Bacteria-binding peptides for the treatment of infectious diseases and associated inflammatory processes

Abstract

The present invention relates to the field of medicine and provides pharmaceutical compositions comprising one or more isolated amino acid sequences comprising or consisting solely of SEQ ID NO: 3 and / or SEQ ID NO: 1 and / or SEQ ID NO: 2, kits and conjugates comprising one or more of the aforementioned amino acid sequences. Furthermore, the present invention relates to the use of the pharmaceutical compositions, kits and conjugates of the present invention as medicaments, in particular in the treatment of infectious diseases or inflammatory conditions associated with infectious diseases or inflammatory diseases associated with the presence of products derived from infectious pathogens. The present invention also provides a device for selectively binding and separating at least one component from an aqueous solution, the device comprising one or more of the aforementioned amino acid sequences. [Selection diagram] None

Description

[Technical Field]

[0001] The present invention relates to the field of medicine, in particular to bacteria-binding peptides of the scavenger-like human CD6 lymphocyte receptor that are useful in the therapeutic and / or prophylactic treatment of infectious diseases and associated inflammatory conditions, and to devices containing said peptides. [Background technology]

[0002] Sepsis is a life-threatening condition caused by a host response to an infectious pathogen, most commonly bacteria, but also fungi, viruses, or parasites. Sepsis is considered a dysregulated systemic inflammatory response syndrome (SIRS) triggered by infection, resulting in a severe and persistent pro-inflammatory state. The immune system's inability to control this response can lead to multiple organ dysfunction (MOD) and cardiovascular collapse (septic shock), which, if unresolved, can lead to death (Non-Patent Document 1). This dysfunctional host inflammatory response is triggered by conserved structures present on microbial cell walls called pathogen-associated molecular patterns (PAMPs). PAMPs are essential compounds for microbial physiology, including LPS from Gram-negative (G-) bacteria, lipoteichoic acid (LTA) and peptidoglycan (PGN) from Gram-positive (G+) bacteria, β-glucan and mannan from fungi, and single-stranded / double-stranded nucleic acids from viruses (Non-Patent Document 2).

[0003] Sepsis can have many causes but is usually precipitated by an undiagnosed and / or untreated localized infection (e.g., pneumonia or peritonitis) that is spontaneous or the result of trauma, surgery, burns, or induced by a debilitating condition such as cancer or AIDS. Sepsis usually begins with shivering, fever, low blood pressure (septic shock), rapid breathing, a high heart rate, and skin lesions. Within hours, sepsis can cause spontaneous clotting in blood vessels, severe hypotension, multiple organ failure, shock, gangrene, and ultimately death.

[0004] The detection of PAMPs is achieved by germline-encoded, clonally unselected, and non-polymorphic pattern recognition receptors (PRRs) present on immune cells. PRRs belong to various structural and functional protein receptor families (e.g., Toll-like receptors, scavenger receptors, or C-type lectins) and contribute not only to pathogen detection but also to the assembly and regulation of innate and adaptive immune responses (Non-Patent Document 3).

[0005] The scavenger receptor cysteine-rich superfamily (SRCR-SF) is an ancient and highly conserved group of protein receptors characterized by the presence of one or several repeats of a 90-110 amino acid-long cysteine-rich globular domain (Non-Patent Document 4). In mammals, SRCR-SF members are expressed by hematopoietic and non-hematopoietic cells, where they exhibit multiple functions. Although no unified role has been identified for all SRCR-SF members, some of them function as PRRs. Such groups include macrophage (SR-AI, MARCO, CD163, and Spα), epithelial (SCARA5, DMBT1, and S5D-SRCRB), and lymphocyte (CD5 and CD6) receptors (Non-Patent Document 5).

[0006] Even today, sepsis, severe sepsis, and septic shock remain unmet clinical needs, with projected increased incidence and enormous socioeconomic burden as a result of an aging population, increased invasive medical procedures, the emergence of multidrug-resistant (MDR) bacteria, and an increasing prevalence of chronic diseases (Non-Patent Document 6). Overall mortality from sepsis and septic shock remains high (35% and 60%, respectively) despite significant advances in supportive care and the availability of powerful broad-spectrum antibiotics.

[0007] Although antibiotics constitute an essential part of the treatment of sepsis, they are likely insufficient to substantially reduce the mortality associated with severe sepsis and septic shock-related MOD, especially considering the rise of MDR bacteria. Therefore, there is an urgent need for innovative development of cost-effective biological treatments and / or medical devices that can replace or complement antibiotics and supportive care.

[0008] Adjunctive / alternative therapies to antibiotics include host-targeted approaches aimed at enhancing innate defense mechanisms and / or reversing immune cell dysfunction associated with sepsis mortality (Non-Patent Document 1). Neutralization of pathogenic microbial factors by endogenous host immune components is one such approach. In this regard, some members of the scavenger receptor cysteine-rich superfamily (SRCR-SF) interact with PAMPs derived from both Gram-negative (lipopolysaccharide (LPS)) and Gram-positive (lipoteichoic acid (LTA) and peptidoglycan (PGN)) bacteria (Non-Patent Document 5).

[0009] The prototypical member of the SRCR-SF that exhibits bacterial PAMP-binding properties is DMBT-1 (Deleted in Malignant Brain Tumors-1), also known as SAG (Salivary Agglutinin) or gp340 (Non-Patent Document 7, Non-Patent Document 8). DMBT-1 / SAG is a soluble glycoprotein containing 14 SRCRs, one zona pellucida, and two C1r / C1s Uegf Bmp1 domains. The bacterial-binding properties of DMBT-1 / SAG have been precisely mapped to an 11-mer consensus peptide sequence (DMBT-1 / SAG.pbs1, GRVEVLYRGSW) within its SRCR domain, and a 9-mer motif (VEVLxxxxW) present in 13 of 14 of the 11-mer consensus peptides was identified (Non-Patent Document 9).

[0010] Other SRCR-SF members with bacteria-binding properties include class A macrophage scavenger receptor type I (Non-Patent Document 12), collagenous macrophage receptor (MARCO) (Non-Patent Document 10), soluble protein α (Spα) (Non-Patent Document 13), CD6 (Non-Patent Document 14), CD163 (Non-Patent Document 11), scavenger receptor class A member 5 (Non-Patent Document 15), and five-domain soluble scavenger receptor cysteine-rich group B member (Non-Patent Document 16, Non-Patent Document 17), even though only the bacteria-binding regions of MARCO (Non-Patent Document 10) and CD163 (Non-Patent Document 11) have been functionally mapped.

[0011] CD6 is a lymphocyte surface receptor highly homologous to CD5, another lymphocytic member of the SRCR-SF. Both receptors are thought to have been derived by duplication from a common ancestral gene (NPL 18) and are expressed primarily by T cells and the B1a cell subset involved in the production of natural antibodies. CD6 and CD5 share a similar extracellular region composed of three tandem SRCR domains and a cytoplasmic tail suitable for signal transduction. Indeed, CD6 and CD5 are physically associated with the T cell receptor (TCR) complex (NPL 19) and play a relevant role in regulating T cell development and activation processes (NPL 20, NPL 21). The binding of rshCD6 to bacterial PAMPs such as LPS, LTA, or PGN has a K in the nM range, similar to the binding affinity of CD14 for the same PAMPs. d This occurs through affinity (Non-Patent Document 22, Non-Patent Document 23). Furthermore, rshCD6 down-regulates the release of inflammatory cytokines (IL-1β, IL-6, TNF-α) induced by LPS or LTA / PGN (Non-Patent Document 24).

[0012] Prophylactic infusion of a recombinant soluble form of human CD6 (rshCD6) significantly reduces mortality and serum levels of pro-inflammatory cytokines (IL-1β, IL-6, and TNF-α) in mouse models of septic shock induced by endotoxins from G+ and G- bacteria (LTA+PGN and LPS, respectively), live whole bacteria (S. aureus, Acinetobacter baumannii) regardless of MDR phenotype (methicillin-resistant Staphylococcus aureus, colistin-resistant Acinetobacter baumannii), and monomicrobial and polymicrobial models of peritonitis (Non-Patent Document 25, Non-Patent Document 24, Non-Patent Document 14).

[0013] Patent document 1 discloses that intraperitoneal (ip) administration of rshCD6 counteracts the lethal effect caused by LPS-induced septic shock in mice, and that CD6 has therapeutic potential for intervention in septic shock syndrome and other inflammatory diseases associated with infections. [Prior art documents] [Patent documents]

[0014] [Patent Document 1] European Patent No. 2143436 [Non-patent literature]

[0015] [Non-Patent Document 1] Delano MJ and Ward PA, 2016, Sepsis-induced immune dysfunction: can immune therapies reduce mortality? J Clin Invest 126:23-31 [Non-patent document 2] Janeway CA and Medzhitov R, 2002, Innate immune recognition, Annu Rev Immunol 20:197-216 [Non-patent document 3] Palm NW and Medzhitov R, 2009, Pattern recognition receptors and control of adaptive immunity, Immunol Rev 227:221-33 [Non-patent document 4] Sarrias MR et al., 2004, The Scavenger Receptor Cysteine-Rich (SRCR) Domain: An Ancient and Highly Conserved Protein Module of the Innate Immune System, Crit Rev Immunol 24:1-38 [Non-patent document 5] Martinez VG et al., 2011, The conserved scavenger receptor cysteine-rich superfamily in therapy and diagnosis, Pharmacol Rev 63:967-1000 [Non-patent document 6] Okeke EB and Uzonna JE, 2016, In Search of a Cure for Sepsis: Taming the Monster in Critical Care Medicine, J Innate Immun 8:156-70 [Non-Patent Document 7] Ligtenberg AJM, et al., 2010, Deleted in malignant brain tumors-1 protein (DMBT1): a pattern recognition receptor with multiple binding sites, Int J Mol Sci 11:5212-33 [Non-patent document 8] Madsen J, et al., 2010, Gp-340 / DMBT1 in mucosal innate immunity, Innate Immun 16:160-7 [Non-Patent Document 9] Bikker FJ, et al., 2004, Bacteria binding by DMBT1 / SAG / gp-340 is confined to the VEVLXXXXW motif in its scavenger receptor cysteine-rich domains. J Biol Chem 279:47699-703 [Non-Patent Document 10] Braennstroem A, et al., 2002, Arginine residues in domain V have a central role for bacteria-binding activity of macrophage scavenger receptor MARCO. Biochem Biophys Res Commun 290:1462-9 [Non-Patent Document 11] Fabriek BO, et al., 2009, The macrophage scavenger receptor CD163 functions as an innate immune sensor for bacteria, Blood 113:887-92 [Non-Patent Document 12] Peiser L, et al., 2000, Macrophage class A scavenger receptor-mediated phagocytosis of Escherichia coli: role of cell heterogeneity, microbial strain, and culture conditions in vitro Infect Immun 68:1953-63 [Non-Patent Document 13] Sarrias MR, et al., 2005, A role for human Sp alpha as a pattern recognition receptor, J Biol Chem 280:35391-8

Non-Patent Document 14

Non-Patent Document 15

Non-Patent Document 16

Non-Patent Document 17

Non-Patent Document 18

[0016] However, the production of mammalian recombinant proteins is a relatively complicated process that ideally requires the protein to be properly folded and, if present, to have post-translational modifications. The process usually involves cloning the desired gene in a mammalian expression vector, introducing the recombinant gene into a mammalian cell line (e.g., CHO cells), and purifying the protein by chromatography. This process has certain limitations, such as low production efficiency and high cost. Therefore, it would be desirable to provide compounds and compositions that are easy to produce and therefore less expensive, and that are effective in the prevention and treatment of infectious diseases, such as sepsis, and inflammatory conditions associated with these infections. [Means for solving the problem]

[0017] The present application discloses amino acid sequences comprising or consisting of SEQ ID NO:3 and / or SEQ ID NO:1 and / or SEQ ID NO:2, or derivatives thereof.

[0018] The present application further discloses methods for making the amino acid sequences and / or peptides of the present invention. The methods can be carried out by solid phase peptide synthesis or by peptide synthesis in solution. Solid phase peptide synthesis involves: a) a solid phase peptide synthesis step; b) cleaving the peptide from the polymer support; c) optionally cycling the peptide in solution; d) removing the protecting group; or i) a solid phase peptide synthesis step; ii) optionally, a solid phase peptide cycling step; iii) cleaving the peptide from the polymer support and simultaneously removing the protecting groups; Includes:

[0019] Additionally, the present application discloses compositions comprising one or more amino acid sequences of the present invention.

[0020] In a further embodiment, the present application discloses a pharmaceutical composition comprising the composition of the present invention together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or a suitable excipient.

[0021] In a further embodiment, the present application discloses conjugates comprising the amino acid sequences of the invention, preferably conjugates in which one or more amino acid sequences of the invention are conjugated (preferably covalently attached) to a carrier, preferably an insoluble carrier, more preferably an insoluble polymer.

[0022] In a further embodiment, the present application discloses a kit-of-parts comprising one or more amino acid sequences of the present invention and an antibiotic, preferably imipenem.

[0023] The present application further provides one or more amino acid sequences of the invention, compositions of the invention or kits of parts of the invention for use as a medicament, in particular for use in therapeutic and / or prophylactic methods for the treatment in mammals, including humans, of infectious diseases, or inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious agents.

[0024] Additionally provided is a device for selectively binding and separating at least one component from an aqueous solution, the device comprising one or more amino acid sequences of the invention.

