Biomarkers for idiopathic pulmonary fibrosis, and methods for their production and use.

Biomarkers like TIMP1, HA, and PIIINP, combined with immunoassays and algorithms, offer a reliable and non-invasive solution for diagnosing and monitoring IPF, improving patient care by reducing the need for lung biopsies and enabling continuous monitoring.

JP7843369B2Active Publication Date: 2026-04-09SIEMENS HEALTHCARE DIAGNOSTICS INC
View PDF 4 Cites 0 Cited by

Patent Information

Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Filing Date
2023-04-19
Publication Date
2026-04-09

AI Technical Summary

Technical Problem

There are no reliable blood-based biomarkers for diagnosing and monitoring the progression of idiopathic pulmonary fibrosis (IPF), making it difficult for clinicians to predict the disease course and treatment effectiveness.

Method used

Development of biomarkers such as tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP) for use in blood samples, along with immunoassays and algorithms to determine an IPF score for point-of-care diagnosis and monitoring.

Benefits of technology

Provides a reliable and non-invasive method for diagnosing and monitoring IPF, reducing the need for risky lung biopsies and enabling continuous monitoring of disease progression and treatment effectiveness.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 0007843369000003
    Figure 0007843369000003
  • Figure 0007843369000004
    Figure 0007843369000004
  • Figure 0007843369000005
    Figure 0007843369000005
Patent Text Reader

Abstract

A method for determining the presence, severity, and / or predisposition to idiopathic pulmonary fibrosis (IPF) in an individual is disclosed. The method utilizes at least one diagnostic marker of the dynamic process of extracellular matrix synthesis and / or extracellular matrix degradation from said sample. The at least one diagnostic marker can be selected from the group consisting of tissue inhibitor of metallopeptidase 1 (TIMP1), hyaluronan (HA), and / or type III procollagen N-terminal propeptide (PIIINP).
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] Cross-reference of related applications This application claims priority or benefit under U.S. Provisional Patent Application No. 63 / 363,282, filed on April 20, 2022, 35 U.S.C. § 119, the contents of which are incorporated herein by reference in their entirety.

[0002] Sequence List The sequences referred to herein are listed in a sequence listing submitted as a 5KB ASCII text file named "biomarker_ST25a.xml," created on April 19, 2023, which is incorporated herein by reference in its entirety. [Background technology]

[0003] Idiopathic pulmonary fibrosis (IPF) is a life-threatening fibrous lung disease of unknown etiology, affecting up to 185,000 people in the United States. There is no effective treatment for IPF, and it has a fairly high morbidity and mortality rate. The etiology of IPF is not fully understood. Initially, IPF was thought to be caused by systemic pneumonia leading to fibrosis, but the current theoretical framework has shifted to dysfunction of alveolar epithelial cells and irregular fibrosis.

[0004] While the median survival time is 2–3 years, the disease course is wide-ranging and can be generalized into three categories: stable or very slow debilitation, rapid deterioration, and stable periods interspersed with periods of debilitation. Currently, there are no recognized substitutes for these clinical courses, making it difficult for clinicians to predict the disease course of individual patients.

[0005] Biomarkers act as surrogates for clinically meaningful outcomes, which may or may not reflect the underlying etiology of a disease. Examples of clinical utility include diagnosis, prediction of disease progression or regression, and prognosis of mortality. Biomarkers should be easy to obtain, reliable to measure, and available for continuous monitoring. Ideally, biomarkers would also offer the advantages of currently used clinical measures in terms of ease of use, timeframe, and / or cost. [Overview of the project] [Problems that the invention aims to solve]

[0006] However, no reliable blood-based biomarkers have been identified as effective individual or combined biomarkers (blood-based, imaging, or patient clinical data) that are helpful in the diagnosis and progression of IPF. [Means for solving the problem]

[0007] Therefore, biomarkers and assays for IPF are needed in the art. This disclosure covers compositions / devices / assays containing such biomarkers, as well as reagents for measuring said biomarkers, along with methods for using them.

[0008] The embodiments of this disclosure, briefly summarized above and described in more detail below, can be understood by referring to exemplary embodiments of this disclosure depicted in the accompanying drawings. However, the accompanying drawings show only typical embodiments of this disclosure and should not be considered limiting in scope, as this disclosure may also permit other equally valid embodiments. [Brief explanation of the drawing]

[0009] [Figure 1]The receiver operating curve (ROC) shown in this disclosure is a graph that represents the predicted value of tissue metallopeptidase inhibitor 1 (TIMP1) alone, which is a biomarker for identifying IPF. [Figure 2] An exemplary block diagram of computer system 1100 is shown. [Figure 3] An illustrative flowchart of Method 1200 is shown. [Figure 4] An illustrative flowchart of Method 1300 is shown. [Modes for carrying out the invention]

[0010] For ease of understanding, the same reference numerals are used to indicate identical elements common to the drawings where possible. The drawings are not drawn to scale and may be simplified for clarity. Elements and features of one embodiment can be incorporated advantageously into other embodiments without further detail.

[0011] Before describing in detail at least one embodiment of this disclosure by illustrative language and results, it should be understood that in its application, this disclosure is not limited to the details of the construction and arrangement of the components described below. Other embodiments of this disclosure are possible, or can be practiced or implemented in various ways. Therefore, the language used herein is intended to give the broadest possible scope and meaning; the embodiments are intended to be illustrative, not exhaustive. It should also be understood that the expressions and terminology used herein are for illustrative purposes only and should not be considered limiting.

[0012] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings commonly understood by those of ordinary skill in the art. Further, unless the context requires otherwise, singular terms shall include the plural, and plural terms shall include the singular. The foregoing methods and procedures are generally carried out in accordance with conventional methods well known in the art and are carried out as described in various general and more specific references cited and discussed throughout this specification. The nomenclature utilized in connection with analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry as described herein, as well as their experimental procedures and techniques, are well known and generally used in the art.

[0013] All patents, published patent applications, and non-patent publications referred to herein are indicative of the level of skill of those of ordinary skill in the art to which the present disclosure pertains. All patents, published patent applications, and non-patent publications referenced in any part of this application are hereby expressly incorporated by reference in their entirety to the same extent as if each individual patent or publication was specifically and individually indicated to be incorporated by reference.

[0014] All of the compositions, devices, kits, and / or methods disclosed herein can be made and executed without undue experimentation in light of the present disclosure. Although the compositions, devices, kits, and / or methods are described with respect to specific embodiments, it will be apparent to those of ordinary skill in the art that changes can be made to the compositions, devices, kits, and / or methods, and to the order of steps of the methods, described herein without departing from the concept, spirit, and scope of the present disclosure. All such similar substitutions and modifications apparent to those of ordinary skill in the art are deemed to be within the scope of the spirit, scope, and concept of the present disclosure as defined by the appended claims.

[0015] When used in accordance with the present disclosure, the following terms shall be understood to have the following meanings unless otherwise indicated.

[0016] The use of the terms "a" or "an" can mean "one" when used in conjunction with the term "comprising" in the claims and / or the specification, but is also consistent with the meanings of "one or more", "at least one", and "one or more than one". Accordingly, the terms "a", "an", and "the" include plural referents unless the context clearly indicates otherwise. Thus, for example, a reference to "a compound" can refer to one or more compounds, two or more compounds, three or more compounds, four or more compounds, or a greater number of compounds. The term "plural" refers to "two or more".

[0017] The use of the term "at least one" will be understood to include any quantity of two or more, including but not limited to one, two, three, four, five, ten, fifteen, twenty, thirty, forty, fifty, one hundred, etc. The term "at least one" may be extended to 100 or 1000 or more depending on the term to which it is attached; in addition, the quantities 100 / 1000 should not be considered limiting as higher limits may also yield satisfactory results. In addition, the use of the term "at least one of X, Y, and Z" will be understood to include only X, only Y, and only Z, as well as any combination of X, Y, and Z.

[0018] The use of ordinal terms (i.e., "first", "second", "third", "fourth", etc.) is for the sole purpose of distinguishing two or more items and does not imply any order or sequence or importance of one item as compared to another item, nor any further ranking, unless expressly stated otherwise.

[0019] The use of the term “or” in the claims is used to mean an inclusive “and / or” unless it is explicitly indicated that it refers only to substitutes, or unless the substitutes are mutually exclusive. For example, the condition “A or B” is satisfied by any of the following: A is true (or exists) and B is false (or does not exist); A is false (or does not exist) and B is true (or exists); and both A and B are true (or exist).

