibody PL07-2001-C5H9v2 and the corresponding activated antibody, and the respective concentrations were determined in ng / ml.

[0374] Other embodiments While the present invention has been described in conjunction with its detailed description, the above description is illustrative, not limiting, of the scope of the invention, which is defined by the appended claims. Other aspects, advantages, and modifications are within the scope of the following.

Claims

1. 1. A method for quantifying the activation level of an activatable antibody, comprising: i) contacting the loaded capillary or population of loaded capillaries with a biological sample containing one or more components selected from the group consisting of uncleaved activatable antibodies, cleaved activated antibodies, and combinations thereof; the uncleaved activatable antibody comprises an antibody or antigen-binding fragment thereof (AB) that specifically binds a target, a masking moiety (MM) linked to the AB, and a cleavable moiety (CM) linked to the AB; the MM inhibits binding of the AB to the target; the CM is a polypeptide that functions as a substrate for a protease; protease cleavage of the substrate to generate the cleaved activated antibody; the biological sample is isolated from a subject with cancer or the biological sample is derived from a sample isolated from a subject with cancer; contacting said loaded capillary or population of loaded capillaries pre-loaded with a lamination matrix and a separation matrix; ii) separating in each capillary one or more high molecular weight (MW) components of the biological sample from one or more low molecular weight (MW) components of the biological sample, wherein at least one high MW component comprises an uncleaved activatable antibody and at least one low MW component comprises a cleaved activated antibody; iii) immobilizing the one or more high MW components and the one or more low MW components in each capillary; iv) immunoprobing each capillary with at least a first reagent specific to at least one activatable antibody, said first reagent comprising an anti-idiotypic antibody or antigen-binding fragment thereof; When the MM and CM are attached to a heavy chain, the anti-idiotype antibody or antigen-binding fragment thereof binds to the variable heavy chain region of the uncleaved activatable antibody and the variable heavy chain region of the cleaved activated antibody; immunoprobing, wherein the anti-idiotypic antibody or antigen-binding fragment thereof binds to the variable light chain region of the uncleaved activatable antibody and the variable light chain region of the cleaved activated antibody when the MM and CM are attached to the light chain; and v) detecting and quantifying the level of said first reagent in each capillary or population of capillaries to determine the relative levels of cleaved activated antibody and uncleaved activatable antibody in each capillary or population of capillaries, thereby determining the activation level of activatable antibody. A method comprising:

2. 2. The method of claim 1, further comprising, prior to step i), loading at least one capillary or population of capillaries with a stacking matrix and a separation matrix to create at least one loaded capillary or population of loaded capillaries.

3. 10. The method of claim 1, wherein the separating step is carried out for a separation time of at least 35 minutes, or at least 36 minutes, or at least 37 minutes, or at least 38 minutes.

4. 4. The method of claim 1, wherein step iii) comprises immobilizing the one or more high MW components and the one or more low MW components of the biological sample using UV light.

5. 5. The method of any one of claims 1 to 4, wherein the activatable antibody is selected from the group consisting of a conjugated activatable antibody, a multispecific activatable antibody, and a conjugated multispecific activatable antibody.

6. The method of any one of claims 1 to 5, wherein the first reagent is a detectable reagent.

7. The method of any one of claims 1 to 5, wherein step iv) further comprises loading each capillary with a second reagent that specifically binds to the first reagent.

8. The method of claim 7 , wherein the second reagent comprises a secondary antibody.

9. The method of claim 7 , wherein the second reagent comprises a detectable label.

10. The method of claim 8 , wherein the second reagent comprises a secondary antibody conjugated to a detectable label.

11. The method of claim 10, wherein the detectable label is a fluorescent label.

12. 11. The method of claim 10, wherein the detectable label is a reporter enzyme selected from the group consisting of horseradish peroxidase (HRP) and alkaline phosphatase.

13. 13. The method of claim 12, wherein the reporter enzyme is horseradish peroxidase.