[0025] The present application also provides a method for removing at least one component from an aqueous solution, comprising: providing an aqueous solution potentially containing said at least one component; removing said at least one component from said aqueous solution by passing said aqueous solution through a device of the invention under conditions that result in binding of said at least one component to one or more of said amino acid sequences contained in said device; A method is disclosed, comprising: [Brief explanation of the drawings]

[0026] [Figure 1]Figure 1 shows structural features and amino acid conservation of CD6 peptides. (A) Amino acid sequences, molecular weights (MW), and isoelectric points (PI) of analyzed CD5, CD6, and DMBT-1 peptides and proteins. (B) Three-dimensional surface representation of the extracellular region of human CD6 (colored dark gray) showing the relative positions of the CD6 peptides under study. (C) Primates (Homo sapiens, Rhesus macaque (Macaca mulatta), Northern white-cheeked gibbon (Nomascus leucogenys), chimpanzee (Pan troglodytes), Philippine tarsier (Tarsius syrichta)), rodents (house mouse (Mus musculus), brown rat (Rattus norvegicus), European rabbit (Oryctolagus cuniculus), golden hamster (Mesocricetus auratus)), fish (Poeciliopsis prolifica, Atlantic salmon (Salmo salar)), cattle (Bos taurus), pigs (Sus scrofa), and reptiles (American alligator (Alligator Amino acid sequence alignment of the CD6-derived peptides under study from the species A. mississippiensis. Amino acid identities are highlighted in gray. [Figure 2]Figure 1 shows the bacterial aggregation properties of CD6-derived peptides. Increasing concentrations (5 μg / mL, 50 μg / mL, and 200 μg / mL) of the indicated peptides derived from CD6 (PD1, PD2, and PD3), DMBT-1 (pbs1; C+), and CD5 (PD2; C-) were incubated for 2 h at room temperature in 96-well U-bottom plates containing a live bacterial cell suspension (75 × 10 CFU / mL) in TTC buffer (50 mM Tris (pH 7.5) + 150 mM NaCl, 0.1% Tween 20, and 1 mM Ca2+). Bacterial aggregation was scored by two independent observers as -, + / -, +, ++, or +++, and consensus was reached. (A) Summary of agglutination results obtained with the indicated panel of Gram-negative (multidrug-resistant Acinetobacter baumannii clinical isolate; Enterobacter cloacae ATCC 23355; Escherichia coli ATCC 25922; Klebsiella pneumoniae ATCC 13883; Listeria monocytogenes ATCC 19111; Pseudomonas aeruginosa ATCC 27853) and Gram-positive (Staphylococcus aureus ATCC 25923; methicillin-resistant Staphylococcus aureus (MRSA) clinical isolate) bacterial strains. (B) Representative agglutination results obtained for MRSA clinical isolates. [Figure 3]Figure 1 shows the binding of biotin-labeled CD6-derived peptides to immobilized PAMPs from Gram- and Gram+ sources. Biotin-labeled peptides derived from CD6 (PD1, PD2, PD3, and cons), DMBT1 (pbs1), and CD5 (PD1) were added at increasing concentrations (5 μg / mL to 20 μg / mL) to 96-well ELISA plates sensitized with E. coli O111:B4 LPS (A) or Staphylococcus aureus LTA (B) (5 μg / mL each in PBS). Following overnight incubation at 4°C, bound peptides or proteins were developed by the addition of horseradish peroxidase (HRP)-conjugated streptavidin and 3,3',5,5'-tetramethylbenzidine (TMB) substrate and read at OD 405-620 nm. Results are presented as the mean ± SD of two replicates, with one representative experiment performed three times. Statistical analysis was performed by two-way analysis of variance (*, P<0.05; **, P<0.01; ***, P<0.001). [Figure 4] Figure 1 shows the Kd analysis of the interaction of LPS and LTA with CD6-derived peptides and proteins. The apparent Kd values ​​for the binding of the peptides and proteins under study to LPS and LTA are shown, as determined by the fluorescence emission of tryptophan residues. Peptides / proteins (10 μg / mL) were titrated with or without increasing concentrations of Re-LPS or LTA in PBS. Peptide samples (with or without either Re-LPS or LTA) and blank samples (Re-LPS or LTA alone) were excited at 295 nm, and emission spectra were recorded from 300 to 400 nm. Results are expressed as the change in peptide fluorescence (ΔF) at the wavelength of the emission maximum (353 nm for peptides and 337 nm for rshCD6 protein) in the presence and absence of either Re-LPS or LTA. Results are the mean ± SD of three experiments. The peptide fluorescence change at 353 nm was fitted to the Hill equation. [Figure 5]Figure 1 shows the analysis of the hydrodynamic size of CD6-derived peptides in solution. Dynamic light scattering (DLS) analysis of the hydrodynamic diameter of peptides derived from CD6 (PD1, PD2, PD3, and Pcons) and DMBT-1 / SAG (pbs1) in PBS (10 μg / mL) is shown. The y-axis represents the relative intensity of scattered light, and the x-axis represents the hydrodynamic diameter of the particles present in solution. One representative experiment out of four is shown (left). The values ​​obtained for each peptide are also shown (right). [Figure 6] Figure 1 shows the effect of CD6-derived peptides on LPS-induced cytokine release by mouse splenocytes in vitro. Whole splenocyte suspensions (2 × 10 cells) from C57BL / 6 mice (n = 7) were stimulated with LPS (0.5 μg / mL) in the presence or absence of increasing concentrations (0.5 μg / mL, 5 μg / mL, and 20 μg / mL) of CD6-derived peptides (PD1, PD2, PD3, and Pcons) for 48 hours, three times. Cytokine levels in the culture supernatants were determined by ELISA, and results are expressed in pg / mL as the mean ± SD of three experiments. Viability was greater than 75% at 48 hours in all experimental conditions. Statistical analysis was performed using a two-tailed Mann-Whitney test with a 95% confidence interval (*, P < 0.05; **, P < 0.01; ***, P < 0.001). [Figure 7] Figure 1 shows the comparative therapeutic effects of intravenously infused CD6-derived peptides on mouse survival after cecal ligation and puncture (CLP)-induced sepsis. (A, B) At +1 hour after CLP induction, C57BL / 6J mice were intravenously infused with saline (n = 25) or a single 6 mg / kg dose of untagged peptides derived from CD6 (PD1, n = 8; PD2, n = 16; PD3, n = 15; Pcons, n = 12) or DMBT1 (pbs1, n = 13). A sham group (n = 3) was included. In both cases, mean percent survival was analyzed over time for each group and compared with the saline-treated group using a log-rank t-test (*, P < 0.05; **, P < 0.01; **, P < 0.001). [Figure 8]These figures show the dose-, time-, and route-dependent effects of CD6.PD3 infusion on mouse survival after CLP-induced sepsis. (A) At +1 h after CLP, C57BL / 6 mice were intravenously infused with saline (n = 26) or single, increasing doses of CD6.PD3 peptide (3 mg / kg, n = 13; 6 mg / kg, n = 15; and 12 mg / kg, n = 8). (B) At different times after CLP (+1 h, n = 5; +3 h, n = 5; +6 h, n = 6), C57BL / 6 mice were intravenously infused with saline (n = 4) or 6 mg / kg CD6.PD3. (C) At +1 h after CLP, C57BL / 6J mice were infused iv (n = 11) or ip (n = 9) with 6 mg / kg CD6.PD3 peptide or saline (n = 9). In all cases, the mean percent survival was analyzed over time and compared with the saline-treated group using a log-rank t-test (ns, not significant; *, P<0.05; **, P<0.01; ***, P<0.001). [Figure 9] Figure 1 shows the therapeutic effect of CD6.PD3 infusion on cytokine and bacterial load levels after CLP-induced sepsis. (A) At +1 h after CLP, C57BL / 6J mice were intravenously infused with saline (n = 7) or CD6.PD3 peptide (6 mg / kg; n = 9), and cytokine plasma concentrations were subsequently monitored by ELISA at different time points (4 h and 20 h). Data are presented as mean ± SD. (B) At 20 h after CLP induction, the same groups of mice as in (A) were monitored for bacterial load in the blood and spleen. Data are presented as mean ± SD of CFU / mg (spleen) or CFU / μL (blood). In all cases, statistical differences were assessed using a two-tailed Student's t-test (*, P < 0.05). [Figure 10]Figure 1 shows the additive effect of combined administration of CD6.PD3 plus imipenem / cilastatin on mouse survival after CLP-induced sepsis. At +1 h after CLP, C57BL / 6J mice were therapeutically infused with saline (n = 36), CD6.PD3 (6 mg / kg i.v.; n = 25), imipenem / cilastatin (I / C, 50 mg / kg i.p. for 12 h; n = 9), or a combination of the latter two (I / C + PD3, n = 11). In all cases, mean percent survival was analyzed over time for each group and compared with the I / C + CD6.PD3 group using a log-rank t-test (**, P < 0.02; ***, P < 0.002). [Figure 11] Figure 1 shows an endotoxin adsorption assay for immobilized CD6-derived peptides and proteins. Eupergit™ beads coated with different CD6-derived peptides (PD2, PD3, and Pcons) (A) or proteins (rshCD5 and rshCD6) (B) were incubated with 50 UI / mL endotoxin solution for different periods (0, 30, 90, and 150 min). Limulus amebocyte extract activating activity (LAL activity) of the supernatant was then monitored over time, as shown at OD 405 nm and 620 nm. Human serum albumin (HSA)-coated beads were used as a negative control. A representative experiment from three independent experiments is shown. Statistical analysis was performed using a two-tailed paired t-test with a 95% confidence interval (***, P<0.001). DETAILED DESCRIPTION OF THE INVENTION

[0027] Amino acid sequences and peptides In a first aspect, the present invention provides a method for producing a medicament for the treatment of a pulmonary arthritis, comprising: CD6.PD1:GTVEVRLEASW (SEQ ID NO: 1); CD6.PD2:GRVEMLEHGEW (SEQ ID NO: 2); and CD6.PD3:GQVEVHFRGVW (SEQ ID NO: 3); (the "amino acid sequences of the invention") or derivatives thereof.

[0028] Preferably, the present invention provides a method for producing a medicament for the treatment of a pulmonary arthritis. CD6.PD1:GTVEVRLEASW (SEQ ID NO: 1); CD6.PD2:GRVEMLEHGEW (SEQ ID NO: 2); and CD6.PD3:GQVEVHFRGVW (SEQ ID NO: 3); ("peptides of the invention") or derivatives thereof.

[0029] In a preferred embodiment, the present invention provides an amino acid sequence comprising or consisting of GQVEVHFRGVW (SEQ ID NO: 3, CD6.PD3), or a derivative thereof. In a preferred embodiment, the present invention provides the CD6.PD3 peptide (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof.

[0030] In a further embodiment, the present invention provides an amino acid sequence comprising or consisting of GTVEVRLEASW (SEQ ID NO: 1, CD6.PD1), or a derivative thereof. In a preferred embodiment, the present invention provides the CD6.PD1 peptide (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0031] In a further embodiment, the present invention provides an amino acid sequence comprising or consisting of GRVEMLEHGEW (SEQ ID NO: 2, CD6.PD2), or a derivative thereof. In a preferred embodiment, the present invention provides the CD6.PD2 peptide (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof.

[0032] These peptides are conserved short 11-mer peptides mapping the extracellular SRCR domain of human CD6. The CD6 ectodomain is composed of three SRCR domains, an intervening sequence, and a stalk region.

[0033] The present invention further provides an amino acid sequence comprising peptide CD6.PD1 (SEQ ID NO: 1), CD6.PD2 (SEQ ID NO: 2), and / or CD6.PD3 (SEQ ID NO: 3). The amino acid sequence may be linear or cyclic. Preferably, the amino acid sequence is contained within the ectodomain of human CD6. In a preferred embodiment, the amino acid sequence is contained within SEQ ID NO: 4. In a specific embodiment, the linear or cyclic amino acid sequence comprises 12 to 17 contiguous amino acids comprising peptide CD6.PD1 (SEQ ID NO: 1), CD6.PD2 (SEQ ID NO: 2), or CD6.PD3 (SEQ ID NO: 3), and is preferably contained within SEQ ID NO: 4. Examples of preferred amino acid sequences include, but are not limited to, CSGTVEVRLEASWEPAC (SEQ ID NO: 13), SGTVEVRLEASWEPA (SEQ ID NO: 14), SGTVEVRLEASWEP (SEQ ID NO: 15), SGTVEVRLEASWE (SEQ ID NO: 16), SGTVEVRLEASW (SEQ ID NO: 17), GTVEVRLEASWEPA (SEQ ID NO: 18), GTVEVRLEASWEP (SEQ ID NO: 19), GTVEVRLEASWE (SEQ ID NO: 20), CAGRVEMLEHGEWGSVC (SEQ ID NO: 21), AGRVEMLEHGEWGSV (SEQ ID NO: 22), AGRVEMLEHGEWGS (SEQ ID NO: 23), AGRVEM Examples of such amino acid sequences include LEHGEWG (SEQ ID NO: 24), AGRVEMMLEHGEW (SEQ ID NO: 25), GRVEMLEHGEWGSV (SEQ ID NO: 26), GRVEMLEHGEWGS (SEQ ID NO: 27), GRVEMLEHGEWG (SEQ ID NO: 28), CEGQVEVHFRGVWNTVC (SEQ ID NO: 29), EGQVEVHFRGVWNTV (SEQ ID NO: 30), EGQVEVHFRGVWNT (SEQ ID NO: 31), EGQVEVHFRGVWN (SEQ ID NO: 32), EGQVEVHFRGVW (SEQ ID NO: 33), GQVEVHFRGVWNTV (SEQ ID NO: 34), GQVEVHFRGVWNT (SEQ ID NO: 35), and GQVEVHFRGVWN (SEQ ID NO: 36).

[0034] As used herein, the phrase "derivative of an amino acid sequence or peptide of the present invention" includes any derivative of an amino acid sequence or peptide of the present invention that is capable of performing a biological function, for example, any derivative of an amino acid sequence or peptide of the present invention that is capable of binding to a PAMP (e.g., LPS) widely distributed among Gram-negative (G-) bacteria and a PAMP (e.g., LTA) widely distributed among Gram-positive (G+) bacteria. The amino acid sequences and peptides of the present invention may include modifications of the given sequence. Such modifications are well known to those skilled in the art. Transferring substituents from C atoms to N atoms within amino acid residues to generate peptides with increased resistance to proteolysis, as well as other modifications, are known and are included within the scope of the present invention. For example, one or more L-amino acids in the amino acid sequences and peptides of the present invention may be replaced with D-amino acids to enhance stability. For example, N-acylation and / or C-amidation or C-esterification of the peptides and / or amino acid sequences of the present invention may enhance their resistance to proteolysis. For example, cyclization of one or more amino acid sequences and / or peptides of the present invention may enhance their stability and permeability. For example, one or more amino acids in the amino acid sequences and / or peptides of the invention may be N-alkylated (generally N-methylated) to improve their stability. For example, one or more amino acid sequences and / or peptides of the invention may be conjugated to one or more polymers (e.g., polyethylene glycol (PEG), albumin) to improve stability and / or reduce renal clearance. For example, the amino acid sequences and peptides of the invention may include an N- or C-terminus capped with a Cys residue for further covalent attachment to a solid phase (e.g., polypropylene beads).

[0035] SEQ ID NO: 4 corresponds to the mature (fully processed) soluble isoform of human CD6. The sequence of the human CD6 receptor is that identified under accession number P30203 (CD6_HUMAN, last updated December 15, 2009, UniProtKB / Swiss-Prot database version 3). This sequence corresponds to the receptor in its membrane-bound isoform. Whether soluble isoforms of CD6 are also generated by proteolytic cleavage has yet to be fully determined. SEQ ID NO: 4 is obtained by the addition of a stop codon in the stalk region preceding the transmembrane region.

[0036] SEQ ID NO:4 DQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQA LPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEEVPASVQTVTIESSVTVKIENKESR

[0037] SEQ ID NO:4 is generated by transcription and translation of a nucleotide sequence comprising SEQ ID NO:5.