[0020] Where used herein, any reference to “one embodiment,” “one embodiment,” “some embodiments,” “one example,” “for example,” or “one example” means that any particular element, feature, structure, or characteristic described in relation to an embodiment is included in at least one embodiment. For example, the phrases “in some embodiments” or “one example” appearing in different parts of this specification do not necessarily all refer to the same embodiment. Furthermore, all references to one or more embodiments or examples should be construed as not limiting the scope of the claims.

[0021] Throughout this application, the term “approximately” is used to indicate that a given value includes an inherent error variability with respect to the variability present between a composition / apparatus / device, the method used to determine the value, or the subject of test. For example, but not limited to, when the term “approximately” is used, a given value may differ from a given value by plus or minus 20%, or 15%, or 12%, or 11%, or 10%, or 9%, or 8%, or 7%, or 6%, or 5%, or 4%, or 3%, or 2%, or 1%, such variability is appropriate for performing the disclosed method and is understood by those skilled in the art.

[0022] The term “antibody” is used herein in its broadest sense and refers to, for example, complete monoclonal and polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), antibody fragments and their conjugates exhibiting desired biological activity such as analyte binding (e.g., Fab, Fab', F(ab')2, Fv, scFv, Fd, diabody, single-chain antibodies, and other antibody fragments and their conjugates that retain at least a portion of the variable region of a complete antibody), antibody-substituted proteins or peptides (i.e., engineered binding proteins / peptides), and combinations or derivatives thereof. Antibodies may be of any type or class (e.g., IgG, IgE, IgM, IgD, and IgA) or subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2).

[0023] Biomarker: The terms “biomarker” or “biological marker” are used herein, in accordance with their use in the Art, to refer to entities whose presence, level, or form correlates with a particular biological event or condition of interest, and which are consequently considered to be “markers” of that event or condition. To give a few examples, in some embodiments, a biomarker may be, or may include, a marker of a particular disease condition, or of the likelihood of a particular disease, disorder, or condition developing, occurring, or recurring. In some embodiments, a biomarker may be, or may include, a marker of a particular disease or treatment outcome, or the likelihood thereof. Thus, in some embodiments, a biomarker predicts the relevant biological event or condition of interest, in some embodiments, a biomarker prognoses it, and in some embodiments, a biomarker diagnoses it. In some embodiments, a biomarker is a possible biomarker for the relevant biological event or condition of interest. A biomarker may be an entity of any chemical class. For example, in some embodiments, a biomarker may be, or may include, a nucleic acid, polypeptide, small molecule, or a combination thereof. In some embodiments, a biomarker is a cell surface marker. In some embodiments, the biomarker is intracellular. In some embodiments, the biomarker is found in a specific tissue (e.g., lung tissue). In some embodiments, the biomarker is found extracellularly (e.g., secreted or otherwise produced or present outside the cell in bodily fluids such as blood, urine, tears, saliva, or cerebrospinal fluid).

[0024] As described herein, in some embodiments, the biomarker is an IPF biomarker. As used herein, “IPF biomarker” refers to a biological marker of idiopathic pulmonary fibrosis (IPF). In some embodiments, one or more IPF biomarkers include tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof. In various embodiments, the IPF biomarker includes a gene product associated with a specific enumerated biomarker. For example, depending on the context, “TIMP1” refers to a nucleotide encoding TIMP1 or a characteristic or functional fragment thereof, as well as the TIMP1 protein or a characteristic or functional fragment thereof.

[0025] Characteristic Fragment: The term “characteristic fragment” refers to a fragment of a biomarker (e.g., an IPF biomarker) that is sufficient to identify the biomarker from which the fragment originated. For example, in some embodiments, a “characteristic fragment” of a biomarker includes an amino acid sequence, or a set of amino acid sequences that together enable, to distinguish the biomarker from which the fragment originated from other possible biomarkers, proteins, or polypeptides. In some embodiments, a characteristic fragment includes at least 10, at least 20, at least 30, at least 40, or at least 50 amino acids. In various embodiments, a characteristic fragment refers to a fragment of a biomarker that has at least 90%, at least 95%, or at least 99% sequence identity with respect to the biomarker from which the characteristic fragment originated.

[0026] Gene product or expression product: As used herein, the term “gene product” generally refers to RNA transcribed from a gene (before and / or after processing), or a polypeptide encoded by RNA transcribed from a gene (before and / or after modification).

[0027] Hybridization: The term "hybridization" refers to the physical properties of a single-stranded nucleic acid molecule (e.g., DNA or RNA) annealing with a complementary nucleic acid molecule. Hybridization can be evaluated under a variety of circumstances, including when the interacting nucleic acid molecules are tested in isolation or in relation to more complex systems (e.g., while covalently or otherwise bound to a carrier entity, and / or in a biological system or cell). In some embodiments, hybridization can be detected by hybridization techniques, such as techniques selected from the group consisting of in-situ hybridization (ISH), microarrays, Northern blotting, and Southern blotting. In some embodiments, hybridization refers to 100% annealing between the single-stranded nucleic acid molecule and the complementary nucleic acid molecule. In some embodiments, annealing is less than 100% (e.g., at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, and at least 70% of the single-stranded nucleic acid molecule anneal with the complementary nucleic acid molecule). Hybridization techniques and methods for evaluating hybridization are well known in the art. See, for example, Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 2nd edition, Cold Spring Harbor Press, Plainview, NY. Those skilled in the art understand how to estimate and adjust the stringency of hybridization conditions so that sequences with at least a desired level of complementarity stably hybridize, while sequences with lower levels of complementarity do not. For examples of hybridization conditions and parameters, see, for example, Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 2nd edition, Cold Spring Harbor Press, Plainview, NY; Ausubel, FM et al., 1994, Current Protocols in Molecular Biology, John Wiley & Sons, Secaucus, NJ.

[0028] Detection agent: As used herein, the term "detection agent" refers to any element, molecule, functional group, compound, fragment or moiety that is detectable. In some embodiments, the detection agent is provided or utilized alone. In some embodiments, the detection agent is provided and / or utilized in association with (e.g., linked to) another agent. Examples of detection agents include various ligands, radionuclides (e.g., 3 H, 14 C, 18 F, 19 F, 32 P, 35 S, 135 I, 125 I, 123 I, 64 Cu, 187 Re, 111 In, 90 Y, 99 mTc, 177 Lu, 89 Zr, etc.), fluorescent dyes, chemiluminescent agents (e.g., acridinium esters, stabilized dioxetanes, etc.), bioluminescent agents, spectrally resolvable inorganic fluorescent semiconductor nanocrystals (i.e., quantum dots), metal nanoparticles (e.g., gold, silver, copper, platinum, etc.), nanoclusters, paramagnetic metal ions, enzymes, colorimetric labels (e.g., dyes, gold colloids, etc.), biotin, digoxigenin, haptens, and proteins from which antisera or monoclonal antibodies can be obtained, but are not limited thereto.

[0029] Diagnostic Testing: As used herein, “Diagnostic Testing” refers to any process or set of processes performed or carried out to obtain useful information in determining whether a patient has a disease, disorder, or condition, and / or classifying a disease, disorder, or condition into any category that is significant in terms of phenotypic categories, prognosis, or likely response to treatment of the disease, disorder, or condition (either general treatment or any specific treatment). Similarly, “Diagnosis” refers to providing any type of diagnostic information, including but not limited to information useful in determining whether a subject has or is likely to develop a disease, disorder, or condition, the staging or characteristics of a disease, disorder, or condition that may manifest in the subject, information about the nature or classification of a tumor, information about prognosis, and / or information useful in selecting appropriate treatment or further diagnostic testing. Treatment selection may include selection of a particular therapeutic agent or other form of treatment, e.g., surgery, radiation, etc., selection of whether to withhold or administer treatment, and selection of a medication regimen (e.g., the frequency or level of one or more doses of a particular therapeutic agent or combination of therapeutic agents). The selection of additional diagnostic tests may include tests that are more specific to a given disease, disorder, or condition.

[0030] As used herein and in the claims, the terms “comprising” (and any form of “comprising,” e.g., “comprise” and “comprises”), “having” (and any form of “having,” e.g., “have” and “has”), “including” (and any form of “includes” and “include”), or “containing” (and any form of “contains” and “contain”) are inclusive or open-ended and do not exclude additional unlisted elements or process steps. For example, a process, method, article, or apparatus containing a list of elements is not necessarily limited to those elements and may include other elements that are not expressly listed or are not essentially present therein.