14. The method of claim 8 , wherein the secondary antibody is not conjugated to a detectable label.

15. 15. The method of claim 14, wherein the secondary antibody is bound to a first binding tag of a pair of a first binding tag and a second binding tag, and the first binding tag is capable of binding to the second binding tag.

16. 16. The method of claim 15, wherein step iv) further comprises loading each capillary with a third reagent that specifically binds to the second reagent.

17. 17. The method of claim 16, wherein the third reagent comprises a reporter enzyme attached to the second binding tag.

18. 18. The method of claim 17, wherein the reporter enzyme is selected from the group consisting of horseradish peroxidase and alkaline phosphatase.

19. 19. The method of claim 17 or 18, wherein the first binding tag and the second binding tag are selected from the group consisting of biotin and streptavidin, streptavidin and biotin, biotin and avidin, and avidin and biotin, respectively.

20. 20. The method of claim 19, wherein the second reagent is a secondary antibody conjugated to biotin, and the third reagent is a reporter enzyme conjugated to streptavidin.

21. 20. The method of claim 19, wherein the second reagent is a secondary antibody conjugated to streptavidin, and the third reagent is a reporter enzyme conjugated to biotin.

22. The method of any one of claims 17 to 21, wherein the reporter enzyme is selected from the group consisting of horseradish peroxidase and alkaline phosphatase.

23. 17. The method of claim 16, wherein the third reagent comprises a detectable tertiary antibody.

24. The method of any one of claims 1 to 23, wherein step iv) further comprises loading each capillary with a substrate selected from the group consisting of chemiluminescent and colorimetric substrates.

25. 25. The method of claim 24, wherein the substrate is a chemiluminescent substrate and step v) comprises detecting the level of chemiluminescence in each capillary or population of capillaries.

26. 26. The method of claim 25, wherein the chemiluminescent substrate is luminol and step iv) further comprises loading each capillary with peroxide.

27. 27. The method of any one of claims 1 to 26, wherein step i) comprises loading 1 to 500 ng of biological sample.

28. 28. The method of claim 27, wherein step i) comprises loading 5 to 40 ng of biological sample.

29. 29. The method of any one of claims 1 to 28, wherein the biological sample is prepared with one or more SDS-containing buffers in an amount sufficient to provide molecular weight separation.

30. The method according to any one of claims 1 to 29, wherein the biological sample is a body fluid.

31. 31. The method of claim 30, wherein the bodily fluid is selected from the group consisting of blood, plasma, and serum.

32. The method according to any one of claims 1 to 29, wherein the biological sample is diseased tissue.

33. 33. The method of claim 32, wherein the diseased tissue is a lysate.

34. 33. The method of claim 32, wherein the diseased tissue is tumor tissue.

35. 2. The method of claim 1, wherein the uncleaved activatable antibody has the following structure from N-terminus to C-terminus: MM-CM-AB or AB-CM-MM.

36. 36. The method of claim 35, wherein the AB is directly linked to the CM, the CM is directly linked to the AB, or both.

37. 36. The method of claim 35, wherein the AB is linked to the CM via a connecting peptide, the CM is linked to the MM via a connecting peptide, or both.

38. 36. The method of claim 35, wherein the uncleaved activatable antibody comprises a first connecting peptide (LP1) and a second connecting peptide (LP2), and wherein the uncleaved activatable antibody has the following structural arrangement from N-terminus to C-terminus: MM-LP1-CM-LP2-AB or AB-LP2-CM-LP1-MM.

39. 39. The method of claim 38, wherein the two connecting peptides do not have to be identical to each other.

40. 39. The method of claim 38, wherein LP1 and LP2 are each peptides of about 1 to 20 amino acids in length.

Citation Information

Patent Citations

  • IgA ANTIBODY MEASURING METHOD

    JP2009031001A

  • Method and device for analyte detection

    JP2011209301A

  • Activatable antibody that binds epidermal growth factor receptor and method of using the same

    JP2015516813A

  • Method for detection of molecular species in a crude sample using capillary electrophoresis

    US20040259269A1

  • Methods. apparatus and systems for detection of total protein using capillary electrophoresis

    US20150093757A1