[0038] SEQ ID NO:5 gaccagctca acaccagcag tgcagagagt gagctctggg agccagggga gcggcttccg gtccgtctga caaacgggag cagcagctgc agcgggacgg tggaggtgcg gctcgaggcg tcctgggagc ccgcgtgcgg ggcgctctgg gacagccgcg ccgccgaggc cgtgtgccga gcactgggct gcggcggggc ggaggccgcc tctcagctcg ccccgccgac ccctgagctg ccgcccccgc ctgcagccgg gaacaccagc gtagcagcta atgccactct ggccggggcg cccgccctcc tgtgcagcgg cgccgagtgg cggctctgcg aggtggtgga gcacgcgtgc cgcagcgacg ggaggcgggc ccgtgtcacc tgtgcagaga accgcgcgct gcgcctggtg gacggtggcg gcgcctgcgc cggccgcgtg gagatgctgg agcatggcga gtggggatca gtgtgcgatg acacttggga cctggaggac gcccacgtgg tgtgcaggca actgggctgc ggctgggcag tccaggccct gcccggcttg cacttcacgc ccggccgcgg gcctatccac cgggaccagg tgaactgctc gggggccgaa gcttacctgt gggactgccc ggggctgcca ggacagcact actgcggcca caaagaggac gcgggcgtgg tgtgctcaga gcaccagtcc tggcgcctga cagggggcgc tgaccgctgc gaggggcagg tggaggtaca cttccgaggg gtctggaaca cagtgtgtga cagtgagtgg tacccatcgg aggccaaggt gctctgccag tccttgggct gtggaactgc ggttgagagg cccaaggggc tgccccactc cttgtccggc aggatgtact actcatgcaa tggggagggag ctcaccctct ccaactgctc ctggcggttc aacaactcca acctctgcag ccagtcgctg gcagccaggg tcctctgctc agcttcccgg agtttgcaca atctgtccac tcccgaagtc cctgcaagtg ttcagacagt cactatagaa tcttctgtga cagtgaaaat agagaacaag gaatctcggt ag

[0039] CD6.PD1 (also referred to herein as "PD1" or "P1"), CD6.PD2 (also referred to herein as "PD2" or "P2"), and CD6.PD3 (also referred to herein as "PD3" or "P3") can bind PAMPs (e.g., LPS) widely distributed among Gram-negative (G-) bacteria and PAMPs (e.g., LTA) widely distributed among Gram-positive (G+) bacteria (see, e.g., Figure 3). They also exhibit high bacterial aggregation properties. In particular, PD1 and PD2 exhibit very high affinity for Re-LPS and LTA (see, e.g., Figure 4). CD6.PD3 improves the survival of mice undergoing polymicrobial sepsis in a dose- and time-dependent manner (see, e.g., Figure 7, Figure 8, and Figure 9). When combined with the antibiotics imipenem / cilastatin, this peptide works even better (see, e.g., Figure 10), demonstrating an additive survival effect on septic mice.

[0040] Any method commonly used in the art can be used to produce the amino acid sequences and peptides of the present invention, or their derivatives (CD6.PD1, CD6.PD2, and CD6.PD3), for example, by solid-phase peptide synthesis (Albericio F and Kates SA, 2000, Solid-Phase Synthesis: A Practical Guide, CRC Press, ISBN 9780824703592).

[0041] The compounds of the present invention (as described above, the amino acid sequences and peptides, and derivatives thereof), their stereoisomers, or their pharmaceutically acceptable salts can be synthesized according to conventional methods known in the state of the art. In an embodiment of the present invention, the compounds are synthesized by liquid phase or solid phase peptide synthesis methods.

[0042] Solid-phase synthesis is described, for example, in Stewart JM and Young JD, 1984, "Solid Phase Peptide Synthesis, 2nd edition," Pierce Chemical Company, Rockford, Illinois; Bodanzsky M. and Bodanzsky A., 1984, "The practice of Peptide Synthesis," Springer Verlag, New Cork; Lloyd-Williams P., Albericio F. and Giralt E. (1997) "Chemical Approaches to the Synthesis of Peptides and Proteins," CRC, Boca Raton, FL, USA. Liquid-phase synthesis, and a combination of liquid-phase and solid-phase synthesis, or enzymatic synthesis, are described in Kullmann W. et al., J.Biol.Chem., 1980, 255, 8234-8238.

[0043] In an embodiment of the invention, the compounds of the invention (as described above, amino acid sequences and peptides, and derivatives thereof) are a) a step of solid phase peptide synthesis; b) cleaving the peptide from the polymeric support, preferably by acid treatment; c) optionally cycling the peptide in solution; d) optionally removing the protecting groups, preferably with trifluoroacetic acid; contains, or i) a step of solid phase peptide synthesis; ii) optionally, a step of solid phase peptide cycling; iii) cleaving the peptide from the polymer support and, if necessary, simultaneously removing protecting groups, preferably by treatment with trifluoroacetic acid; It is prepared by a method comprising:

[0044] Preferably, the C-terminus is bound to a solid support, and since this process is carried out in the solid phase, it involves linking an amino acid with a protected N-terminus and a free C-terminus to an amino acid with a free N-terminus and a C-terminus bound to the polymer support, removing the protecting group from the N-terminus, and repeating this sequence as many times as necessary to obtain the target peptide sequence, and finally cleaving the synthesized peptide from the original polymer support. Functional groups of the amino acid side chains remain appropriately protected with protecting groups temporarily or permanently throughout the synthesis, and can be deprotected simultaneously with or orthogonally during the process of cleaving the peptide from the polymer support.

[0045] Alternatively, solid phase synthesis can be carried out by a convergent strategy by linking peptide fragments on a polymer support or peptide fragments previously bound to a polymer support. Convergent synthesis strategies are well known to those skilled in the art and are described by Lloyd-Williams P. et al. in Tetrahedron 1993, 49, 11065-11133.

[0046] This process may include the additional steps of deprotecting the N- and C-termini and / or cleaving the peptide from the polymeric support, in any order, using standard processes and conditions known in the art, after which the functional groups at said termini can be modified. Any modifications of the N- and C-termini can be made while the peptide of formula (I) is still immobilized on the polymeric support or after the peptide has been cleaved from the polymeric support.

[0047] The term "protecting group" refers to a group that blocks an organic functional group and can be removed under controlled conditions. Protecting groups, their relative reactivities, and the conditions under which they remain inert are known to those skilled in the art.

[0048] Examples of representative protecting groups for amino groups are, inter alia, amides such as acetate, benzoate, pivalate; benzyloxycarbonyl (Cbz or Z), 2-chlorobenzyl (ClZ), para-nitrobenzyloxycarbonyl (pNZ), tert-butyloxycarbonyl (Boc), 2,2,2-trichloroethoxycarbonyl (Troc), 2-(trimethylsilyl)ethoxycarbonyl (Teoc), 9-fluorenylmethoxycarbonyl (Fmoc) or allyloxycarbonyl (Alloc), trityl (Trt), methoxytrityl (Mtt), 2,4-dinitrophenyl (Dnp), N-[1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl] (Dde), 1-(4,4-dimethyl-2,6-dioxo-cyclohexylidene)-3-methyl-butyl (ivDde), 1-(1-adamantyl)-1-methylethoxy-carbonyl (Adpoc), preferably Boc or Fmoc.

[0049] Representative examples of protecting groups for carboxyl groups are, inter alia, tert-butyl (tBu) ester, allyl (All) ester, triphenylmethyl ester (trityl ester, Trt), cyclohexyl (cHx) ester, benzyl (Bzl) ester, ortho-nitrobenzyl ester, para-nitrobenzyl ester, para-methoxybenzyl ester, trimethylsilylethyl ester, 2-phenylisopropyl ester, fluorenylmethyl (Fm) ester, 4-(N-[1-(4,4-dimethyl-2,6-dioxocyclohexylidene)-3-methylbutyl]amino)benzyl (Dmab) ester, with preferred protecting groups of the present invention being the All, tBu, cHex, Bzl and Trt esters.

[0050] Trifunctional amino acids can be protected during the synthesis process using temporary or permanent protecting groups orthogonal to the N- and C-terminal protecting groups. The above-mentioned amino protecting groups are used to protect the amino group of the lysine side chain, the tryptophan side chain can be protected with any of the above-mentioned amino protecting groups or can be left unprotected, the serine and threonine side chains are protected with tert-butyl (tBu) ester, the cysteine ​​side chain is protected with a protecting group selected from the group consisting of trityl and acetamidomethyl, and the asparagine side chain can be protected with a protecting group selected from the group consisting of methoxytrityl, trityl, and xanthyl, or can be left unprotected. Preferred trifunctional amino acid protecting groups of the present invention are tBu ester for the serine and threonine side chains, Boc for the lysine side chain, Trt for the cysteine ​​side chain, and Fmoc or Boc as the temporary protecting group for the N-terminus. Examples of these and other additional protecting groups, their introduction and removal are described in the literature [Greene TW and Wuts PGM (1999) "Protective groups in organic synthesis" John Wiley & Sons, New York; Atherton B. and Sheppard RC (1989) "Solid Phase Peptide Synthesis: A practical approach" IRL Oxford University Press]. The term "protecting group" also includes polymer supports used in solid phase synthesis.

[0051] When the synthesis is carried out partially or completely on a solid phase, polystyrene, polyethylene glycol grafted onto a polystyrene support, etc. can be mentioned as solid supports used in the method of the present invention, and non-limiting examples include p-methylbenzhydrylamine (MBHA) resin [Matsueda GR et al., Peptides 1981, 2, 45-50], 2-chlorotrityl resin [Barlos K. et al. 1989 Tetrahedron Lett. 30:3943-3946, Barlos K. et al., 1989 Tetrahedron Lett. 30, 3947-3951], TentaGel™ resin (Rapp Polymere GmbH), ChemMatrix™ resin (Matrix Innovation, Inc.), etc., which are 5-(4-aminomethyl-3,5-dimethoxyphenoxy)valeric acid (PAL) [Albericio F. et al., 1990, J. Org. Chem. 55, 3730-3743], 2-[4-aminomethyl-(2,4-dimethoxyphenyl)]phenoxyacetic acid (AM) [Rink H., 1987, Tetrahedron Lett. 28, 3787-3790], Wang [Wang SS, 1973, J. Am. Chem. Soc. 95, 1328-1333], etc. (which cleave a semi-protected peptide and form a cycle in solution by a deprotection step during solution or solid-phase cycling, allowing subsequent deprotection and simultaneous cleavage of the peptide).

[0052] combination In a second aspect, the present invention provides a combination comprising one or more amino acid sequences or peptides, or derivatives thereof, of the present invention and at least one antibiotic. Preferably, the antibiotic is a β-lactam antibiotic, more preferably imipenem. In a preferred embodiment, the combination further comprises an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin. Even more preferably, the combination comprises imipenem and cilastatin.

[0053] Other antibiotics may be used in the combinations of the present invention. Examples of other β-lactam antibiotics are carbapenems such as meropenem, ertapenem, doripenem, etc., and penicillins such as amoxicillin, ampicillin, propicillin, oxacillin, dicloxacillin, flucloxacillin, mezlocillin, piperacillin, etc. Examples of other classes of antibiotics include aminoglycosides such as streptomycin, gentamicin, tobramycin, netilmicin, and amikacin; tetracyclines such as tetracycline, doxycycline, minocycline, chlortetracycline, oxytetracycline, demeclocycline, lymecycline, meclocycline, methacycline, minocycline, and loritotetracycline; and antibiotics such as flumequine (Flubactin), oxolinic acid (Uroxin), losoxacin (Eradacil), ciprofloxacin (Zoxan, Ciprobay, Cipro, Ciproxin), fleroxacin (Megalone, Roquinol), lomefloxacin (Maxaquin), nadifloxacin (Acuatim, Nadoxin, Nadixa), and norfloxacin (Lexinor). , Noroxin, Quinabic, Janacin), ofloxacin (Floxin, Oxaldin, Tarivid), pefloxacin (Peflacine), rufloxacin (Uroflox), balofloxacin (Baloxin), grepafloxacin (Raxar), levofloxacin (Cravit, Levaquin), pazufloxacin (Pasil, Pazucross), sparfloxacin (Zagam), temafloxacin (Omniflox), clinafloxacin, gatifloxacin (Zigat, Tequin) (Zymar-opth.), moxifloxacin (Avelox, Vigamox), sitafloxacin (Gracevit), prulifloxacin (Quisnon) and besifloxacin (Besivance), preferably fluoroquinolones. Also contemplated are glycopeptide antibiotics such as vancomycin, teicoplanin, or telavancin, among others, or macrolide antibiotics such as erythromycin, spiramycin, roxithromycin, clarithromycin, or azithromycin.

[0054] The combination may also include other beta-lactamase inhibitors such as clavulanic acid, sulbactam, tebipenem, 6-methylidenepenem 2, tazobactam, avibactam or relebactam.

[0055] Common combinations of β-lactam antibiotics and β-lactamase inhibitors are, for example, ampicillin / sulbactam, amoxicillin / clavulanic acid, or piperacillin / tazobactam.

[0056] In a preferred embodiment, the combination of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0057] In another embodiment, the combination of the invention comprises an amino acid sequence comprising or consisting of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0058] In a further embodiment, the combination of the invention comprises an amino acid sequence comprising or consisting of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0059] In a further embodiment, the combination of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0060] In a further embodiment, the combination of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0061] In a further embodiment, the combination of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0062] In a further embodiment, the combination of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof, and at least one antibiotic, preferably imipenem, and also preferably an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin.

[0063] composition In a third aspect, the present invention provides a composition, preferably a pharmaceutical composition, comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof ("composition of the invention"). For example, a composition of the invention, preferably a pharmaceutical composition, may comprise a combination of the invention.

[0064] In a preferred embodiment, the composition, preferably the pharmaceutical composition, of the present invention comprises an amino acid sequence comprising or consisting of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof.

[0065] In another embodiment, the composition, preferably the pharmaceutical composition, of the present invention comprises an amino acid sequence comprising or consisting of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0066] In a further embodiment, the composition, preferably the pharmaceutical composition, of the invention comprises an amino acid sequence comprising or consisting of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof.

[0067] In a further embodiment, the composition of the present invention, preferably a pharmaceutical composition, comprises an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0068] In a further embodiment, the composition of the present invention, preferably a pharmaceutical composition, comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0069] In a further embodiment, the composition of the present invention, preferably a pharmaceutical composition, comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof.

[0070] In a further embodiment, the composition of the present invention, preferably a pharmaceutical composition, comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0071] As mentioned above, in a preferred embodiment, the composition of the present invention is a pharmaceutical composition. Accordingly, the present invention provides a pharmaceutical composition comprising one or more isolated amino acid sequences of SEQ ID NO:3 and / or SEQ ID NO:1 and / or SEQ ID NO:2, or derivatives thereof.

[0072] As known to those skilled in the art, a pharmaceutical composition may contain, in addition to one or more active ingredients (e.g., one or more amino acid sequences or peptides of the invention), a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or a suitable excipient. Further, a pharmaceutical composition of the invention comprises a composition of the invention together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or a suitable excipient.