[0031] As used herein, the term "or any combination thereof" refers to all permutations and combinations of the items listed preceding that term. For example, "A, B, C, or any combination thereof" is intended to include at least one of A, B, C, AB, AC, BC, or ABC, and also to include BA, CA, CB, CBA, BCA, ACB, BAC, or CAB, where the order is important in the particular context. Continuing this example, combinations containing one or more repetitions of items or terms, such as BB, AAA, AAB, BBC, AAABCCCC, CBBAAA, CABABB, etc., are explicitly included. A person skilled in the art will understand that, unless it is evident from the context otherwise, there is typically no limit to the number of items or terms in any combination.

[0032] As used herein, the term “substantially” means that the event or situation described thereafter occurs entirely, or that the event or situation described thereafter occurs to a considerable extent or degree. For example, in relation to a particular event or situation, the term “substantially” means that the event or situation described thereafter occurs for at least 80% of the time, or at least 85% of the time, or at least 90% of the time, or at least 95% of the time. The term “substantially adjacent” may mean that two items are 100% adjacent to each other, or that two items are close to each other but not 100% adjacent, or that a portion of one of the two items is close to the other but not 100% adjacent to the other.

[0033] As used herein, the phrase “bonded to” includes both direct and indirect bonding of two parts to each other. Non-limiting examples of bonding include covalent bonding of one part to another, either by direct bonding or via spacer groups; non-covalent bonding of one part to another, either directly or by specific bond-to-part members bonded to the part; incorporation of one part into another, such as by dissolving one part into the other or by synthesis; and coating one part onto another.

[0034] As used herein, the term “biological fluid sample” will be understood to include any liquid test sample obtained from a patient and available in accordance with this disclosure. Examples of available biological fluid samples include, but are not limited to, whole blood or any part thereof (i.e., plasma or serum), saliva, sputum, mucus, nasal secretions, nasopharyngeal fluid, prenasal fluid, oropharyngeal fluid, tracheal fluid, bronchoalveolar fluid, cerebrospinal fluid (CSF), intestinal fluid, intraperitoneal fluid, cystic fluid, sweat, interstitial fluid, tears, and combinations thereof.

[0035] As used herein, the term “volume” in the context of liquid test samples used in accordance with this disclosure typically refers to the volume of a liquid test sample, such as a range of about 0.1 μl to about 100 μl, or a range of about 1 μl to about 75 μl, or a range of about 2 μl to about 60 μl, or a value of about 50 μl or less.

[0036] As used herein, the term “patient” includes humans and veterinary subjects. In certain non-limiting embodiments, the patient is a mammal. In certain other non-limiting embodiments, the patient is a human. For diagnostic / procedural purposes, the term “mammal” refers to any animal classified as a mammal, including humans, domesticated and livestock, non-human primates, and zoo animals, sports animals, or companion animals, such as dogs, horses, cats, and cows.

[0037] "Healthcare provider" or "healthcare decision-maker" includes any individual authorized to diagnose or treat a patient, or to assist in the diagnosis or treatment of a patient. In the context of identifying new drugs that may be useful for treating lung disease, a healthcare provider may be an individual who is not authorized to diagnose or treat a patient, or to assist in the diagnosis or treatment of a patient.

[0038] A "point-of-care test" refers to a real-time diagnostic test that can be performed within a rapid timeframe so that the resulting test is performed more quickly than an equivalent test that does not use this system. Point-of-care tests can be performed quickly and on-site, particularly in clinics, bedsides, emergency rooms, emergency treatment rooms, or other such locations where rapid and accurate results are required. Patient presence is possible, but not required. Point-of-care includes, but is not limited to, emergency rooms, operating rooms, hospital laboratories and other clinical laboratories, clinics, on-site, or any situation where rapid and accurate results are desired.

[0039] The term “specific binding partner” should be understood, especially (but not limited to) when used herein in the sense of “target analyte specific binding partner,” to refer to any molecule that can specifically bind to a target analyte. For example, but not limited to, a binding partner may be an antibody, receptor, ligand, aptamer, molecularly imprinted polymer (i.e., inorganic matrix), a combination or derivative thereof, as well as any other molecule that can specifically bind to a target analyte.

[0040] As used herein, the term “immunoassay” refers to an assay for determining the presence of a diagnostic biomarker in a biological sample by reacting the sample with an antibody (or fragment thereof) that specifically binds to the diagnostic biomarker, the reaction being carried out under conditions and for a time that allows for the formation of an immune complex between the antibody (or fragment thereof) and the diagnostic biomarker. Subsequently, such immune complexes are quantitatively measured.

[0041] In certain (but non-limiting) embodiments, an immunoassay can detect an immobilized complex between a serum marker and a serum marker-conjugated antibody using a second antibody that is labeled and conjugated to a first antibody. Alternatively, the first version features a sandwich configuration in which the second antibody also conjugates to the serum marker. In a sandwich immunoassay procedure, the serum marker-conjugated antibody may be a capture antibody conjugated to an insoluble substance, and the second antibody may be a labeled antibody. The above sandwich immunoassay procedure can be used with the antibodies described below herein.

[0042] In other specific (but non-limiting) embodiments, the immunoassay can detect a complex between a serum marker and a serum marker-binding antibody using a detection molecule (i.e., a second reagent) that can bind to a serum marker-binding antibody and, if bound to the immune complex, can also be detected. For example (but not limited to), the second reagent may include a receptor, a ligand, or even a label bound to another copy of the serum marker.

[0043] Turning to certain non-limiting embodiments of the present disclosure, embodiments of the present disclosure include individual biomarkers of IPF, as well as compositions / devices / assays containing them, methods for their preparation and use, kits, and diagnostic tests associated therewith. The identification of one or more biomarkers of IPF is of interest and beneficial for several reasons. Firstly, the diagnostic criteria for IPF currently in use rely on radiographic images and / or surgical lung biopsies interpreted by physicians with expertise in interstitial lung disease. This expertise is often found only in tertiary care centers, which may be geographically distant from the patient and their primary care physician. The identification of one or more serum biomarkers that are diagnostically valid for IPF is useful for both clinicians and patients, especially when surgical lung biopsy material is unavailable or access to a specialized interstitial lung disease physician is limited. Secondly, the discovery of peripheral blood biomarkers that reflect disease activity allows for continuous monitoring and also provides objective markers for evaluating treatment effectiveness. Finally, IPF biomarkers that provide prognostic information regarding disease course and / or mortality are valuable for both clinical care and research design. This disclosure focuses on (but is not limited to) biomarkers present in peripheral blood because they are readily available, can be measured over the long term, and are most likely to achieve clinical utility. Prior to this disclosure, there were no validated biomarkers that were conventionally used in the clinical care of patients with IPF.

[0044] Certain non-limiting embodiments of this disclosure relate to a method for determining the presence, severity, and / or predisposition of idiopathic pulmonary fibrosis (IPF) in an individual using a single biomarker. The method comprises the steps of: (a) obtaining a biofluid sample from an individual; (b) incubating the biofluid sample with an antibody that specifically binds to tissue metallopeptidase inhibitor 1 (TIMP1) under conditions that allow for the formation of an antibody-TIMP1 immune complex; (c) measuring the amount of the formed antibody-TIMP1 immune complex to obtain a measurement of TIMP1 in the sample; and (d) using a mathematical algorithm to obtain an IPF score based on the measurement of TIMP1 in the sample.

[0045] Any biological fluid sample known in the art or otherwise assumed herein, which is detectable by an anti-TIMP1 antibody and may contain TIMP1 as an indicator of IPF, can be used in accordance with this disclosure. Examples of biological fluid samples that can be used include, but are not limited to, blood, plasma, saliva, sputum, mucus, nasal secretions, nasopharyngeal secretions, prenasal secretions, oropharyngeal secretions, tracheal secretions, bronchoalveolar secretions, and combinations thereof.

[0046] Anti-TIMP1 antibodies are well-known, widely commercialized, and extensively studied in the art. For example (but not limited to), some distributors of anti-TIMP1 monoclonal and / or polyclonal antibodies include Abcam (Cambridge, UK); Biolegend, Inc. (San Jose, CA); Bio-Rad Laboratories, Inc. (Hercules, CA); Cell Signaling Technology, Inc. (Danvers, MA); Millipore Sigma (Burlington, MA); Santa Cruz Biotechnology, Inc. (Dallas, TX); Sino Biological US Inc. (Wayne, PA); Thermo Fisher Scientific (Waltham, MA); and many others. However, this list is not exhaustive, and many more distributors of anti-TIMP1 antibodies are available pursuant to this disclosure. Therefore, it is considered that those skilled in the art can clearly and uniquely identify and select the various anti-TIMP1 antibodies available pursuant to this disclosure, and thus further description of anti-TIMP1 antibodies or their characteristics is deemed unnecessary.

