Affinity agent

Abstract

Provided herein are affinity agents that comprise a ligand that specifically binds to a target molecule. The affinity agents are useful for binding, isolation, and / or purification.

Claims

1. An affinity agent comprising a solid support and a ligand, wherein the ligand is a polypeptide comprising the sequence LREAKERAIEEELRRRAGISSDYYFDLIQKAKTVEGVQALKDEILKA (SEQ ID NO: 15), or an amino acid sequence having three or fewer, two or fewer, or one or fewer substitutions, additions, or deletions compared to SEQ ID NO:

15. The ligand is the K of the interaction Ｄ The maximum value is 1 x 10 －９ An affinity agent that binds to albumin in an M-shape.

2. The affinity agent according to claim 1, wherein the ligand binds to serum albumin and / or one or more serum albumin fusion proteins.

3. The affinity agent according to claim 1, wherein the ligand binds to human serum albumin and / or one or more human albumin fusion proteins.

4. An affinity agent comprising a solid support and a ligand that binds to human serum albumin and / or human albumin fusion protein, The ligand is an affinity agent comprising at least one polypeptide having one of the amino acid sequences of SEQ ID NOs. 21 to 37, or an amino acid sequence having three or fewer, two or fewer, or one or fewer substitutions, additions, or deletions compared to one of SEQ ID NOs. 21 to 37.

5. The ligand comprises a polymerized polypeptide, and the polymerized polypeptide comprises at least two subunits. The affinity agent according to claim 1, wherein each subunit contains or consists of the polypeptide contained in the affinity agent according to claim 1.

6. The ligand comprises a polymerized polypeptide, and the polymerized polypeptide comprises at least two subunits. The affinity agent according to claim 4, wherein each subunit contains or consists of the polypeptide contained in the affinity agent according to claim 4.

7. The affinity agent according to claim 5, wherein not all of the aforementioned subunits are the same.

8. The affinity agent according to claim 6, wherein not all of the aforementioned subunits are the same.

9. The affinity agent according to claim 1, wherein the ligand is attached to the solid support.

10. The affinity agent according to claim 9, wherein the solid support is a resin, beads, a film, or a monolith.

11. The affinity agent according to claim 9, wherein the ligand is attached to the solid support via a linker.

12. The affinity agent according to claim 4, wherein the ligand is attached to the solid support.

13. The affinity agent according to claim 12, wherein the ligand is attached to the solid support via a linker.

14. A method for purifying a human serum albumin (HSA) protein or an HSA fusion protein, comprising contacting a solution containing the HSA protein or an HSA fusion protein with an affinity agent according to any one of claims 1 to 13.

15. A method for producing an affinity agent, comprising conjugating the ligand contained in the affinity agent according to any one of claims 1 to 8 onto a solid surface.

Images