[0073] As used herein, the phrase "pharmaceutically acceptable carrier" means a non-toxic solvent, dispersant, excipient, adjuvant, or other material that is mixed with an active ingredient(s) to enable the formation of a pharmaceutical composition, i.e., a dosage form that can be administered to a patient. One example of such a carrier is a pharmaceutically soluble oil commonly used for parenteral administration.

[0074] The term "pharmaceutically acceptable salts" as used herein means that salts of compounds of the invention can be used in pharmaceutical preparations. However, other salts may be useful in the preparation of compounds according to the invention or of their pharmaceutically acceptable salts.

[0075] The term "carrier" refers to a diluent or excipient with which the active ingredient(s) is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like. Water or aqueous saline solutions and aqueous dextrose and glycerol solutions are preferably used as carriers, particularly for injectable solutions. Suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E.W. Martin in 1995.

[0076] An "adjuvant," as used herein, is a substance that has little or no pharmacological effect by itself, but that can enhance the effectiveness or potency of other agents when given at (essentially) the same time, often by (essentially) the same route of administration, and at (essentially) the same site (e.g., injection into the same muscle) as the other agents. More particularly, when used in the context of immunization, an adjuvant is a substance that stimulates or has the potential to stimulate the immune system and can enhance the response to an immunizing agent, without having any specific antigenic effect by itself. More specifically, an immunogenic adjuvant can be defined as a substance that, when used in combination with a specific antigenic agent(s), acts to accelerate, prolong, or enhance the antigen-specific immune response.

[0077] The carriers and auxiliary substances necessary to prepare the desired pharmaceutical dosage form of the pharmaceutical composition of the present invention will depend, among other factors, on the pharmaceutical dosage form selected. Such pharmaceutical dosage forms of the pharmaceutical composition of the present invention are prepared according to conventional methods known to those skilled in the art.

[0078] Examples of pharmaceutical compositions include any solid (tablets, pills, capsules, granules, etc.) or liquid (solution, suspension, or emulsion) composition for oral administration, topical administration, or parenteral administration such as intraperitoneal, intravenous, intramuscular, or subcutaneous administration. Furthermore, pharmaceutical compositions may contain stabilizers, suspensions, preservatives, surfactants, etc., as necessary.

[0079] Those skilled in the art can adapt the composition depending on the particular mode of administration. The compositions of the present invention may further comprise other therapeutic agents for infectious diseases or inflammatory conditions associated therewith, or combinations thereof.

[0080] Parts kit In a third aspect, the present invention provides a kit of parts comprising, or alternatively consisting of, one or more amino acid sequences or peptides (or derivatives thereof) of the present invention and at least one antibiotic. Preferably, the antibiotic is a β-lactam antibiotic, more preferably imipenem ("kit of parts of the present invention"). In a preferred embodiment, the combination further comprises an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, more preferably cilastatin. Even more preferably, the kit of parts comprises imipenem and cilastatin.

[0081] Other antibiotics can be used in the kit of parts of the present invention. Examples of other β-lactam antibiotics are carbapenems such as meropenem, ertapenem, doripenem, etc., and penicillins such as amoxicillin, ampicillin, propicillin, oxacillin, dicloxacillin, flucloxacillin, mezlocillin, piperacillin, etc. Examples of other classes of antibiotics include aminoglycosides such as streptomycin, gentamicin, tobramycin, netilmicin, and amikacin; tetracyclines such as tetracycline, doxycycline, minocycline, chlortetracycline, oxytetracycline, demeclocycline, lymecycline, meclocycline, methacycline, minocycline, and loritotetracycline; and antibiotics such as flumequine (Flubactin), oxolinic acid (Uroxin), losoxacin (Eradacil), ciprofloxacin (Zoxan, Ciprobay, Cipro, Ciproxin), fleroxacin (Megalone, Roquinol), lomefloxacin (Maxaquin), nadifloxacin (Acuatim, Nadoxin, Nadixa), and norfloxacin (Lexinor). , Noroxin, Quinabic, Janacin), ofloxacin (Floxin, Oxaldin, Tarivid), pefloxacin (Peflacine), rufloxacin (Uroflox), balofloxacin (Baloxin), grepafloxacin (Raxar), levofloxacin (Cravit, Levaquin), pazufloxacin (Pasil, Pazucross), sparfloxacin (Zagam), temafloxacin (Omniflox), clinafloxacin, gatifloxacin (Zigat, Tequin) (Zymar-opth.), moxifloxacin (Avelox, Vigamox), sitafloxacin (Gracevit), prulifloxacin (Quisnon) and besifloxacin (Besivance), preferably fluoroquinolones.Also contemplated are glycopeptide antibiotics such as vancomycin, teicoplanin, or telavancin, among others, or macrolide antibiotics such as erythromycin, spiramycin, roxithromycin, clarithromycin, or azithromycin.

[0082] The kit of parts may also include other β-lactamase inhibitors such as clavulanic acid, sulbactam, tebipenem, 6-methylidenepenem 2, tazobactam, avibactam or relebactam.

[0083] Common combinations of β-lactam antibiotics and β-lactamase inhibitors are, for example, ampicillin / sulbactam, amoxicillin / clavulanic acid, or piperacillin / tazobactam.

[0084] A kit of parts may also be referred to herein as a "combination product" and / or a "pharmaceutical product" and is defined in the context of this application as a product or multi-component system comprising two or more components that are not necessarily present as a union, e.g., in a composition, but are available for simultaneous, separate or sequential application or administration. Thus, the components of a kit of parts may be physically separated in different containers, as described in more detail below.

[0085] A multi-component system can be used, with one container storing one or more amino acid sequences or peptides of the invention, and another container containing an antibiotic (preferably imipenem) and preferably also an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor (preferably cilastatin). The components can be mixed at the appropriate time. Alternatively, the components can be used separately or sequentially, i.e., without mixing before administration to a subject in need of the components.

[0086] In particular, such a kit of parts may comprise or consist of (a) a first container containing one or more amino acid sequences or peptides of the invention, and (b) a second container containing an antibiotic, as described above, preferably imipenem, and also preferably an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, as described above, preferably cilastatin.

[0087] The kit of parts of the invention may comprise or consist of one or more amino acid sequences or peptides of the invention and an antibiotic, preferably imipenem (as described above, preferably also comprising an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin), as separate entities (e.g., contained in separate containers) that can be administered simultaneously, sequentially, or separately to a subject (a mammal, preferably a human). In a preferred embodiment, the kit of parts of the invention comprises or consists of one or more amino acid sequences or peptides of the invention and an antibiotic, preferably imipenem (as described above, preferably also comprising an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin), as separate entities (e.g., contained in separate containers) that can be administered simultaneously, sequentially, or separately to a subject (a mammal, preferably a human, or a non-mammal). In another embodiment, the containers are combined into a single article of manufacture with a barrier between the containers. Removal or disruption of this barrier allows mixing of the components at the appropriate time.

[0088] The present invention therefore provides a kit of parts of the invention, as defined below, to be used simultaneously, sequentially or separately as a medicament, in particular in a therapeutic and / or prophylactic method for the treatment in mammals, including humans, and / or non-mammals of infectious diseases, or inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious agents.

[0089] For example, the mammal may be a rodent (such as a mouse or rat), a primate (such as an ape, monkey or lemur), dog, cat, rabbit, or ungulate such as a cow, horse or pig. In a preferred embodiment, the mammal is a human.

[0090] For example, non-mammals include chickens, ducks, geese, ostriches, pigeons, turkeys, and the like.

[0091] The kit of parts of the present invention comprises: a) a pharmaceutical composition comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof, or a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or a suitable excipient; b) a pharmaceutical composition comprising an antibiotic, as described above, preferably imipenem, and an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, as described above, preferably cilastatin, together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipients; More preferably, the pharmaceutical composition comprises imipenem, and even more preferably, it comprises imipenem together with cilastatin.

[0092] Both pharmaceutical composition (a) and pharmaceutical composition (b) are preferably comprised in the kit of parts of the invention as separate entities (e.g., as separate liquid or solid compositions in separate containers, as described above) that can be administered simultaneously, sequentially or separately to a subject (a mammal, preferably a human, or a non-mammal).

[0093] As mentioned above and further described below, the combinations, compositions, pharmaceutical compositions and / or kits of parts of the present invention may preferably further comprise an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin. The enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, may be included in the kit of parts of the present invention as a (third) separate entity in a third container, preferably in the form of a pharmaceutical composition comprising the enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient. Preferably, the enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, is included in the same entity (same container) as the antibiotic, preferably imipenem, as described above (e.g., a composition or pharmaceutical composition comprising imipenem and cilastatin).

[0094] For example, one or more amino acid sequences or peptides of the invention, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient), preferably comprised in the kit of parts of the invention as separate entities, and an antibiotic, preferably imipenem, as described above, preferably together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, as described above, preferably together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient), as described above, may be administered simultaneously (at the same time) to a subject (a mammal, preferably a human).

[0095] Alternatively, one or more amino acid sequences or peptides of the invention, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient), preferably comprised in the kit of parts of the invention as separate entities, and an antibiotic, preferably imipenem, as described above, preferably together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, as described above, preferably together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient), as described above, can be administered to a subject (a mammal, preferably a human) They may be administered sequentially, for example, one or more amino acid sequences or peptides of the present invention, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides of the present invention, or derivatives thereof, together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or a suitable excipient) may be administered first, followed by administration of an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above, together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or a suitable excipient) to a subject (a mammal, preferably a human).

[0096] Preferably, an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient) is first administered to a subject (a mammal, preferably a human), and thereafter one or more amino acid sequences or peptides of the invention, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient) is administered to the subject.

[0097] Alternatively, one or more amino acid sequences or peptides of the invention, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof, together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient), preferably comprised in the kit of parts of the invention as separate entities, and an antibiotic, preferably imipenem, as described above, preferably together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above, together with a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipient), as described above, may be administered separately to a subject (a mammal, preferably a human). For example, the subject (a mammal, preferably a human) has already taken an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, as described above, together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipients), and one or more amino acid sequences or peptides of the invention, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides of the invention, or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or suitable excipients), preferably in a single dose.

[0098] Thus, the components of the kit of parts of the invention may be administered simultaneously, sequentially or separately to a subject (a mammal, including a human) as described below, preferably in a therapeutic and / or prophylactic method for the treatment of an infectious disease, or an inflammatory condition associated with an infectious disease, or an inflammatory disease associated with the presence of a product derived from an infectious agent.

[0099] Imipenem Imipenem is a β-lactam antibiotic belonging to the carbapenem class of antibiotics. Carbapenems are highly resistant to β-lactamase enzymes produced by many multidrug-resistant G- bacteria. Imipenem acts as an antibacterial agent by inhibiting cell wall synthesis of various G+ and G- bacteria, thereby reducing the amount of PAMPs released during bacteriolysis. Imipenem remains highly stable in the presence of β-lactamases (both penicillinases and cephalosporinases) produced by some bacteria and is a potent inhibitor of β-lactamases from some G- bacteria that are resistant to most β-lactam antibiotics. The IUPAC systematic name for imipenem is (5R,6S)-6-[(1R)-1-hydroxyethyl]-3-({2-[(iminomethyl)amino]ethyl}thio)-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid, its CAS registry number is 74431-23-5, and its chemical formula is set forth below in Formula 1: [ka]

[0100] As discussed in more detail below, imipenem is commonly administered with cilastatin.

[0101] Cilastatin Cilastatin is a compound that inhibits human dehydropeptidase, an enzyme involved in the in vivo degradation of the antibiotic imipenem. Therefore, cilastatin can be administered together with imipenem to prevent its degradation by dehydropeptidase, thereby extending its circulation time in the body and, therefore, its antibacterial effect. Cilastatin itself does not have antibiotic activity. As those skilled in the art will recognize, imipenem alone is an effective antibiotic and can be administered without cilastatin. However, imipenem is preferably administered together with cilastatin, preferably in a 1:1 imipenem:cilastatin ratio.

[0102] Effects of the amino acid sequences, peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions and kits of parts of the present invention According to the teachings of the present invention, one or more amino acid sequences, peptides, or derivatives thereof, combinations, compositions, pharmaceutical compositions and / or components of a kit of parts of the present invention can be administered to mammals, preferably humans. Alternatively, one or more amino acid sequences, peptides, or derivatives thereof, combinations, compositions, pharmaceutical compositions and / or components of a kit of parts of the present invention can be administered to non-mammals, preferably chickens, ducks, geese, ostriches, pigeons and / or turkeys. The purpose of administration of one or more amino acid sequences, peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions and / or components of a kit of parts of the present invention can be prophylactic (to avoid the onset of these diseases) and / or therapeutic (to treat these diseases after they have been developed / introduced).

[0103] It is understood that the components of one or more amino acid sequences, peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions and / or kits of parts of the present invention are administered in a pharmaceutically acceptable form. A person skilled in the art can ascertain the appropriate dosage using standard procedures. It is understood that the dosage is an effective amount of one or more amino acid sequences or peptides (or derivatives thereof), with or without an antibiotic, preferably imipenem, as described above (with or without an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above), in the sense that a reduction in inflammatory response is observed in the treated subject.

[0104] The specific co-administration (simultaneously, sequentially or separately) of one or more amino acid sequences or peptides (or derivatives thereof) of the present invention, preferably CD6.PD3 or a derivative thereof, and an antibiotic, preferably imipenem (as described above, preferably together with an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin) provides a clearly improved additive therapeutic effect in mammals, including humans, and / or non-mammals, including chickens, ducks, geese, ostriches, pigeons and / or turkeys, in particular in the treatment and / or prevention of infectious diseases, or inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious pathogens.

[0105] Treatment method In a further aspect, one or more amino acid sequences, peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions, and / or kits of parts of the present invention, in any of its variants, can be used as a medicament, preferably in a method of therapy and / or prophylaxis for the treatment of infectious diseases, or inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious agents, in mammals, including humans, and / or non-mammals, including chickens, ducks, geese, ostriches, pigeons, and / or turkeys. Accordingly, the present invention provides a method of therapy and / or prophylaxis for the treatment of infectious diseases, or inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious agents, comprising administering to a mammal and / or non-mammal one or more amino acid sequences, peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions, and / or kits of parts of the present invention. For example, the mammal may be a rodent (such as a mouse or rat), a primate (such as an ape, monkey, or lemur), a dog, a cat, a rabbit, or an ungulate, such as a cow, a horse, or a pig. In a preferred embodiment, the mammal is a human. For example, the non-mammal may be a chicken, duck, goose, ostrich, pigeon, turkey, or the like.

[0106] Preferably, the present invention provides a therapeutic and / or prophylactic method for the treatment of an infectious disease, or an inflammatory condition associated with an infectious disease, or an inflammatory disease associated with the presence of a product derived from an infectious pathogen, comprising the administration of an amino acid sequence comprising or consisting solely of GQVEVHFRGVW (CD6.PD3, SEQ ID NO: 3) or a derivative thereof, or an amino acid sequence comprising or consisting solely of GQVEVHFRGVW (CD6.PD3, SEQ ID NO: 3) or a derivative thereof, as defined above, to a mammal, preferably a human and / or a non-mammal, as described above.