[0047] Non-limiting examples of the TIMP1 immunoassay, the reagents used therein, and algorithms that can be used in accordance with this disclosure are described in detail in U.S. Patent No. 7,141,380 issued November 28, 2006; and U.S. Patent No. 7,668,661 issued February 23, 2010. All the contents of each of the aforementioned patents are expressly incorporated herein by reference.

[0048] In certain (but non-limiting) embodiments, the IPF score is used to aid, predict, or substitute for the histological score of lung biopsy material.

[0049] In certain (but not limited) embodiments, the mathematical algorithm is a discriminant function algorithm, such as a linear discriminant function algorithm (but not limited to this).

[0050] In certain (but non-limiting) embodiments, the IPF score is at least one factor for determining a treatment strategy for an individual.

[0051] In certain (but non-limiting) embodiments, the IPF score is at least one factor used to monitor the effectiveness of treatment strategies implemented for an individual.

[0052] In certain (but non-limiting) embodiments, the IPF score is at least one factor used to determine whether or not an individual should receive lung biopsy material.

[0053] In certain (but non-limiting) embodiments, the IPF score is at least one factor used to assess the degree of IPF in an individual.

[0054] Certain non-limiting embodiments of this disclosure relate to a method for determining the presence, severity, and / or predisposition of idiopathic pulmonary fibrosis (IPF) in an individual using two biomarkers. The method comprises the steps of: (a) obtaining a biofluid sample from an individual or patient; (b) selecting at least two diagnostic markers from the sample for dynamic processes of extracellular matrix synthesis and / or extracellular matrix degradation, wherein the at least two diagnostic markers are selected from the group consisting of tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP); (c) measuring the amount of each of the at least two diagnostic markers in the sample to obtain a measurement value for each of the at least two diagnostic markers; and (d) combining the measurements of the at least two diagnostic markers using a mathematical algorithm to obtain an IPF score.

[0055] In certain (but non-limiting) embodiments, at least two diagnostic markers are TIMP1 and HA.

[0056] In certain (but non-limiting) embodiments, at least two diagnostic markers are TIMP1 and PIIINP.

[0057] In certain (but non-limiting) embodiments, at least two diagnostic markers include TIMP1, HA, and PIIINP, and step (d) is further defined as combining measurements of the three diagnostic markers using a mathematical algorithm to obtain an IPF score. In some embodiments, TIMP1 and PIIINP (or P3NP) are characterized as human.

[0058] HA-binding proteins and / or anti-HA antibodies are well known, widely commercialized, and extensively studied in the art. For example (but not limited to), some distributors of anti-HA monoclonal and / or polyclonal antibodies include AbbXa Ltd (Houston, TX); Bio-Rad Laboratories, Inc. (Hercules, CA); Biorbyt Ltd. (St. Louis, MO); Creative Diagnostics (Shirley, NY); GeneTex, Inc. (Irvine, CA); LifeSpan BioSciences (Seattle, WA); MyBioSource, Inc. (San Diego, WA); US Biological Life Sciences (Salem, MA); and many others. However, this list is not exhaustive, and many more distributors of anti-HA antibodies are available pursuant to this disclosure. Therefore, it is assumed that those skilled in the art can clearly and uniquely identify and select the various anti-HA antibodies available pursuant to this disclosure, and thus further description of anti-HA antibodies or their characteristics is deemed unnecessary.

[0059] Anti-PIIINP antibodies are well-known, widely commercialized, and extensively studied in the art. For example (but not limited to), some distributors of anti-PIIINP monoclonal and / or polyclonal antibodies include Abbxa Ltd (Houston, TX); Abcam (Cambridge, UK); Abnova Corporation (Walnut, CA); Antibodies-Online Inc. (Limerick, PA); Cedarlane (Burlington, Ontario); Creative Diagnostics (Shirley, NY); Millipore Sigma (Burlington, MA); MyBioSource, Inc. (San Diego, CA); Sino Biological US Inc. (Wayne, PA); and many others. However, this list is not exhaustive, and many more distributors of anti-PIIINP antibodies are available pursuant to this disclosure. Therefore, it is considered that those skilled in the art can clearly and uniquely identify and select the various anti-PIIINP antibodies available pursuant to this disclosure, and thus further description of anti-PIIINP antibodies or their characteristics is deemed unnecessary.

[0060] TIMP1, HA, and PIIINP immunoassays, reagents used therein (including antibodies used therein), and non-limiting examples of algorithms that can be used in accordance with this disclosure are described in detail in U.S. Patent No. 7,141,380 issued November 28, 2006; U.S. Patent No. 7,668,661 issued February 23, 2010; and U.S. Patent No. 7,541,149 issued June 2, 2009. The contents of each of the aforementioned patents are expressly incorporated herein by reference. In various embodiments, suitable biomarkers for use herein include polypeptides having the amino acid sequence shown in (UniProt accession number P01033), for example: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA (SEQ ID NO: 1), or fragments or variants thereof, for example, variants having at least 95%, at least 97%, or at least 99% sequence identity to this biomarker sequence. In various embodiments, suitable biomarkers for use herein include polypeptides having the amino acid sequence shown in (UniProt accession number P02461 or P02461.1), for example:

[0061] In certain (but non-limiting) embodiments, the IPF score is used to aid, predict, or substitute for the histological score of lung biopsy material.

[0062] In certain (but not limited) embodiments, the mathematical algorithm is a discriminant function algorithm, such as a linear discriminant function algorithm (but not limited to this).

[0063] In certain (but non-limiting) embodiments, the IPF score is at least one factor for determining a treatment strategy for an individual.

[0064] In certain (but non-limiting) embodiments, the IPF score is at least one factor used to monitor the effectiveness of treatment strategies implemented for an individual.

[0065] In certain (but non-limiting) embodiments, the IPF score is at least one factor used to determine whether or not an individual should receive lung biopsy material.

[0066] In certain (but non-limiting) embodiments, the IPF score is at least one factor used to assess the degree of IPF in an individual.

[0067] The current reference standard for evaluating pulmonary fibrosis is lung biopsy. In a biopsy, a randomly selected tissue sample from the lung is cut into slices and examined by a specialist under a microscope.

[0068] Numerous problems arise with lung biopsies, including the following causes of uncertainty: the distribution of fibrosis in the lung (if clustered fibrosis is present, the needle may be inserted into areas of the lung unaffected by fibrosis), sample preparation failures (e.g., insufficient tissue material), and the subjectivity of the pathologist. Furthermore, the fibrotic state of the lung is usually described using scores, and many different, potentially incompatible scoring systems exist (e.g., the CRP scoring system). For example, two unrelated pathologists may have to score the same biopsy sample from the same patient at two different time points using two different scoring systems.

[0069] This disclosure facilitates point-of-care or telediagnosis of IPF and helps healthcare providers monitor the status or progression of IPF at two or more points in time. Importantly, this disclosure provides healthcare decision-makers with an alternative to potentially inaccurate and risky lung biopsies.

[0070] This disclosure uses a computer-implementable algorithmic method that utilizes one or more IPF-related marker values. The predictive values ​​of this disclosure have been validated in clinical trials that monitored the state or progression of IPF. In these clinical trials, this disclosure was validated on a cross-sectional basis, where analyses were performed at individual time points, and on a longitudinal basis, where analyses were performed at two or more time points.

[0071] Therefore, this disclosure can be used to (a) measure the dynamic processes of extracellular matrix synthesis (fibrosis) and extracellular matrix degradation (fibrinolysis); and (b) obtain results that reflect the degree and dynamic changes of fibrosis occurring in lung tissue through the prediction of IPF histological scores.

[0072] This disclosure is particularly useful in assisting the diagnosis and treatment of patients for whom lung biopsy is considered highly risky. Such patients may have coagulation disorders, be reluctant to undergo biopsy, or be unable to undergo specialized histopathological examination. In addition, this disclosure can be used by medical decision-makers to assess IPF. Furthermore, this disclosure is particularly useful when fibrosis may be heterogeneously distributed and sampling error is a significant concern.

[0073] In one non-limiting embodiment, the Disclosure provides a method for assisting in the diagnosis of IPF status or progression in a patient by determining predictor variable values ​​for each time point in time, wherein the predictor variable values ​​and comparisons of comparison datasets at one or more time points are used by a medical decision-maker to confirm the patient's IPF status or progression, and the patient predictor variable values ​​are calculated by inputting data of one or more blood markers (e.g., one or more plasma or serum markers) and optionally one or more auxiliary markers into a linear or nonlinear functional algorithm derived by correlating reference IPF histopathological markers and blood markers (e.g., plasma or serum marker data).

[0074] A "comparison dataset" can include any data reflecting any qualitative or quantitative indicators of histopathological status. In one non-limiting embodiment, the comparison dataset can include one or more numerical values ​​or ranges of numerical values ​​related to histopathological status. For example, the comparison dataset could include various sets of integers (e.g., integers from 0 to 5), where these six different groups of integers correlate with different IPF disease states (e.g., 0-1 may correlate with mild disease status, 2-3 with moderate disease status, and 4-5 with severe disease status). Thus, the comparison dataset can correlate with an established lung biopsy scoring system (e.g., a clinical-radiographic-physiological (CRP) scoring system).

[0075] In a particular (but non-limiting) embodiment, the blood marker is a serum marker selected from one or more of the following: tissue metallopeptidase inhibitor 1 (TIMP1), type III procollagen N-terminal propeptide (PIIINP), and hyaluronan. Co-markers include, but are not limited to, the patient's weight, sex, age, and transaminase levels.

[0076] In another non-limiting embodiment of this disclosure, a linear or nonlinear function algorithm is derived by correlating reference IPF histopathological markers and blood markers (e.g., plasma and serum markers) data using either discriminant function regression analysis or nonparametric analysis. The reference IPF histopathological markers and blood markers (e.g., plasma and serum markers) data may include data indicating fibrosis or fibrinolysis, elevated IPF serum markers, or other IPF clinical symptoms.

[0077] In one non-limiting embodiment, the reference IPF histopathological marker and blood marker data (e.g., plasma and serum marker data) are based on data from one or more subjects other than the patient being diagnosed. In another non-limiting embodiment, the reference IPF histopathological marker and blood marker data (e.g., plasma and serum marker data) are based on data previously obtained from the patient being diagnosed, and optionally on data obtained from one or more other subjects.

[0078] In one non-limiting embodiment, the linear or nonlinear function algorithm includes the steps of: (a) aggregating a dataset for a first group of subjects, including blood marker data (e.g., plasma or serum marker data) and histopathological data; (b) deriving a linear or nonlinear function algorithm from the aggregated dataset through the application of an analytical method; (c) calculating a validation biopsy score for a second group of subjects by inputting data including blood marker data (e.g., plasma or serum marker data) values ​​for the second group of subjects into the algorithm derived in step (b); (d) comparing the validation biopsy score calculated in step (c) with the IPF histopathological score for the second group of subjects; and (e) determining that the validation biopsy score determined in step (c) is for the second If the IPF histopathological score for the target group does not correlate within a clinically acceptable level, the following steps (i) to (iii) are performed until such tolerance is met: (i) modifying the algorithm based on one or more criteria, including (1) revising the dataset for the first target group and (2) revising or changing the analytical method; (ii) calculating the validation biopsy score for the second target group by inputting data including blood marker data (e.g., plasma or serum marker data) values ​​for the second target group into the modified algorithm; and (iii) evaluating whether the validation biopsy score calculated using the modified algorithm correlates within a clinically acceptable level with the lung histopathological score for the second target group.

[0079] Analytical methods include statistical methods such as discriminant function analysis and nonparametric classification, as well as methods such as classification trees or neural networks.

[0080] In another, non-limiting embodiment, the Disclosure provides a data structure stored in a computer-readable medium that can be read by a microprocessor and includes at least one code that uniquely identifies a linear or nonlinear function algorithm derived in the manner described herein.

[0081] In another non-limiting embodiment, the Disclosure provides a diagnostic kit comprising: (a) a data structure stored in a computer-readable medium, which can be read by a microprocessor and which includes at least one code that uniquely identifies a linear or nonlinear functional algorithm derived in the manner described herein; and (b) one or more immunoassays for detecting and determining a patient's serum marker values.

[0082] In another non-limiting embodiment, the Disclosure provides a computer-implementable method and system for determining whether a composition is useful in treating IPF, comprising the step of evaluating data useful in diagnosing the state or progression of IPF in a patient treated with the composition, wherein (a) the diagnosis is made by a healthcare provider by algorithmically determining predictor variable values ​​for each time point at one or more time points; (b) a comparison of the predictor variable values ​​and a comparison dataset at one or more time points is used by the healthcare provider to confirm the state or progression of patient IPF; and (c) the patient predictor variable values ​​are calculated by inputting data for one or more blood markers (e.g., plasma or serum markers) into a linear or nonlinear function algorithm derived by correlating reference IPF histopathological markers and blood marker data (e.g., plasma or serum marker data).

[0083] The methods, systems, and kits described herein may also be used by healthcare providers for the following purposes: (1) to determine treatment regimens for patients who are predisposed to or have IPF; and (2) to design clinical programs useful in monitoring the status or progression of IPF in one or more patients.

[0084] Discriminant function analysis is a technique used to determine which variables distinguish between two or more naturally occurring, mutually exclusive groups. The fundamental idea behind discriminant function analysis is to determine whether groups are distinct with respect to a set of predictor variables that may or may not be independent of each other, and then to use those variables to predict group affiliation (for example, of new cases).

[0085] Discriminant function analysis begins with an outcome variable that is categorical (two or more mutually exclusive levels). This model assumes that these levels can be identified by a set of predictor variables that can be continuous or categorical, as in ANOVA, and that the underlying discriminant function is linear, as in ANOVA. Discriminant analysis does not perform "variability segmentation." It looks for canonical correlations within the set of predictor variables and uses these correlations to construct an eigenfunction that explains the percentage of total variability of all predictors across all levels of the outcome variable.

[0086] The output of the analysis is a set of linear discriminant functions (eigenfunctions) that generate "discrimination scores" regardless of the level of the outcome variable, using combinations of predictor variables. The percentage of total variability is presented for each function. Furthermore, for each eigenfunction, a set of Fisher discriminant functions is developed that generate discriminant scores based on combinations of predictor variables within each level of the outcome variable.

[0087] Typically, several variables are included in the study to see which variables contribute to the distinction between groups. In this case, a matrix of total variances and covariances is generated. Similarly, a matrix of pooled within-group variances and covariances may also be generated. A multivariate F-test is performed to compare these two matrices to determine whether there are any significant differences between groups (with respect to all variables). This procedure is identical to multivariate analysis of variance, or MANOVA. As with MANOVA, a multivariate test is performed first, and if it is statistically significant, one can proceed to investigate which variables have significantly different means between groups.

[0088] For a set of observations that includes one or more quantitative variables and a classification variable that defines groups of observations, the discrimination procedure develops a discrimination criterion for classifying each observation into one of the groups. To understand how well the discrimination criterion "works," it is necessary to classify (a priori) different cases, i.e., cases that were not used to estimate the discrimination criterion. Only the classification of new cases allows for an assessment of the predictive validity of the discrimination criterion.

[0089] To validate the derived criteria, the classification can be applied to other datasets. The dataset used to derive the discrimination criteria is called the training or calibration dataset or patient training cohort. The dataset used to validate the performance of the discrimination criteria is called the validation dataset or validation cohort.

[0090] The discriminant criterion (function or algorithm) determines the measure of the generalized squared distance. These distances are based on a pooled covariance matrix. Proximity can be determined using either the Mahalanobis distance or the Euclidean distance. These distances can be used to identify groupings of outcome levels and thereby determine possible reductions in levels for the variables.

[0091] A "pooled covariance matrix" is a numerical matrix formed by adding together the components of the covariance matrix for each subgroup in the analysis.

[0092] A “predictor variable” is any variable that can be applied to a function to generate a dependent variable, a response variable, or a “predictor variable value.” In one non-limiting embodiment of this disclosure, the predictor variable value may be a discriminant score determined by discriminant function analysis of two or more patient blood markers (e.g., plasma markers or serum markers). For example, a linear model might define a (linear) relationship between a dependent (or response) variable Y and a set of predictor variables X. Y = b0 + b1x1 + b2x2 + ... + b k X k Specify it like this.

[0093] In this equation, b0 is the regression coefficient for the intercept, and the b1 value is the regression coefficient calculated from the data (for variables 1 to k).

[0094] A "classification tree" is used to predict the belonging of a case or object to a class of a categorical dependent variable from its measurements to one or more predictor variables. Classification tree analysis is one of the main techniques used in so-called data mining. The goal of a classification tree is to predict or explain the response to a categorical dependent variable, and therefore the available techniques have much in common with those used in more traditional methods such as discriminant analysis, cluster analysis, nonparametric statistics, and nonlinear estimation.