[0107] For example, the present invention provides a therapeutic and / or prophylactic method for the treatment of an infectious disease, or an inflammatory condition associated with an infectious disease, or an inflammatory disease associated with the presence of a product derived from an infectious pathogen, comprising the administration of an amino acid sequence comprising, or consisting solely of, GTVEVRLEASW (CD6.PD1, SEQ ID NO: 1) or a derivative thereof, or a combination, composition, pharmaceutical composition and / or kit of parts as defined above comprising an amino acid sequence comprising, or consisting solely of, GTVEVRLEASW (CD6.PD1, SEQ ID NO: 1) or a derivative thereof, to a mammal, preferably a human and / or a non-mammal, as described above.

[0108] For example, the present invention provides a therapeutic and / or prophylactic method for the treatment of an infectious disease, or an inflammatory condition associated with an infectious disease, or an inflammatory disease associated with the presence of a product derived from an infectious pathogen, comprising the administration of an amino acid sequence comprising or consisting solely of GRVEMLEHGEW (CD6.PD2, SEQ ID NO: 2) or a derivative thereof, or an amino acid sequence comprising or consisting solely of GRVEMLEHGEW (CD6.PD2, SEQ ID NO: 2) or a derivative thereof, as defined above, to a mammal, preferably a human and / or a non-mammal, as described above.

[0109] For example, the present invention provides a kit of parts of the present invention to be used simultaneously, sequentially or separately as a medicament, in particular in a therapeutic and / or prophylactic method for the treatment of an infectious disease, or an inflammatory condition associated with an infectious disease, or an inflammatory disease associated with the presence of a product derived from an infectious agent, in mammals, including humans, and / or non-mammals, as described above.

[0110] In certain embodiments of the present invention, the infectious disease is a microbial infection, hi more particular embodiments, the microbial infection is selected from the group consisting of a bacterial infection (either G+ bacteria or G- bacteria, non-pathogenic or pathogenic, aerobic or anaerobic), a fungal infection, a viral infection, a parasitic infection, and combinations thereof (polymicrobial infections).

[0111] In another specific embodiment, the infectious disease is bacteremia. As used herein, the term "bacteremia" refers to the presence of any microorganism in the bloodstream. In particular, the bacteremia is selected from the group consisting of bacteremia, fungemia, viremia, parasitemia, and combinations thereof.

[0112] While the presence of viable microorganisms is seen in most cases of inflammatory conditions associated with infectious diseases, 20% to 30% of patients have no identified microorganisms from any source, but have microbial-derived products. Thus, in another embodiment, the inflammatory condition is associated with products derived from infectious agents. In particular, the infectious agent is selected from the group consisting of bacteria (either G+ or G- bacteria, non-pathogenic or pathogenic, aerobic or anaerobic), fungi, viruses, parasites, and / or combinations thereof.

[0113] Sepsis is defined as the presence or suspected presence of an infection accompanied by signs of a systemic response called the systemic inflammatory response syndrome (SIRS). For a definition of sepsis, see "Severe Sepsis and Septic Shock: A Review of the Literature and Emergency Department Management Guidelines," HB Nguyen et al., Ann. Emergency Med. 2006, vol. 48, pp. 28-54. Sepsis is usually caused by bacterial infection (either G+ or G- bacteria), but it can also be caused by other pathogens. Most commonly, sepsis is caused by G+ and G- bacterial infections. However, the damage and symptoms resulting from sepsis are not only caused by whole, living bacteria, but also by components of the bacterial cell wall known as endotoxins. Endotoxins (e.g., LPS, LTA, and PGN) are glycolipids ubiquitously present in the outer membranes of G+ and G- bacteria. Endotoxins are released when the immune system destroys invading bacteria. The released endotoxin binds to immune cells (monocytes, macrophages, granulocytes, lymphocytes, and endothelial and epithelial cells) and induces the production of various soluble mediators of inflammation, such as cytokines (e.g., TNF-α, IL-1β, and IL-6) and chemokines (e.g., IL-8), which are the main cause of severe forms of sepsis.

[0114] In certain embodiments of the present invention, the inflammatory condition is SIRS (systemic inflammatory response syndrome). In another specific embodiment, the inflammatory condition is sepsis. SIRS is characterized by: (1) a body temperature above 38°C or below 36°C, (2) a pulse rate above 90 beats / min, (3) a respiratory rate above 20 breaths / min (or a PCO2 below 32 Torr), and (4) a blood pressure of 12,000 cells / mm3. 3 or more than 4000 pieces / mm 3 It is defined as a white blood cell count of less than 0.001 or the presence of two or more immature rods greater than 10%.

[0115] In certain embodiments, the sepsis is polymicrobial sepsis, which is defined as a complex systemic infection involving the simultaneous occurrence of multiple infectious pathogens (e.g., bacterial and fungal; non-pathogenic and pathogenic; aerobic and anaerobic, etc.).

[0116] In another specific embodiment, the inflammatory condition is severe sepsis.Severe sepsis is defined as sepsis accompanied by one or more organ failures.Organ failure can be defined as acute lung injury, coagulation abnormalities, thrombocytopenia, altered mental status, renal failure, liver failure or cardiac failure, or hypoperfusion accompanied by lactic acidosis.

[0117] In another specific embodiment, the inflammatory condition is septic shock. Septic shock is defined as the presence of sepsis and refractory hypotension, i.e., a systolic blood pressure of less than 90 mmHg, a mean arterial pressure of less than 65 mmHg, or a decrease of 40 mmHg in systolic blood pressure compared to baseline, unresponsive to a crystalloid challenge of 20 ml / kg to 40 ml / kg. Thus, septic shock is effectively a form of severe sepsis. Finally, septic shock may be endotoxin-induced septic shock.

[0118] The source of infection can be any of a number of locations throughout the body. Common sites of infection that can lead to sepsis include inflammation of the appendix (appendicitis), diverticulitis, intestinal disorders, infection of the abdominal cavity (peritonitis), and gallbladder or liver infection; inflammation or infection of the brain or spinal cord (meningitis, encephalitis); lung infections such as pneumonia; skin infections due to wounds or openings made by intravenous catheters, cellulitis (inflammation of the connective tissue of the skin); urinary tract infections, especially if the patient has a urinary catheter to drain urine; dental and gynecological examinations or procedures; blunt or penetrating trauma, surgery, and endocardial inflammation.

[0119] As mentioned above, administration of one or more amino acid sequences, peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions and / or kits of parts of the invention in any of their variations to mammals, including humans, and / or non-mammals, can be performed intraperitoneally (ip) and / or intravenously (iv).

[0120] As described above, one or more amino acid sequences, peptides (or derivatives thereof), compositions, and / or pharmaceutical compositions of the present invention, in any of their variants, are preferably administered to mammals and / or non-mammals, including humans, as follows: A single dose of one or more amino acid sequences or peptides, preferably CD6.PD3 or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides, preferably CD6.PD3 or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or a suitable excipient) is administered as early as possible during antibiotic (preferably imipenem) treatment, preferably intravenously, optionally with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above. The optimal peptide dose in mice is 3 mg / kg to 15 mg / kg, preferably 6 mg / kg to 12 mg / kg. As will be understood by those skilled in the art, optimal peptide doses for other mammals (and non-mammals), including humans, must be established through clinical assays.

[0121] In another preferred embodiment, the components of the kit of parts of the invention are administered as follows: a single dose of one or more amino acid sequences or peptides, preferably CD6.PD3, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides, preferably CD6.PD3, or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or suitable excipients) is administered, preferably intravenously, to a subject in need thereof as soon as possible, followed by administration of an antibiotic, preferably imipenem (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or suitable excipients) (preferably together with an enzyme inhibitor, such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above).

[0122] In another preferred embodiment, the components of the kit of parts of the invention are administered as follows: first, an antibiotic, preferably imipenem (or a pharmaceutical composition comprising an antibiotic, preferably imipenem, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or suitable excipients) (preferably together with an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin, as described above) is administered to a subject in need thereof, followed by a single dose of one or more amino acid sequences or peptides, preferably CD6.PD3, or derivatives thereof (or a pharmaceutical composition comprising one or more amino acid sequences or peptides, preferably CD6.PD3, or derivatives thereof, and a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant, and / or suitable excipients), preferably administered intravenously.

[0123] Alternatively, rather than just administering a single dose of one or more amino acid sequences or peptides of the invention, or derivatives thereof, as described above, to a subject in need thereof, two or more doses, for example, two, three, four, five, six, seven, eight, nine, ten or more doses, may be administered to a subject in need thereof. As will be appreciated by those skilled in the art, the one, two, three, four, five, six, seven, eight, nine, ten or more doses may be administered either before, during or after the administration of an antibiotic, preferably imipenem (preferably together with an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin). Furthermore, the one or more amino acid sequences or peptides, or derivatives thereof, may be administered as a continuous perfusion (preferably i.v.) rather than as a dose, either before, during or after administration of an antibiotic, preferably imipenem (preferably together with an enzyme inhibitor such as a dehydropeptidase inhibitor or a β-lactamase inhibitor, preferably cilastatin).

[0124] It will be appreciated that a subject in need thereof may be under treatment with other drugs, such as other antibiotics, when one or more amino acid sequences or peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions and / or components of kits of parts of the invention, in any of its variations, are administered.

[0125] By "therapeutically effective amount" is meant an amount of a compound effective in treating the so-called disorder or condition.

[0126] The term "treatment" or "therapy" encompasses both prophylactic and curative methods of treating disease, since both relate to the maintenance or restoration of health. Regardless of the cause of disease, discomfort, or disability, its alleviation by administration of an appropriate agent should be construed as therapy or therapeutic use in the context of this application.

[0127] As such, one or more amino acid sequences or peptides (or derivatives thereof), combinations, compositions, pharmaceutical compositions and / or kits of parts of the invention may be used in methods of therapeutic treatment (after clinical manifestation of the disease) and / or prophylactic treatment (before clinical manifestation of the disease).

[0128] Conjugates In a further embodiment, the present application discloses a conjugate comprising one or more amino acid sequences and / or peptides of the invention, preferably in which one or more amino acid sequences and / or peptides of the invention are conjugated (preferably covalently bound) to a carrier, preferably a polymer, such as a soluble or preferably insoluble polymer.

[0129] A "peptide-carrier conjugate" or "conjugate" is defined as a hybrid structure combining an amino acid sequence and / or peptide with a carrier. Attachment to the carrier can be via the NH or COOH groups of the amino acid sequence and / or peptide, or by any other functional group on the amino acid side chain. The carrier can be a soluble polymer or an insoluble polymer to which the amino acid sequence and / or peptide is immobilized in the form of a solid or hydrogel material.

[0130] In order to conjugate (or fix or attach or bind or link or attach, preferably covalently bond) one or more amino acid sequences or peptides (or derivatives thereof) to the carrier, it may be preferable for the carrier to contain one or more functional groups for this purpose, representative examples of which are hydroxyl, amino, aldehyde, carboxyl, thiol, silanol, amide, epoxy, halogen, succinylimide and acid anhydride groups.

[0131] In a preferred embodiment, the conjugate of the present invention comprises an amino acid sequence comprising or consisting of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof.

[0132] In another embodiment, the conjugate of the invention comprises an amino acid sequence comprising or consisting of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0133] In a further embodiment, the conjugate of the invention comprises an amino acid sequence comprising or consisting of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof.

[0134] In a further embodiment, the conjugate of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0135] In a further embodiment, the conjugate of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0136] In a further embodiment, the conjugate of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof.

[0137] In a further embodiment, the conjugate of the present invention comprises an amino acid sequence comprising or consisting solely of CD6.PD3 (GQVEVHFRGVW, SEQ ID NO: 3), or a derivative thereof, an amino acid sequence comprising or consisting solely of CD6.PD2 (GRVEMLEHGEW, SEQ ID NO: 2), or a derivative thereof, and an amino acid sequence comprising or consisting solely of CD6.PD1 (GTVEVRLEASW, SEQ ID NO: 1), or a derivative thereof.

[0138] Conjugates of the invention can further comprise one or more amino acid sequences comprising peptides CD6.PD1 (SEQ ID NO: 1), CD6.PD2 (SEQ ID NO: 2), and / or CD6.PD3 (SEQ ID NO: 3). The amino acid sequence may be linear or cyclic. Preferably, the amino acid sequence is comprised within the ectodomain of human CD6. In a preferred embodiment, the amino acid sequence is comprised within SEQ ID NO: 4. In a specific embodiment, the linear or cyclic amino acid sequence comprises 12 to 17 contiguous amino acids comprising peptides CD6.PD1 (SEQ ID NO: 1), CD6.PD2 (SEQ ID NO: 2), or CD6.PD3 (SEQ ID NO: 3), preferably comprised within SEQ ID NO: 4. Examples of preferred amino acid sequences that may be included in the devices of the present invention include, but are not limited to, CSGTVEVRLEASWEPAC (SEQ ID NO: 13), SGTVEVRLEASWEPA (SEQ ID NO: 14), SGTVEVRLEASWEP (SEQ ID NO: 15), SGTVEVRLEASWE (SEQ ID NO: 16), SGTVEVRLEASW (SEQ ID NO: 17), GTVEVRLEASWEPA (SEQ ID NO: 18), GTVEVRLEASWEP (SEQ ID NO: 19), GTVEVRLEASWE (SEQ ID NO: 20), CAGRVEMLEHGEWGSVC (SEQ ID NO: 21), AGRVEMLEHGEWGSV (SEQ ID NO: 22), AGRVEMLEHGEWGS (SEQ ID NO: 23), Examples of such amino acids include AGRVEMLEHGEWG (SEQ ID NO: 24), AGRVEMLEHGEW (SEQ ID NO: 25), GRVEMLEHGEWGSV (SEQ ID NO: 26), GRVEMLEHGEWGS (SEQ ID NO: 27), GRVEMLEHGEWG (SEQ ID NO: 28), CEGQVEVHFRGVWNTVC (SEQ ID NO: 29), EGQVEVHFRGVWNTV (SEQ ID NO: 30), EGQVEVHFRGVWNT (SEQ ID NO: 31), EGQVEVHFRGVWN (SEQ ID NO: 32), EGQVEVHFRGVW (SEQ ID NO: 33), GQVEVHFRGVWNTV (SEQ ID NO: 34), GQVEVHFRGVWNT (SEQ ID NO: 35), and GQVEVHFRGVWN (SEQ ID NO: 36).