[0095] While the flexibility of classification trees makes them a very attractive analytical option, this does not mean that their use is recommended over more traditional methods. In fact, traditional methods may be preferable when the more rigorous theoretical and distributional assumptions of traditional methods are met. However, as an exploratory method or as a last resort when conventional methods fail, classification trees are considered superior in the opinion of many researchers. Classification trees are widely used in various applied fields such as medicine (diagnosis), computer science (data structures), botany (taxation), and psychology (decision theory). Classification trees are well-suited to graphical representation, which helps to make interpretation easier than when only rigorous numerical interpretation is possible.

[0096] A neural network is an analytical method modeled after the (hypothetical) process of learning in the brain's cognitive systems and neurological functions. It is an analytical method that, after performing a so-called learning process on existing data, can predict new observations (for a particular variable) from other observations (for the same or other variables). Neural networks are a data mining technique. The first step is to design a specific network architecture (containing a specific number of "layers," each consisting of a certain number of "neurons"). The size and structure of the network must match the nature of the phenomenon being investigated (e.g., formal complexity). This task is not easy and often involves multiple "trial and error" steps, as the latter is obviously not well known at this initial stage.

[0097] The neural network is then subjected to the "training" process. During this stage, computer memory acts as neurons, applying an iterative process to the number of inputs (variables) to adjust the network's weights in order to optimally predict the sample data on which the "training" is performed. After the learning phase on the existing dataset, the new network is ready and can be used to generate predictions.

[0098] In one non-limiting embodiment of the present disclosure, the neural network may include the memory of one or more personal computers or mainframe computers or computerized point-of-care devices.

[0099] This disclosure is described in the general context of computer executable instructions for computer programs running on personal computers, but those skilled in the art will recognize that this disclosure can also be implemented in combination with other program modules. Generally, a program module includes routines, programs, components, and data structures that perform a specific task or implement a specific abstract data type. Furthermore, those skilled in the art will understand that this disclosure can be implemented in other computer system configurations, including portable devices, multiprocessor systems, microprocessor-based or programmable home appliances, minicomputers, and mainframe computers. This disclosure can also be implemented in a distributed computing environment where tasks are performed by remote processing devices linked over a communication network. In a distributed computing environment, program modules can reside in both local and remote memory storage.

[0100] The diagnostic systems of this disclosure may include portable devices useful for point-of-care applications, or they may be systems that operate remotely from the patient care location. In either case, the system may include auxiliary software programmed in any useful language to implement the diagnostic methods of this disclosure in accordance with the algorithms or other analytical techniques described herein.

[0101] The "validation cohort marker score" refers to a numerical score derived from a linear combination of the discriminant weights obtained from the training cohort and the marker values ​​for each patient in the validation cohort.

[0102] The "patient diagnostic marker cutoff value" refers to the value of a marker or combination of markers at which a predetermined level of sensitivity or specificity is achieved.

[0103] "Negative predictive power" ("NPV") refers to the probability of not having the disease if a marker value (or set of marker values) does not rise above a defined cutoff.

[0104] A "positive predictive value" ("PPV") refers to the probability of having the disease if a marker value (or set of marker values) rises above a defined cutoff.

[0105] A "receiver operating characteristic curve" ("ROC") refers to a graphical representation of the functional relationship between the distribution of sensitivity and 1-specificity values ​​of a marker in a cohort of affected individuals and a cohort of unaffected individuals.

[0106] The "Area Under the Curve" ("AUC") is a number that represents the area under the receiver operating characteristic curve. The closer this number is to 1, the better the marker value distinguishes between affected and unaffected cohorts.

[0107] "McNemar chi-squared test" ("McNemar χ") 2 A "proportion hypothesis test" is a statistical test used to determine whether two correlated proportions (proportions with a common numerator but different denominators) are significantly different from each other.

[0108] Nonparametric regression analysis is a set of statistical methods that enable the fitting of lines to bivariate data with little or no assumptions about the distribution of each variable or the errors in the estimation of each variable. Non-restrictive examples include the Theil estimator for location, Passing-Bablok regression, and Deming regression.

[0109] A "cutoff value" is a numerical value of a marker (or set of markers) that defines a specific level of sensitivity or specificity.

[0110] kit Kits comprising one or more anti-IPF biomarker agents and instructions for use (e.g., treatment, prophylactic, or diagnostic use) are also provided by this disclosure. In some embodiments, the kit is used for an in vitro diagnostic assay for diagnosing IPF. In some embodiments, one or more anti-IPF biomarker agents comprise antibody agents. In some embodiments, one or more of the antibody agents are labeled with a detectable portion. In some embodiments, the kit further comprises a detection agent (e.g., one or more acridinium ester molecules). In some embodiments, one or more of the antibody agents are labeled with one or more acridinium ester molecules. In some embodiments, the kit further comprises one or more secondary antibody agents that specifically bind to one or more of the anti-IPF biomarker antibody agents.

[0111] In some embodiments, one or more anti-IPF biomarker agents include nucleic acid probes. In some embodiments, at least a portion of each nucleic acid probe hybridizes to one or more portions of nucleotides encoding IPF biomarkers (e.g., tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof). The nucleotides encoding the IPF biomarkers may be DNA (e.g., cDNA) or RNA (e.g., mRNA). In some embodiments, the nucleic acid probes are labeled with one or more detection agents (e.g., the detection agents indicate the presence of nucleotides encoding IPF biomarkers).

[0112] In some embodiments, the kit further includes one or more control samples. In some embodiments, the control samples include one or more IPF biomarker standards. In some embodiments, the IPF biomarker standards include recombinant IPF biomarkers (e.g., tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof). In some embodiments, the IPF biomarker standards include nucleic acids of synthetic IPF biomarkers (e.g., tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof).

[0113] In addition to the above, the kit may include other components such as solvents or buffers, stabilizers or preservatives, and / or agents for treating the conditions or disorders described herein. Alternatively, the other components may be included in the kit in a separate composition or container from the anti-IPF biomarker agent. In such embodiments, the kit may include instructions for mixing the anti-IPF biomarker agent with the other components, or for using the anti-IPF biomarker together with the other components.

[0114] In certain embodiments, a kit for use in accordance with this disclosure may include a reference or control sample, instructions for processing the sample, instructions for performing the test on the sample, instructions for interpreting the results, buffers and / or other reagents necessary to perform the test.

[0115] This disclosure also provides the recognition that certain single IPF biomarkers may be helpful in detecting and / or diagnosing IPF. This disclosure further provides insight that certain combinations of IPF biomarkers are particularly useful for detecting and / or diagnosing IPF. Accordingly, the methods, compositions, and kits described herein can be used in assays to assess the risk of IPF, to determine whether a subject should undergo further lung examinations, and / or to diagnose IPF based on the detection or measurement of IPF biomarkers in a sample, e.g., a biological sample obtained from a subject.

[0116] The methods and kits provided herein can detect IPF in a sample with sensitivity and specificity that makes the test outcome sufficiently reliable for medical use. The methods and kits provided herein for the detection and / or diagnosis of IPF in a subject can detect IPF with sensitivity greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, greater than 96%, greater than 97%, greater than 98%, greater than 99%, or about 100%. In some embodiments, the methods and kits provided herein can detect IPF with sensitivity of about 70% to 100%, about 80% to 100%, or about 90% to 100%. In some embodiments, the methods and kits provided herein can detect IPF with sensitivity and specificity between about 50% to 100%, about 60% to 100%, about 70% to 100%, about 80% to 100%, or about 90% to 100%.

[0117] composition Compositions are also provided herein. In some embodiments, a composition comprises one or more IPF biomarkers and one or more anti-IPF biomarker agents. In some embodiments, one or more IPF biomarkers include tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof, and one or more anti-IPF biomarker agents include anti-TIMP1 agents, anti-HA agents, anti-PIIINP agents, or a combination thereof.

[0118] In some embodiments, the composition comprises a combination (e.g., one or more, two or more, or three of the IPF biomarkers and a corresponding combination of an anti-IPF biomarker agent). In various embodiments, one or more, two or more, or three of the IPF biomarkers are present in amounts sufficient to demonstrate the presence of IPF in the patient.

[0119] In some embodiments, the composition comprises two or more IPF biomarkers and two or more anti-IPF biomarker agents. In some embodiments, the two or more IPF biomarkers include tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronane (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof, and the two or more anti-IPF biomarker agents include an anti-TIMP1 agent, an anti-HA agent, an anti-PIIINP agent, or a combination thereof.

[0120] In some embodiments, the composition comprises three IPF biomarkers and three or more anti-IPF biomarker agents. In some embodiments, the three IPF biomarkers include tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronane (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof. In some embodiments, the three or more anti-IPF biomarker agents include an anti-TIMP1 agent, an anti-HA agent, an anti-PIIINP agent, or a combination thereof.

[0121] Computer system The methods described herein can be implemented in a computer system having a processor that executes specific instructions in a computer program. In some embodiments, the computer system may be configured to output an IPF biomarker score based on receiving an IPF biomarker profile and / or levels of two or more IPF biomarkers. In particular, the computer program may include instructions for the system to select appropriate next steps, including additional medication, treatment, and / or additional tests for the subject.

[0122] In some embodiments, the computer program may be configured so that the computer system can identify subjects for further examination (e.g., lung examination) based on received data (e.g., IPF biomarker profile), identify subjects as being at risk of or having IPF, and / or identify subjects to receive drug therapy, and use the data to calculate an IPF biomarker score. The system may be able to rank the identified subsequent steps based on the IPF biomarker profile, which has demographic factors and / or image-based biomarkers. The system may be able to adjust the ranking based, for example, on the clinical response of subjects or their families who have or are suspected of having IPF.

[0123] Figure 2 is a block diagram of a computer system 1100 that can be used for the operations described above, according to one embodiment. The system 1100 includes a processor 1110, memory 1120, storage device 1130, and input / output device 1140. Each of the components 1110, 1120, 1130, and 1140 is interconnected using a system bus connection 1150. The system may include an analytical instrument 1160 for determining the level of one or more biomarkers of this disclosure in a sample.

[0124] In various embodiments, the processor 1110 can process instructions for execution within the system 1100. In one embodiment, the processor 1110 is a single-threaded processor. In another embodiment, the processor 1110 is a multi-threaded processor. The processor 1110 can process instructions stored in the memory 1120 or storage device 1130, including receiving or transmitting information via the input / output device 1140.

[0125] In various embodiments, the memory 1120 stores information within the system 1100. In one embodiment, the memory 1120 is a computer-readable medium. In one embodiment, the memory 1120 is a volatile memory unit. In another embodiment, the memory 1120 is a non-volatile memory unit.

[0126] The storage device 1130 can provide a large-capacity storage device to the system 1100. In one embodiment, the storage device 1130 is a computer-readable medium.

[0127] The input / output device 1140 provides input / output operations to the system 1100. In one embodiment, the input / output device 1140 includes a keyboard and / or a pointing device. In one embodiment, the input / output device 1140 includes a display device for displaying a graphical user interface.

[0128] System 1100 can be used to build a database. Figure 3 shows a flowchart of Method 1200 for building a database to be used to identify subjects for further examination (e.g., IPF examination), identify subjects as being at risk of IPF or having IPF, and / or identify subjects to receive medication. Preferably, Method 1200 is performed on System 1100. For example, a computer program product may include instructions to cause Processor 1110 to perform the steps of Method 1200 or Method 1300.

[0129] Referring here to Figure 3, Method 1200 includes the following steps: Step 1210 receives the IPF biomarker profile of interest (e.g., the levels of one or more IPF biomarkers in the sample). A computer program in System 1100 may include instructions for presenting a suitable graphical user interface on Input / Output Device 1140, the graphical user interface may prompt the user to input levels 1170 using Input / Output Device 1140, such as a keyboard. Step 1220 calculates the IPF biomarker score from the IPF biomarker profile. As described herein, Step 1220 calculates the IPF biomarker score from (i) the IPF biomarker profile and (ii) demographic factors and / or image-based biomarkers. Step 1230 stores the IPF biomarker score. System 1100 may store the IPF biomarker score in Storage Device 1130. Additionally or alternatively, System 1100 may provide a readout containing the IPF biomarker score. Readout may also include the following steps, as proposed, regarding the subjects and / or confidence levels associated with the IPF biomarker score.

[0130] Referring here to Figure 4, Method 1300 includes the following steps: Step 1310 detects the level of one or more IPF biomarkers in a sample from a subject, for example. Step 1320 uses the levels of one or more IPF biomarkers to obtain an IPF biomarker profile. Step 1330 calculates an IPF biomarker score from the IPF biomarker profile. As described herein, Step 1330 calculates an IPF biomarker score from (i) the IPF biomarker profile and (ii) demographic factors and / or image-based biomarkers. Step 1340 stores the IPF biomarker score. System 1100 can store the IPF biomarker score in storage device 1130. Additionally or alternatively, System 1100 may provide a readout including the IPF biomarker score. The readout may also include the following steps proposed for the subject and / or confidence level associated with the IPF biomarker score.

[0131] In addition, a non-temporary computer-readable medium is also provided, which includes executable instructions that, when executed, cause a processor to perform an operation including the methods provided herein. For example, the non-temporary computer-readable medium includes, when executed, executable instructions that cause a processor to perform an operation including the methods 1200 or 1300 described above. In various embodiments, the non-temporary computer-readable medium includes hard drives, external hard disks, disks, CDs, DVDs, etc., for storing data. In various embodiments, software located on a physical medium is preferred for use herein.

[0132] In some embodiments, a non-temporary computer-readable medium is provided which includes executable instructions causing a processor to perform an operation that, if performed, includes a method for determining the presence, severity, and / or predisposition of idiopathic pulmonary fibrosis (IPF) in an individual, wherein the method includes (a) incubating a biological fluid sample with an antibody that specifically binds to tissue metallopeptidase inhibitor 1 (TIMP1) under conditions that allow the formation of an antibody-TIMP1 immune complex; (b) measuring the amount of the formed antibody-TIMP1 immune complex to obtain a measurement of TIMP1 in the sample; and (c) using a mathematical algorithm to obtain an IPF score based on the measurement of TIMP1 in the sample.

[0133] Exemplary numbered embodiments Embodiment 1. A method for determining the presence, severity, and / or predisposition of idiopathic pulmonary fibrosis (IPF) in an individual, comprising: (a) obtaining a biofluid sample from the individual; (b) incubating the biofluid sample with an antibody that specifically binds to tissue metallopeptidase inhibitor 1 (TIMP1) under conditions that enable the formation of antibody-TIMP1 immune complexes; (c) measuring the amount of the formed antibody-TIMP1 immune complexes to obtain a measurement of TIMP1 in the sample; and (d) using a mathematical algorithm to obtain an IPF score based on the measurement of TIMP1 in the sample.

[0134] Embodiment 2. The method according to Embodiment 1, wherein the biological fluid sample is selected from the group consisting of blood, plasma, saliva, sputum, mucus, nasal secretions, nasopharyngeal fluid, prenasal fluid, oropharyngeal fluid, tracheal fluid, bronchoalveolar fluid, and combinations thereof.

[0135] Embodiment 3. The method according to Embodiment 1, wherein the IPF score is used to assist, predict, or substitute for the histological score of lung biopsy material.

[0136] Embodiment 4. The method according to Embodiment 1, wherein the mathematical algorithm is a discriminant function algorithm.

[0137] Embodiment 5. The method according to Embodiment 1, wherein the discriminant function algorithm is a linear discriminant function algorithm.

[0138] Embodiment 6. The method according to Embodiment 1, wherein the IPF score is at least one factor for determining a treatment strategy for an individual.

[0139] Embodiment 7. The method according to Embodiment 1, wherein the IPF score is at least one factor used to monitor the effectiveness of the treatment strategy implemented on the individual.

[0140] Embodiment 8. The method according to Embodiment 1, wherein the IPF score is at least one factor used to determine whether or not an individual should obtain lung biopsy material.

[0141] Embodiment 9. The method according to Embodiment 1, wherein the IPF score is at least one factor used to assess the degree of IPF in an individual.

[0142] Embodiment 10. A method for determining the presence, severity, and / or predisposition of idiopathic pulmonary fibrosis (IPF) in an individual, comprising: (a) obtaining a biofluid sample from the individual; (b) selecting at least two diagnostic markers from the sample for dynamic processes of extracellular matrix synthesis and / or extracellular matrix degradation, wherein the at least two diagnostic markers are selected from the group consisting of tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP); (c) measuring the amount of each of the at least two diagnostic markers in the sample to obtain a measurement for each of the at least two diagnostic markers; and (d) combining the measurement values ​​of the at least two diagnostic markers using a mathematical algorithm to obtain an IPF score.

[0143] Embodiment 11. The method according to Embodiment 10, wherein at least two diagnostic markers are TIMP1 and HA.