[0139] One or more amino acid sequences and / or peptides of the present invention contained in the conjugate can be conjugated (preferably covalently bound) to a carrier. The carrier can be an insoluble carrier. The insoluble carrier can be a solid support, which can include water-insoluble inorganic carriers such as glass beads or silica gel; organic carriers containing synthetic polymers such as cross-linked polyvinyl alcohol, cross-linked polyacrylate, cross-linked polymethacrylate, cross-linked polyacrylamide, cross-linked polycarbonate, cross-linked polysulfone, cross-linked polyethersulfone, or cross-linked polystyrene; or polysaccharides such as crystalline cellulose, cross-linked cellulose, cross-linked agarose, or cross-linked dextran; or composite carriers obtained by combining the above-mentioned compounds, such as organic-organic carriers and organic-inorganic carriers. The solid support can also be a metal support such as magnetic beads.

[0140] Preferably, the carrier may be a porous matrix having a particle size of 50 μm to 300 μm. Preferably, the solid support is Eupergit™, which are macroporous beads with a diameter of 100 μm to 250 μm made by copolymerization of N,N'-methylene-bis-(methacrylamide), glycidyl methacrylate, allyl glycidyl ether, and methacrylamide.

[0141] In a preferred embodiment, conjugates of peptide-coated Eupergit™ beads are obtained by treating polymeric beads with a solution of the peptide of the invention in a pH buffer. Preferably, the polymeric beads are incubated with the peptide of the invention in sodium phosphate buffer at room temperature.

[0142] The one or more amino acid sequences and / or peptides of the invention comprised in the conjugate may be conjugated (preferably covalently bound) to a soluble carrier such as albumin or a soluble polymer such as, for example, PEG, dextran, polysialic acid, hyaluronic acid or hydroxyethyl starch.

[0143] The conjugates of the invention can be used as medicaments, preferably in therapeutic and / or prophylactic methods for the treatment of infectious diseases, or inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious agents, in mammals or non-mammals, including humans.

[0144] Device A further aspect of the present invention relates to a device, preferably a medical device, which may also be referred to as an "adsorbent", which comprises one or more amino acid sequences or peptides of the present invention ("device of the present invention").

[0145] Therefore, the device of the present invention CD6.PD1:GTVEVRLEASW (SEQ ID NO: 1); CD6.PD2:GRVEMLEHGEW (SEQ ID NO: 2); and / or CD6.PD3:GQVEVHFRGVW (SEQ ID NO: 3); It includes one or more amino acid sequences comprising or consisting solely of the sequence, or derivatives thereof.

[0146] The devices of the invention may also comprise one or more amino acid sequences comprising peptides CD6.PD1 (SEQ ID NO: 1), CD6.PD2 (SEQ ID NO: 2), and / or CD6.PD3 (SEQ ID NO: 3). The amino acid sequence may be linear or cyclic. Preferably, the amino acid sequence is comprised within the ectodomain of human CD6. In a preferred embodiment, the amino acid sequence is comprised within SEQ ID NO: 4. In certain embodiments that may be comprised in the devices of the invention, the linear or cyclic amino acid sequence comprises 12 to 17 contiguous amino acids comprising peptides CD6.PD1 (SEQ ID NO: 1), CD6.PD2 (SEQ ID NO: 2), or CD6.PD3 (SEQ ID NO: 3), and is preferably comprised within SEQ ID NO: 4. Examples of preferred amino acid sequences include, but are not limited to, CSGTVEVRLEASWEPAC (SEQ ID NO: 13), SGTVEVRLEASWEPA (SEQ ID NO: 14), SGTVEVRLEASWEP (SEQ ID NO: 15), SGTVEVRLEASWE (SEQ ID NO: 16), SGTVEVRLEASW (SEQ ID NO: 17), GTVEVRLEASWEPA (SEQ ID NO: 18), GTVEVRLEASWEP (SEQ ID NO: 19), GTVEVRLEASWE (SEQ ID NO: 20), CAGRVEMLEHGEWGSVC (SEQ ID NO: 21), AGRVEMLEHGEWGSV (SEQ ID NO: 22), AGRVEMLEHGEWGS (SEQ ID NO: 23), AGRVEM Examples of such amino acid sequences include LEHGEWG (SEQ ID NO: 24), AGRVEMMLEHGEW (SEQ ID NO: 25), GRVEMLEHGEWGSV (SEQ ID NO: 26), GRVEMLEHGEWGS (SEQ ID NO: 27), GRVEMLEHGEWG (SEQ ID NO: 28), CEGQVEVHFRGVWNTVC (SEQ ID NO: 29), EGQVEVHFRGVWNTV (SEQ ID NO: 30), EGQVEVHFRGVWNT (SEQ ID NO: 31), EGQVEVHFRGVWN (SEQ ID NO: 32), EGQVEVHFRGVW (SEQ ID NO: 33), GQVEVHFRGVWNTV (SEQ ID NO: 34), GQVEVHFRGVWNT (SEQ ID NO: 35), and GQVEVHFRGVWN (SEQ ID NO: 36).

[0147] Preferably, the device of the present invention comprises an amino acid sequence comprising or consisting of GTVEVRLEASW (CD6.PD1, SEQ ID NO: 1), or a derivative thereof.

[0148] For example, a device of the present invention comprises an amino acid sequence comprising or consisting of GRVEMLEHGEW (CD6.PD2, SEQ ID NO: 2), or a derivative thereof.

[0149] For example, a device of the present invention comprises an amino acid sequence comprising or consisting of GQVEVHFRGVW (CD6.PD3, SEQ ID NO: 3), or a derivative thereof.

[0150] In a preferred embodiment, the device of the present invention comprises an amino acid sequence comprising or consisting solely of GTVEVRLEASW (CD6.PD1, SEQ ID NO: 1), or a derivative thereof, and an amino acid sequence comprising or consisting solely of GRVEMLEHGEW (CD6.PD2, SEQ ID NO: 2), or a derivative thereof.

[0151] In a further embodiment, the device of the present invention comprises an amino acid sequence comprising or consisting solely of GTVEVRLEASW (CD6.PD1, SEQ ID NO: 1), or a derivative thereof, and an amino acid sequence comprising or consisting solely of GQVEVHFRGVW (CD6.PD3, SEQ ID NO: 3), or a derivative thereof.

[0152] In a further embodiment, the device of the present invention comprises an amino acid sequence comprising or consisting solely of GRVEMLEHGEW (CD6.PD2, SEQ ID NO: 2), or a derivative thereof, and an amino acid sequence comprising or consisting solely of GQVEVHFRGVW (CD6.PD3, SEQ ID NO: 3), or a derivative thereof.

[0153] In a further preferred embodiment, the device of the present invention comprises an amino acid sequence comprising or consisting solely of GRVEMLEHGEW (CD6.PD2, SEQ ID NO: 2), or a derivative thereof, an amino acid sequence comprising or consisting solely of GTVEVRLEASW (CD6.PD1, SEQ ID NO: 1), or a derivative thereof, and an amino acid sequence comprising or consisting solely of GQVEVHFRGVW (CD6.PD3, SEQ ID NO: 3), or a derivative thereof.

[0154] The device of the present invention may comprise a conjugate comprising one or more amino acid sequences and / or peptides of the present invention. The conjugate is preferably one in which one or more amino acid sequences and / or peptides of the present invention are conjugated (preferably covalently bound) to a carrier, preferably a polymer, preferably an insoluble polymer.

[0155] The device is suitable for selectively binding and separating at least one component from an aqueous solution, preferably a bodily fluid such as blood, plasma, serum, or other suitable blood fraction. The aqueous solution may contain at least one component that selectively binds to and is thereby separated by the device of the present invention. For example, at least one component that may be contained in the aqueous solution (preferably a bodily fluid such as blood, plasma, serum, or other suitable blood fraction) is one or more chemical components of the surface structure of Gram- and / or Gram+ bacteria, such as endotoxins, such as LPS, LTA, and / or PGN.

[0156] The key chemical components of bacterial surface structures are (Medical Microbiology, 4th edition, Baron S, editor; Galveston (TX): University of Texas Medical Branch at Galveston; 1996): Cell wall peptidoglycan (PGN): Both G+ and G- bacteria possess cell wall peptidoglycan, which confers their characteristic cell shape and provides mechanical protection to the cell. Peptidoglycan is unique to prokaryotes and consists of a glycan backbone of muramic acid and glucosamine (both N-acetylated) and peptide chains that are highly cross-linked with bridges in G+ bacteria (e.g., Staphylococcus aureus) or partially cross-linked in G- bacteria (e.g., Escherichia coli). Cross-linking transpeptidase enzymes are some of the targets of β-lactam antibiotics. Teichoic acids (TA): Teichoic acids are highly negatively charged polyol phosphate polymers. Teichoic acids are covalently attached to peptidoglycan in some G+ bacteria. Teichoic acids are highly antigenic but are generally absent in G- bacteria. Lipoteichoic acid (LTA): As a membrane teichoic acid, LTA is a polymer of amphipathic glycophosphates and lipophilic glycolipids that is anchored in the cytoplasmic membrane. Lipoteichoic acid is antigenic, cytotoxic, and an adhesin (e.g., for Streptococcus pyogenes). Lipopolysaccharide (LPS): One of the major components of the bacterial outer membrane is lipopolysaccharide (endotoxin), a complex molecule consisting of a lipid A anchor, a polysaccharide core, and carbohydrate chains. The sugars in the polysaccharide chains confer serological specificity. Wall-Less Forms: Two groups of bacteria that lack cell wall peptidoglycan are Mycoplasma species that have surface membrane structures, and L forms that arise from either G+ bacterial cells or G- bacterial cells that have lost the ability to produce peptidoglycan structures.

[0157] Preferably, the medical device of the present invention is a hemoadsorption medical device, such as a medical device for extracorporeal removal of one or more chemical components of the surface structures of G- and / or G+ bacteria, such as endotoxins (e.g., LPS, LTA and / or PGN), during hemoperfusion.

[0158] One or more amino acid sequences or peptides of the present invention, or derivatives thereof, contained in the device of the present invention can be immobilized on a solid support, as described below. The solid support may be a water-insoluble inorganic support such as glass beads or silica gel; an organic support comprising a synthetic polymer such as cross-linked polyvinyl alcohol, cross-linked polyacrylate, cross-linked polymethacrylate, cross-linked polyacrylamide, cross-linked polycarbonate, cross-linked polycarbonate, cross-linked polysulfone, cross-linked polyethersulfone, or cross-linked polystyrene; or a polysaccharide such as crystalline cellulose, cross-linked cellulose, cross-linked agarose, or cross-linked dextran; or a composite support obtained by combining the above compounds, such as an organic-organic support or an organic-inorganic support. The solid support may also be a metal support such as magnetic beads.

[0159] The solid support may be in the form of granules, beads, fibers, fibrous membranes, a porous matrix in the form of a film or as a gel.

[0160] The solid support may be a porous matrix having a particle size of 50 μm to 300 μm. Preferably, the solid support is Eupergit™, which are macroporous beads having a diameter of 100 μm to 250 μm made by copolymerization of N,N'-methylene-bis-(methacrylamide), glycidyl methacrylate, allyl glycidyl ether, and methacrylamide.

[0161] In order to immobilize (or attach or bind or link) one or more amino acid sequences or peptides (or derivatives thereof) to the solid support, the solid support may preferably contain one or more functional groups for this purpose, representative examples of which are hydroxyl, amino, aldehyde, carboxyl, thiol, silanol, amide, epoxy, halogen, succinylimide and acid anhydride groups.

[0162] The medical device of the present invention can efficiently bind and separate at least one component from an aqueous solution that may contain at least one component. For example, the device of the present invention can capture chemical components of the surface structure of bacteria (G+ and / or G-), such as endotoxins such as LPS, LTA, and / or PGN, because the toxins can bind to one or more amino acid sequences or peptides (or derivatives thereof) of the present invention immobilized on the solid support of the device. Preferably, the device of the present invention can capture one or more chemical components of the surface structure of G- and / or G+ bacteria, such as endotoxins such as LPS, LTA, and / or PGN, which may be present in an aqueous solution selected from water, whole blood, or a bodily fluid such as plasma, serum, or other suitable blood fraction. This is achieved by passing an aqueous solution such as water, blood, or other bodily fluid through the device. For clinical use, the device is preferably applied extracorporeally.

[0163] The present invention further provides a method for the removal, preferably extracorporeal removal, of at least one component, preferably one or more chemical components of the surface structures of G− and / or G+ bacteria, such as endotoxins, such as LPS, LTA and / or PGN, from an aqueous solution potentially containing at least one component, preferably a biological fluid such as blood, plasma, serum or other suitable blood fraction, derived from an animal, such as a mammal and / or non-mammal, preferably a mammal, including a human, as described above, the method comprising: providing an aqueous solution, preferably a bodily fluid such as blood, plasma, serum or other suitable blood fraction, derived from an animal, such as a mammal and / or a non-mammal, preferably a mammal, including a human, which may contain at least one component as described above; passing an aqueous solution, preferably a bodily fluid such as blood, plasma, serum or other suitable blood fraction from an animal, such as a mammal and / or non-mammal, preferably a mammal, including a human, through the medical device of the present invention under conditions such that at least one component, preferably one or more chemical components of the surface structure of G- and / or G+ bacteria, such as endotoxins, such as LPS, LTA and / or PGN, is bound to one or more amino acid sequences or peptides, or derivatives thereof, immobilized on a solid support of the medical device, thereby removing the at least one component from the aqueous solution; Includes:

[0164] The device of the present invention can therefore be used in a method for removing, preferably extracorporeal removal of at least one component, preferably one or more chemical components of the surface structures of G- bacteria and / or G+ bacteria, such as endotoxins, such as LPS, LTA and / or PGN, from an aqueous solution, preferably a bodily fluid, such as blood, plasma, serum or other suitable blood fraction, derived from an animal, such as a mammal and / or non-mammal, preferably a mammal, including a human, as described below.

[0165] For example, the mammal may be a rodent (such as a mouse or rat), a primate (such as an ape, monkey, or lemur), a dog, a cat, a rabbit, or an ungulate such as a cow, a horse, or a pig. In a preferred embodiment, the mammal is a human. For example, the non-mammal is a chicken, a duck, a goose, an ostrich, a pigeon, a turkey, etc.

[0166] The device of the present invention can therefore be used as a medicament, preferably in therapeutic and / or prophylactic methods for the treatment of infectious diseases, inflammatory conditions associated with infectious diseases, or inflammatory diseases associated with the presence of products derived from infectious agents in mammals, including humans, or non-mammals.

[0167] The present invention therefore provides a therapeutic and / or prophylactic method for the extracorporeal removal of at least one component, preferably one or more chemical components of the surface structures of G- and / or G+ bacteria, such as endotoxins such as LPS, LTA and / or PGN, from an aqueous solution, preferably a biological fluid such as blood, plasma, serum or other suitable blood fraction, derived from an animal, preferably a mammal, including a human, or a non-mammal, for the treatment of an infectious disease, or an inflammatory condition associated with an infectious disease, or an inflammatory disease associated with the presence of a product derived from an infectious pathogen.

[0168] The therapeutic and / or prophylactic method of treatment comprises binding at least one component as described above, preferably one or more chemical components of the surface structure of G- and / or G+ bacteria, such as endotoxins such as LPS, LTA and / or PGN, to one or more amino acid sequences or peptides, or derivatives thereof, immobilized on the solid support of the medical device, and passing an aqueous solution, preferably a bodily fluid such as blood, plasma, serum or other suitable blood fraction, derived from an animal, preferably a mammal, including a human, or a non-mammal, which may contain the at least one component, through the medical device of the present invention under conditions which remove the at least one component from the aqueous solution.

[0169] In certain embodiments, the infectious disease is a microbial infection. In more particular embodiments, the microbial infection is selected from the group consisting of a bacterial infection (either G+ bacteria or G- bacteria, non-pathogenic or pathogenic, aerobic or anaerobic), a fungal infection, a viral infection, a parasitic infection, and combinations thereof (polymicrobial infections).

[0170] In another specific embodiment, the infectious disease is bacteremia. As used herein, the term "bacteremia" refers to the presence of any microorganism in the bloodstream. In particular, bacteremia is selected from the group consisting of bacteremia, fungemia, viremia, parasitemia, and combinations thereof. In another specific embodiment, the inflammatory condition is severe sepsis. In a specific embodiment, the sepsis is polymicrobial sepsis. In a specific embodiment of the invention, the inflammatory condition is SIRS (systemic inflammatory response syndrome). In another specific embodiment, the inflammatory condition is sepsis. In another specific embodiment, the inflammatory condition is septic shock. Finally, the septic shock may be endotoxin-induced septic shock.

[0171] The term "treatment" or "therapy" encompasses both prophylactic and curative methods of treating disease, since both relate to the maintenance or restoration of health. Regardless of the cause of disease, discomfort, or disability, its alleviation by administration of an appropriate agent should be construed as therapy or therapeutic use in the context of this application.

[0172] In the claims, the term "comprises" and its variations are not intended to exclude other technical features, additives, components or steps. Furthermore, the term "comprises" can also encompass the term "consisting only of."

[0173] As used herein, the term "about" means the stated value plus or minus 1% of that value, or the term "about" means the stated value plus or minus 2% of that value, or the term "about" means the stated value plus or minus 5% of that value, or the term "about" means the stated value plus or minus 10% of that value, or the term "about" means the stated value plus or minus 20% of that value, or the term "about" means the stated value plus or minus 30% of that value, and preferably, the term "about" means the exact stated value (plus or minus 0%).

[0174] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials similar or equivalent to those described herein can be used in the practice of the present invention. Additional objects, advantages, and features of the present invention will become apparent to those skilled in the art upon examination of the specification or may be learned by practice of the present invention. The following examples and figures are offered by way of illustration and are not intended to limit the invention. [Example]

[0175] Materials and Methods Production and purification of recombinant proteins and peptides The rshCD6 and rshCD5 proteins were purified using the SURE CHO-M Cell Line™ clone (Selexis SUREtechnology Platform™, Geneva, Switzerland) and a size-exclusion chromatography protocol developed at PX'Therapeutics (Grenoble, France) according to a previously published method (Sarrias MR, et al., 2004, Biochemical characterization of recombinant and circulating human Sp alpha. Tissue Antigens 63:335-44). Human and bovine serum albumin (HSA and BSA, respectively) were purchased from Sigma-Aldrich (St. Louis, MO).

[0176] Peptides (CD6.PD1, GTVEVRLEASW (SEQ ID NO: 1); CD6.PD2, GRVEMLEHGEW (SEQ ID NO: 2) and CD6.PD3, GQVEVHFRGVW (SEQ ID NO: 3); CD5.PD1, GQLEVYLKDGW (SEQ ID NO: 6); CD5.PD2, GVVEFYSGSLG (SEQ ID NO: 7); DMBT-1.pbs1, GRVEVLYRGSW (SEQ ID NO: 8); and peptide CD6 Pcons (also referred to as "Pcon," "CD6 con," "CD6.con," "CD6 cons," "PCons," or "CD6.cons," GRVEVLFRGSW (SEQ ID NO: 9) (>80% pure)) were produced by solid-phase peptide synthesis by ProteoGenix (Schiltigheim, France) and stocked at 5 mg / mL using diluted (1:3) acetonitrile.

[0177] Bacterial agglutination assay TTC buffer (50 mM Tris (pH 7.5) + 150 mM NaCl, 0.1% Tween 20, and 1 mM Ca) 2+ ) diluted to 5 × 10 8Colony-forming units (CFU) / mL were mixed (1:1) at different peptide concentrations (0 μg / mL to 200 μg / mL) in 96-well microtiter plates (Biofil) (Bikker FJ, et al., 2002, Identification of the bacteria-binding peptide domain on salivary agglutinin (gp-340 / DMBT1), a member of the scavenger receptor cysteine-rich superfamily, J Biol Chem 277:32109-15). After overnight incubation at 37°C, bacterial aggregation was examined by light microscopy and scored from - (none) to +++ (maximum) by two independent observers.

[0178] Bacterial strains Multidrug-resistant Acinetobacter baumannii clinical isolates, Enterobacter cloacae ATCC 23355, Escherichia coli ATCC 25922, Klebsiella pneumoniae ATCC 13883, Listeria monocytogenes ATCC 19111, Pseudomonas aeruginosa ATCC 27853, Staphylococcus aureus ATCC 25923, and methicillin-resistant Staphylococcus aureus (MRSA) clinical isolates were provided by Dr. Jordi Vila (Microbiology Department, Barcelona Hospital Clinic) and grown at 37°C on agar containing Luria Bertoni or 5% sheep blood (Becton Dickinson), except for Listeria monocytogenes, which was cultured in brain heart infusion medium (Pronadisa).

[0179] Binding assay Intrinsic fluorescence experiments To investigate the ability of different peptides / proteins to bind LTA (Mr = 14000, from Staphylococcus aureus) and rough LPS (Re-LPS, Mr = 2500, from Salmonella minnesota serovar Re595), binding studies were performed in an AB2 spectrofluorometer equipped with a thermostatic cuvette holder (±0.1°C) using 5 mm × 5 mm pathlength quartz cuvettes as described (Coya JM, et al., 2015, Natural Anti-Infective Pulmonary Proteins: In Vivo Cooperative Action of Surfactant Protein SP-A and the Lung Antimicrobial Peptide SP-BN, J Immunol 195:1628-36). Re-LPS concentrations were assessed by quantification of 2-keto-3-deoxyoctouronic acid (Garcia-Verdugo I, et al., 2003, Effect of hydroxylation and N187-linked glycosylation on molecular and functional properties of recombinant human surfactant protein A, Biochemistry 42:9532-42). Peptide / protein samples (10 μg / mL) were titrated with different amounts of stock solutions of either LTA or Re-LPS in phosphate-buffered saline (PBS) (pH 7.2), and Trp fluorescence emission spectra were recorded at 295 nm excitation. Fluorescence intensity readings were corrected for the dilution caused by the addition of peptide / protein. The background intensity of the peptide / protein-free sample, attributed to LTA or Re-PS, was subtracted from each recording. The apparent dissociation constant (K) of the peptide / protein-ligand complex was calculated. d) was obtained by fitting the Hill equation of the change in peptide fluorescence at 353 nm with the amount of LTA or Re-LPS added using the nonlinear least-squares method (Garcia-Verdugo I, et al., 2003, Effect of hydroxylation and N187-linked glycosylation on molecular and functional properties of recombinant human surfactant protein A, Biochemistry 42:9532-42): ΔF / ΔF max =[L] n / ([L] n +K d ) where ΔF is the change in fluorescence intensity at 353 nm relative to the intensity of the free peptide, and F max where is the change in fluorescence intensity at saturating LTA or Re-LPS concentrations, [L] is the molar concentration of free ligand, and n is the Hill coefficient).

[0180] Solid-phase binding assay Ninety-six-well microtiter plates (Nunc, Roskilde, Denmark) were coated with 5 μg / mL purified LPS (Escherichia coli O111:B4, Sigma L2630) or LTA (Staphylococcus aureus, Sigma L2515) in PBS overnight at 4°C, followed by incubation in blocking solution (20 mM Tris-HCl (pH 7.4) + 0.05% Tween 20 and 1% BSA) for 2 h at room temperature. Biotin-labeled peptides / proteins (2.5 μg / mL–20 μg / mL) were added and incubated in blocking solution overnight at 4°C. After extensive washing, bound peptides / proteins were detected by the addition of horseradish peroxidase (HRP)-conjugated streptavidin (1:5000 dilution; DAKO) for 1 h at room temperature. Color was developed by adding 3,3′,5,5′-tetramethylbenzidine (TMB) liquid substrate (Sigma), and the optical density was read at 405 nm to 620 nm.

[0181] Dynamic Light Scattering (DLS) The hydrodynamic diameter of the peptides (10 μg / mL in PBS) was measured at 25°C on a Zetasizer Nano S (Malvern Instruments, Worcestershire, UK) equipped with a 633 nm HeNe laser as described (Saenz A, et al., 2010, Fluidizing effects of C-reactive protein on lung surfactant membranes: protective role of surfactant protein A, FASEB J 24:3662-73). Four scans were recorded per sample, and samples were analyzed in triplicate.

[0182] in vitro cell culture Spleens from 6- to 8-week-old C57BL / 6 mice (Charles River) were disaggregated by filtering through a cell strainer. After red blood cell lysis, cells were resuspended in RPMI 1640 containing L-glutamine (Lonza) plus 10% fetal bovine serum (BioWest), 100 U / mL penicillin, 100 μg / mL streptomycin, and 50 μM 2-β-mercaptoethanol (Merck). Cells (2 × 10 cells / well) were cultured in U-bottom 96-well plates (Biofil) for 48 h (37°C in a humidified atmosphere of 5% CO) containing LPS (0.5 μg / mL; E. coli O111:B4) with increasing amounts of peptide (0.5 μg / mL to 20 μg / mL) or in the absence of peptide. 5 ) were stimulated. Culture supernatants were collected, and mouse cytokines were measured by ELISA according to the manufacturer's instructions (BD Biosciences OptEIA set).

[0183] Cecal Ligation and Perforation (CLP) Procedure Animal procedures were approved by the Animal Experimental Ethics Committee of the University of Barcelona. CLP-induced septic shock, which has a high mortality rate (more than 90% within the first 48 to 72 hours), was induced in 8- to 10-week-old C57BL / 6J male mice (20 to 25 g; Charles River) as previously described (25).

[0184] To assess bacterial burden, blood and spleen samples were collected from CLP-treated mice, homogenized, and diluted aseptically in sterile PBS. Serial dilutions were plated overnight on agar containing 5% sheep blood (Becton Dickinson) at 37°C. Viable bacterial counts were expressed as CFU / mL (blood) or per mg (spleen).

[0185] Immobilization of proteins / peptides on Eupergit™ beads Proteins or peptides (2.5 mg each) were immobilized via NH groups onto macroporous acrylic EUPERGIT™ beads (0.2 g, Roehm-Pharma GmbH, Germany) according to a previously described protocol (Zimmermann M, et al., 1999, Endotoxin adsorbent based on immobilized human serum albumin. Clin Chem Lab Med 37:373-379). Peptide- or protein-coated EUPERGIT™ beads were obtained by incubating the polymer beads with a solution of the peptide of the present invention in 100 mM sodium phosphate buffer (pH 8) at room temperature with stirring for 24 hours. After incubation, the beads were washed three times with 3 M sodium chloride (pH 7.0), 30 mM sodium phosphate buffer (pH 4.0), and 30 mM sodium phosphate buffer (pH 8.0). Finally, 154 mM sodium chloride solution (pH 7.0) was added to the peptide- or protein-coated beads.

[0186] Endotoxin assay LPS detection was performed using the turbidimetric Limulus Amebocyte Lysate (LAL) kit-QCL (50 U–650 U, Lonza) according to the manufacturer's instructions. Protein / peptide-coated EUPERGIT™ beads were incubated 1:1 (volume:volume) with the prepared endotoxin solution (50 UI / mL) for different periods (0 min–150 min) at room temperature according to the manufacturer's instructions.

[0187] statistical analysis Survival assays were calculated using GraphPad Prism software as log-rank χ 2 The significance of differences between experimental groups was determined by a two-tailed paired T-test with a 95% confidence interval (CI). P values ​​were considered significant when P<0.05. Statistical analysis (mean ± SEM) was performed using a two-tailed Mann-Whitney test with a 95% CI.

[0188] result Example 1. In vitro and in vivo evidence supporting the broad bacterial binding properties of CD6-derived peptides Induction of bacterial aggregation by CD6-derived peptides The CD6-derived peptides studied in this study (CD6.PD1, CD6.PD2, and CD6.PD3, respectively) mapped to SRCR domains 1 to 3, as well as other peptides (CD6.cons, DMBT1.pbs1, CD5.PD1, and CD5.PD2), and the protein (rshCD6(DQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTP)) were also used. ELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLH FTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYY SCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESR, SEQ ID NO: 10) and rshCD5 (RLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVV The sequence and physiochemical properties of CD6.PD1 (EFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQD, SEQ ID NO: 11) are collected in Figure 1A. In silico structural analysis, shown in Figure 1B, indicated that all CD6 peptides are accessible on the surface of CD6, with CD6.PD1 (and CD6.PD3) exposed opposite CD6.PD2.As shown in Figure 1C, the amino acid conservation of CD6-derived peptides among different animal species is relatively high for CD6.PD2 and CD6.PD3, but low for CD6.PD1.

[0189] None of the CD6-derived peptides perfectly matched the minimal 9-mer consensus motif (VEVLxxxxW) previously reported for the DMBT-1 / SAG protein. The functionality of the CD6-derived peptides was examined in bacterial agglutination assays, in which the DMBT1.pbs1 (also referred to as DMBT-1.pbs1 or pbs1) and CD6.cons (also referred to as CD6 cons or PCon) peptides were used as positive controls (Non-Patent Document 9). A similar peptide sequence (CD5.PD2) present in the second SRCR domain of CD5 (a highly homologous lymphocyte receptor with no reported bacterial-binding properties) was used as a negative control. As shown in Figures 2A and 2B, dose-dependent agglutination of different G+ and G- bacterial suspensions (including MDR strains) was observed with CD6.PD1 and CD6.PD3, but not with CD6.PD2.

[0190] CD6-derived peptides directly interact with PAMPs that comprise G- and G+ bacteria with different affinities The binding of biotin-labeled CD6-derived peptides to solid phases adsorbed with LPS or LTA was tested by ELISA. As shown in Figures 3A and 3B, all CD6-derived peptides showed dose-dependent binding to LPS and LTA, as did the DMBT1.pbs1 and CD6.cons peptides used as positive controls. However, the CD6.PD3 peptide exhibited superior binding to both immobilized LPS and LTA compared to the other peptides tested. As expected, no significant binding was observed with the CD5.PD1 peptide or rshCD5 protein. These results confirm that the CD6-derived peptides retain their binding properties to LPS and LTA.