[0144] Embodiment 12. The method according to Embodiment 10, wherein at least two diagnostic markers are TIMP1 and PIIINP.

[0145] Embodiment 13. The method according to Embodiment 10, wherein at least two diagnostic markers include TIMP1, HA, and PIIINP, and step (d) is further defined as a step of combining measurements of the three diagnostic markers using a mathematical algorithm to obtain an IPF score.

[0146] Embodiment 14. The method according to Embodiment 10, wherein the IPF score is used to assist, predict, or substitute for the histological score of lung biopsy material.

[0147] Embodiment 15. The method according to Embodiment 10, wherein the mathematical algorithm is a discriminant function algorithm.

[0148] Embodiment 16. The method according to Embodiment 15, wherein the discriminant function algorithm is a linear discriminant function algorithm.

[0149] Embodiment 17. The method according to Embodiment 16, wherein the IPF score is at least one factor for determining a treatment strategy for an individual.

[0150] Embodiment 18. The method according to Embodiment 10, wherein the IPF score is at least one factor used to monitor the effectiveness of the treatment strategy implemented on the individual.

[0151] Embodiment 19. The method according to Embodiment 10, wherein the IPF score is at least one factor used to determine whether or not an individual should obtain lung biopsy material.

[0152] Embodiment 20. The method according to Embodiment 10, wherein the IPF score is at least one factor used to assess the degree of IPF in an individual.

[0153] Embodiment 21. A non-temporary computer-readable medium containing an executable instruction that, if executed, causes a processor to perform an operation including the method described in any one of Embodiments 1 to 20.

[0154] Embodiment 22. A composition comprising (a) one or more IPF biomarkers comprising tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP), or a combination thereof; and (b) one or more anti-IPF biomarker agents comprising an anti-TIMP1 agent, an anti-HA agent, an anti-PIIINP agent, or a combination thereof. In various embodiments, one or more anti-IPF biomarker agents are artificial or synthetic.

[0155] Embodiment 23. A kit for detecting IPF, comprising (a)(i) an anti-TIMP1 agent, (ii) Anti-HA agents, (iii) Anti-PIIINP agents, (iv) combinations of those One or more anti-IPF biomarkers, including; and (b) Instructions for use A kit that includes this.

[0156] Embodiment 24. A kit for detecting IPF, comprising (a) (i) an anti-TIMP1 agent and an anti-HA agent, (ii) an anti-PIIINP agent and an anti-TIMP1 agent, or (iii) an anti-HA agent, an anti-PIIINP agent, and an anti-TIMP1 agent, and (b) instructions for use.

[0157] Embodiment 25. A kit comprising (a) one or more anti-IPF biomarker agents, comprising an anti-TIMP1 agent, an anti-HA agent, and an anti-PIIINP agent; and (b) instructions for use.

[0158] Embodiment 26. A kit according to any one of Embodiments 23 to 25, wherein one or more anti-IPF biomarker agents comprise one or more antibody agents.

[0159] Embodiment 27. The kit according to Embodiment 26, wherein one or more antibody agents are labeled with a detectable portion.

[0160] Embodiment 28. The kit according to Embodiments 23-27, further comprising one or more control samples.

[0161] Embodiment 29. The kit according to Embodiment 28, wherein the control sample comprises one or more IPF biomarker standards.

[0162] Embodiment 39. Use of the kits described in Embodiments 23-29 in an in vitro diagnostic assay for diagnosing IPF in a subject. [Examples]

[0163] Examples are presented below. However, it should be understood that this disclosure is not limited in its application to the specific experiments, results, and test procedures disclosed later herein. The examples are provided merely as one of various embodiments and are illustrative rather than exhaustive.

[0164] This embodiment relates to a simple measurement of IPF biomarkers in blood samples for accurately identifying (i.e., aiding in diagnosis) and potentially monitoring the progression of IPF in patients.

[0165] The biomarkers tested were tissue metallopeptidase inhibitor 1 (TIMP1), hyaluronan (HA), and type III procollagen N-terminal propeptide (PIIINP). These tests are immunoassays performed on various automated immunoassay platforms (e.g., but not limited to ATELLICA® and ADVIA CENTAUR® Immunoassay Analyzer Systems (Siemens Healthineers, Inc.; Malvern, PA)). The biomarkers can be used alone, in combination with each other, and / or in conjunction with other patient clinical data to accurately identify IPF patients.

[0166] In this study, serum samples from 99 patients were tested using Siemens TIMP1, HA, and PIIINP immunoassays. There were 53 samples from confirmed IPF patients, as well as 46 control patient samples consisting of 23 smokers and 23 non-smokers.

[0167] Logistic regression was used to compare biomarkers and predict the probabilities of IPF compared to the control.

[0168] Performance results were calculated by performing "leave 10 out" cross-validation, and the logistic model was rebuilt 500 times. Each time the model was built, only 89 out of 99 samples were used to construct the model. Subsequently, the model was used to predict the remaining 10 samples. The sensitivity and specificity obtained by comparing these 10 samples to clinical truth was averaged over all 500 simulations / iterations to reach cross-validated performance for sensitivity and specificity.

[0169] TIMP1 alone provided excellent predictive values ​​for identifying IPFs, with optimal sensitivity of 91.7% and specificity of 87.2%, as shown in the receiver operator curve (ROC) in Figure 1 and in Table 1 below.

[0170] [Table 1]

[0171] The predictions obtained by combining TIMP1 and HA with regression analysis further improved the prediction of IPF from the control, as shown in Table 2.

[0172] [Table 2]

[0173] Therefore, this embodiment demonstrates that IPF can be reliably predicted by using TIMP1 alone or in combination with HA in a logistic regression model. Combinations of TIMP1, HA, and other clinical data biomarkers (but not limited to PIIINP) in a logistic regression model provide a discriminant scoring system for more accurate staging and malignancy classification of IPF, as well as for more accurate monitoring of disease progression and response to treatment.

[0174] Accordingly, this disclosure provides compositions, devices, and kits, as well as methods for their manufacture and use, that fully satisfy the purposes and advantages described above. While this disclosure is described in conjunction with the specific drawings, experiments, results, and wording described above, it is obvious that many alternatives, modifications, and variations will be apparent to those skilled in the art. Accordingly, it is intended that all such alternative forms, modifications, and variations that fall within the spirit and broad scope of this disclosure are included in its scope. [Explanation of Symbols]

[0175] 1100 Computer System 1110 processor 1120 memory 1130 Storage device 1140 Input / Output Device 1150 System bus connection 1200 methods Project 1210 Project 1220 Project 1230 1300 methods Project 1310 Project 1320 Project 1330 Project 1340

Claims

1. A method for obtaining an idiopathic pulmonary fibrosis (IPF) score, wherein the method is: (a) a step of measuring the amount of each of at least two diagnostic markers in a biological fluid sample from an individual to obtain a measurement value for each of the at least two diagnostic markers; and (b) A step of obtaining an IPF score by combining measurements of at least two diagnostic markers using a mathematical algorithm, At least two diagnostic markers are TIMP1 and HA. The aforementioned method.

2. The method according to claim 1, wherein step (b) is further defined as the step of using a mathematical algorithm to combine measurements of three diagnostic markers to obtain an IPF score.

3. The method according to claim 1, wherein the IPF score is used to assist, predict, or substitute for the histological score of lung biopsy material.

4. The method according to claim 1, wherein the mathematical algorithm is a discriminant function algorithm.

5. The method according to claim 4, wherein the discriminant function algorithm is a linear discriminant function algorithm.

6. The method according to claim 1, wherein the IPF score is at least one factor for determining a treatment strategy for an individual.

7. The method according to claim 1, wherein the IPF score is at least one factor used to monitor the effectiveness of treatment strategies implemented on an individual.

8. The method according to claim 1, wherein the IPF score is at least one factor used to determine whether or not an individual should obtain lung biopsy material.

9. The IPF score is used to assess the degree of IPF in an individual. The method according to claim 1, which is one of the factors.

10. A non-temporary computer-readable medium including an executable instruction that, if executed, causes a processor to perform an operation including the method according to claim 1.

Citation Information

Patent Citations

  • Assessment of Liver Fibrosis Scoring Using a Serum Marker Algorithm

    JP2003532899A

  • Detection marker and detection kit for idiopathic fibroid lung

    JP2006292718A

  • Methods of diagnosing tissue fibrosis

    US20050186561A1

  • Marker Panels For Idiopathic Pulmonary Fibrosis Diagnosis And Evaluation

    US20120035067A1