[0191] To further validate and measure binding, the underlying affinities of the interactions of CD6-derived peptides (CD6.PD1, CD6.PD2, and CD6.PD3) with LPS and LTA, as well as the corresponding K d The K value was determined by tryptophan fluorescence. The consensus sequences DMBT1.pbs1 and CD6.Pcons (also called Pcons or Pcon, SEQ ID NO: 9, GRVEVLFRGSW) described by Non-Patent Document 9 were also included in this experiment. As summarized in Figure 4, all CD6-derived peptides showed high affinity for both LPS and LTA, with CD6.PD1 and / or CD6.PD2 being higher than CD6.PD3 (PD1 ≥ PD2 > PD3). The K values ​​of CD6.PD1 and CD6.PD2 d These values ​​are lower than those of the prototypic DMBT1.pbs1 and CD6.cons peptides or the rshCD6 protein itself. Taken together, the binding results clearly support a direct and substantial interaction of CD6-derived peptides with essential cell wall components of G- and G+ bacterial strains.

[0192] To determine whether the self-aggregation properties of CD6-derived peptides are related to their aggregation properties, we analyzed the hydrodynamic size of CD6-derived peptides in solution using DLS. The results show that CD6-derived peptides formed particles with different hydrodynamic sizes depending on their self-aggregation properties (Figure 5). CD6.PD3 particles showed two peaks at 630 ± 3 nm and 5151 ± 7 nm, indicating self-aggregation. A similar situation applies to CD6.PD1 (two peaks at 321 ± 5 nm and 1484 ± 8 nm), CD6.cons (two peaks at 1636 ± 6 nm and 5493 ± 7 nm), and DMBT1.pbs1 (two peaks at 169 ± 5 nm and 617 ± 4 nm). In contrast, CD6.PD2 showed a single peak centered at 379 ± 5 nm, consistent with its lower bacterial aggregation properties compared to other CD6- and DMBT1-derived peptides.

[0193] Next, we investigated the functional relevance of the interaction of CD6-derived peptides with key pathogenic bacterial products ex vivo. To this end, we tested the modulatory effects of increasing concentrations of CD6 peptides on cytokine release by mouse splenocytes exposed to LPS. As shown in Figure 6, only the CD6.PD3 and CD6.cons peptides exhibited a dose-dependent inhibitory effect on the release of inflammatory IL-6 and IL-1β cytokines, reaching statistical significance in the former case. The same CD6.PD3 (but not CD6.cons) peptide also induced a statistically insignificant dose-dependent increase in the release of the anti-inflammatory cytokine IL-10.

[0194] In vivo efficacy of CD6-derived peptides in CLP-induced septic shock The in vivo effects of CD6-derived peptides were tested in mice undergoing CLP-induced septic shock (Rittirsch D, et al., 2009, Immunodesign of experimental sepsis by cecal ligation and puncture, Nat Protoc 4:31-6). To this end, C57BL / 6 mice were injected with a single intravenous (iv) dose (6 mg / kg) of different peptides 1 hour after CLP induction and subsequently monitored for survival. As shown in Figure 7A, mice injected with CD6.PD2 (12.5%, P < 0.0005) and CD6.PD3 (36.36%, P < 0.0001) showed significantly increased survival compared with saline treatment, and this was also observed in mice injected with the DMBT-1.pbs1 (23.07%, P < 0.0025) and CD6.cons (25%, P < 0.0101) peptides (Figure 7B). The CD6.PD1 peptide had no significant effect on mouse survival.

[0195] Because the in vivo protective properties of CD6.PD3 against septic shock were superior to those of CD6.PD1 and CD6.PD2, we conducted additional experiments to explore its time-, dose-, and systemic route-dependent effects. As shown in Figures 8A and 8B, the maximum survival rate after CLP was achieved after CD6.PD3 injection at doses of 6 mg / kg or 12 mg / kg (37.5% and 40%, respectively, compared with 23.08% at 3 mg / kg) and at +1 hour after CLP induction (40% compared with 20% at +3 hours). When the CD6.PD3 peptide was injected under optimal conditions (6 mg / kg +1 hour after CLP), no significant difference was observed between intravenous (i.v.) and intraperitoneal (i.p.) routes (Figure 8C).

[0196] Next, we further monitored the effects of optimal CD6.PD3 peptide infusion conditions on serum cytokine levels and bacterial burden after CLP. To this end, C57BL / 6 mice undergoing CLP-induced septic shock were treated with saline or CD6.PD3 peptide (a single iv infusion of 6 mg / kg at +1 h after CLP) and then sacrificed by bleeding 4 and 20 h later, respectively. As shown in Figure 9A, CD6.PD3-treated mice exhibited significantly lower levels (P < 0.05) of the inflammatory cytokines IL-1β, IL-6, and TNF-α at 20 h after CLP compared with the saline-treated group. Similarly, the same CD6.PD3-treated mice also exhibited reduced CFUs isolated from the blood and spleen when sacrificed at 20 h after CLP compared with the saline control group (Figure 9B). These results indicate that the CD6.PD3 peptide retains the therapeutic properties reported for the rshCD6 protein in an experimental model of septic shock (Non-Patent Document 25). This was also true for septic mice treated with CD6.PD3 and the broad-spectrum bactericidal antibiotic imipenem / cilastatin (I / C). As shown in Figure 10, combined administration of CD6.PD3 (6 mg / kg iv) and imipenem / cilastatin (50 mg / kg / 12 h ip) at +1 h after CLP-induced septic shock resulted in a statistically significant additive / synergistic effect on mouse survival (90.9%) compared with either CD6.PD3 (30.8%; P = 0.018) or I / C (44.4%; P = 0.0015) administered individually.

[0197] Consideration This example demonstrates that short (11-mer long) CD6-derived intradomain peptides retain the in vitro and in vivo bacterial recognition properties of the native CD6 protein. These sequences (CD6.PD1, CD6.PD2, and CD6.PD3) map to surface-accessible sites in the three SRCR domains of CD6 and are homologous to an 11-mer consensus peptide (pbs1) identified in the DMBT-1 / SAG protein (Non-Patent Document 9).

[0198] i) Similar homologous sequences from several SRCR-SF members with a minimal VEVLxxxxW consensus motif do not bind to bacteria (Non-Patent Document 9), whereas ii) none of the CD6-derived peptides perfectly match the consensus motif described above, and all three CD6-derived peptides bind to K d They interact with both LPS and LTA, albeit differently, and with a variety of in vitro and in vivo functional properties (e.g., bacterial aggregation or prevention of CLP-induced death).

[0199] The CD6.PD3 peptide performed better in vivo when assayed therapeutically in a mouse model of CLP-induced septic shock than other CD6-derived peptides (P = 0.04 for CD6.PD2 and P = 0.0005 for CD6.PD1). CD6.PD3 was also superior to the prototypic DMBT-1.pbs1 peptide or the CD6.cons sequence, although the difference did not reach statistical significance (P = 0.1). Another striking finding is the statistically significant additive / synergistic effect of the CD6.PD3 peptide on mouse survival when coadministered with imipenem / cilastatin, a member of the carbapenem family considered first-line treatment in critical care patients experiencing sepsis (Verwaest C, 2000, Belgian Multicenter Study Group. Meropenem versus imipenem / cilastatin as empirical monotherapy for serious bacterial infections in the intensive care unit, Clin Microbiol Infect 6:294-302). Thus, CD6.PD3, which captures most of the antibacterial properties of rshCD6, constitutes a cost-effective alternative to the latter as well as an excellent adjunct strategy to antibiotic therapy.

[0200] In conclusion, our findings demonstrate that a short (11-mer) peptide sequence can preserve the bacterial-binding properties of the entire extracellular domain of CD6, opening up cost-effective opportunities for developing novel alternatives to currently available sepsis treatments. The complex physiology of the sepsis response necessitates multidisciplinary, simultaneous investigation of the various time-dependent factors that determine short- and long-term sepsis outcomes.

[0201] Example 2. Adsorption of circulating bacterial toxins by CD6-derived peptides covalently bound to a solid phase result The results obtained by incubating an endotoxin solution (50 UI / mL LPS) with Eupergit™ beads coated with different CD6-derived peptides (CD6.PD2, CD6.PD3, and CD6.cons) or proteins (HSA (UniProtKB-P02768, SEQ ID NO: 12), rshCD5, and rshCD6) for different periods of time are shown in Figure 11. Beads coated with CD6.PD2, CD6.PD3, and rshCD6 reduced endotoxin levels (as detected by LAL assay) compared to controls coated with HSA and rshCD5.The use of CD6-derived peptides for extracorporeal hemoperfusion has advantages over existing devices such as polymyxin B-immobilized fiber hemopurification columns (Esteban E, et al., 2013, Immunomodulation in sepsis: the role of endotoxin removal by polymyxin B-immobilized cartridge, Mediators Inflamm 2013:507539), namely: i) the reported affinity of the LPS / polymyxin B interaction (K, depending on the G-strain used). d 100nM-900nM) (McInerney MP, et al., 2016, Quantitation of Polymyxin-Lipopolysaccharide Interactions Using an Image-Based Fluorescent Probe, J Pharm Sci; 105:1006-10) is lower than CD6.PD1 and CD6.PD2 (K d 3.5±0.3 nM and 35±2 nM), and ii) polymyxin B binds primarily to LPS, but also to CD6.PD1 and CD6.PD2, respectively. d It binds LTA with affinities of 0.39±0.06 nM and 0.31±0.04 nM. Therefore, CD6-derived peptides can be used in cases of G+ infections, which are responsible for more than 50% of sepsis cases (Martin GS, 2012, Sepsis, severe sepsis, and septic shock: changes in incidence, pathogens, and outcomes, Expert Rev Anti Infect Ther 10:701-6).

Claims

1. A pharmaceutical composition comprising one or more peptides, each consisting of at least one isolated amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:1, and SEQ ID NO:2, or derivatives thereof, The pharmaceutical composition, wherein the derivative of the peptide consisting of the isolated amino acid sequence differs from the isolated amino acid sequence only in at least one modification selected from the group consisting of N-acylation and / or C-amidation or C-esterification, N-alkylation, substitution of one or more L-amino acids with D-amino acids, conjugation to one or more polymers (e.g., polyethylene glycol (PEG) or albumin), and capping of the N-terminus or C-terminus with a Cys residue.

2. 2. The pharmaceutical composition according to claim 1, wherein the pharmaceutical composition is a solid composition, preferably in the form of a tablet, pill, capsule or granule, or a liquid composition, preferably in the form of a solution, suspension or emulsion.

3. The pharmaceutical composition according to claim 1 or 2, wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, a pharmaceutically acceptable salt, an adjuvant and / or a suitable excipient.

4. A conjugate comprising one or more peptides, each consisting of at least one isolated amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:1, and SEQ ID NO:2, or derivatives thereof, A conjugate, wherein the derivative of a peptide consisting of the isolated amino acid sequence differs from the isolated amino acid sequence only in at least one modification selected from the group consisting of N-acylation and / or C-amidation or C-esterification, N-alkylation, substitution of one or more L-amino acids with D-amino acids, conjugation to one or more polymers (e.g., polyethylene glycol (PEG) or albumin), and capping of the N-terminus or C-terminus with a Cys residue.

5. The conjugate of claim 4, wherein the peptide, or a derivative thereof, is conjugated to a polymer, such as a soluble polymer, or preferably an insoluble polymer.

6. 1. A kit of parts comprising one or more peptides, each consisting of at least one isolated amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:1 and SEQ ID NO:2, or derivatives thereof, and an antibiotic, preferably further comprising a dehydropeptidase inhibitor or a β-lactamase inhibitor, The derivative of the peptide consisting of the isolated amino acid sequence differs from the isolated amino acid sequence only in at least one modification selected from the group consisting of N-acylation and / or C-amidation or C-esterification, N-alkylation, substitution of one or more L-amino acids with D-amino acids, conjugation with one or more polymers (e.g., polyethylene glycol (PEG) or albumin), and an N-terminus or C-terminus capped with a Cys residue.

7. 7. The kit of parts of claim 6, wherein the antibiotic is imipenem and / or the dehydropeptidase inhibitor or β-lactamase inhibitor is cilastatin.

8. A pharmaceutical composition according to any one of claims 1 to 3, a conjugate according to claim 4 or 5, or a kit of parts according to claim 6 or 7 for use as a medicament.

9. A pharmaceutical composition according to any one of claims 1 to 3, a conjugate according to claim 4 or 5 or a kit of parts according to claim 6 or 7 for the treatment of an infectious disease or an inflammatory condition caused by an infectious disease or an inflammatory disease caused by a component of an infectious pathogen in mammals, including humans, and / or non-mammals.

10. 10. The pharmaceutical composition, conjugate or kit of parts for use according to claim 9, wherein said infectious disease is a microbial infection, preferably bacteremia, and / or said inflammatory condition is systemic inflammatory response syndrome or sepsis, and / or said infectious pathogen is selected from the group consisting of bacteria, fungi, viruses, parasites, and combinations thereof.

11. 1. A device for selectively binding and separating at least one component from an aqueous solution, the device comprising one or more peptides each consisting of at least one isolated amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:1 and SEQ ID NO:2, or derivatives thereof, preferably said device comprising peptides each consisting of the amino acid sequences of SEQ ID NO:3, SEQ ID NO:1 and SEQ ID NO:2, The derivative of the peptide consisting of the isolated amino acid sequence differs from the isolated amino acid sequence only in at least one modification selected from the group consisting of N-acylation and / or C-amidation or C-esterification, N-alkylation, substitution of one or more L-amino acids with D-amino acids, conjugation to one or more polymers (e.g., polyethylene glycol (PEG) or albumin), and capping of the N-terminus or C-terminus with a Cys residue.

12. 12. The device according to claim 11, wherein said at least one component is a chemical component of the surface structure of Gram- and / or Gram+ bacteria, preferably selected from the group consisting of LPS, LTA and PGN.

13. 1. A method for removing at least one component from an aqueous solution, comprising: providing an aqueous solution potentially containing said at least one component; removing said at least one component from said aqueous solution by passing said aqueous solution through said device under conditions that result in binding of said at least one component to one or more of said amino acid sequences contained in said device according to claim 11 or 12; A method comprising:

14. 14. The method of claim 13, wherein said at least one component is a chemical component of the surface structure of Gram- and / or Gram+ bacteria, preferably selected from the group consisting of LPS, LTA and PGN, and / or said aqueous solution is a body fluid, preferably blood, plasma, serum or other suitable blood fraction, derived from an animal, such as a mammal, preferably a human, and / or a non-mammal.

15. 15. The method according to claim 13 or 14, wherein said method is for the extracorporeal removal of at least one chemical component of Gram- bacterial and / or Gram+ bacterial surface structures such as LPS, LTA and / or PGN from a body fluid, preferably blood, plasma, serum or other suitable blood fraction, derived from an animal, such as a mammal, preferably a human, and / or a non-mammal.

Images