Preparation and use of Anti-GPRC5d / BCMA / CD3 trispecific antibody
By mutating the charge and disulfide bonds of the trispecific antibody, the Fab region that specifically binds to BCMA is located at the N-terminus of CD3, which solves the problems of low purification yield, high aggregate size, and low affinity in the existing technology, achieving stronger tumor killing effect and lower immunogenicity, and improving the drug-likeness of the antibody.
Patent Information
- Application Number
- PCT/CN2024/097542
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-06-04
- Filing Date
- 2024-06-05
- Publication Date
- 2025-12-26
AI Technical Summary
Existing trispecific antibodies suffer from low purification yield, high aggregate size, low affinity for the BCMA antigen-binding region, and poor spatial positioning, resulting in weak tumor cell killing effects and issues with nonspecific T cell activation toxicity and antibody immunogenicity.
A trispecific antibody was designed to specifically bind to the Fab region of BCMA located at the N-terminus of CD3 by applying charge mutation and disulfide bond mutation. This avoids nonspecific T cell activation in the absence of tumor antigens, improves the affinity and purification yield of BCMA, reduces aggregation tendency, and enhances the killing effect of T cells.
It improved the affinity of BCMA, enhanced the tumor-killing effect, reduced the tendency to aggregate and the difficulty of purification, reduced non-specific cytotoxicity and antibody immunogenicity, and improved drug-likeness.
Smart Images

Figure PCTCN2024097542-APPB-I100001 
Figure PCTCN2024097542-APPB-I100002 
Figure PCTCN2024097542-APPB-I100003
Abstract
Description
Preparation and applications of anti-GPRC5D / BCMA / CD3 trispecific antibodies
[0001] Cross-reference to related applications
[0002] This application is based on and claims priority to Chinese patent applications No. 202310664900.5, filed on June 6, 2023, and No. 202410713270.0, filed on June 4, 2024, the entire contents of which are incorporated herein by reference. Technical Field
[0003] This invention relates to trispecific antigen-binding proteins, and more specifically, to trispecific antibodies that specifically bind to two tumor antigens, GPRC5D and BCMA, and the T-cell surface antigen CD3, as well as pharmaceutical compositions comprising the same, methods of preparation, and uses thereof. Background Technology
[0004] Bispecific T-cell antibodies (BsAbs) have been used in cancer treatment. These antibodies can form synapses between cytotoxic T lymphocytes and tumor cells, inducing tumor cell destruction. BsAbs typically involve dual targeting of tumor-associated antigens (TAAs) and T-cell surface antigens (also known as T-cell adaptor antigens, TEAs). However, BsAb-based treatment strategies typically rely on the distribution of TAAs on the tumor cells to be treated. This leads to selectivity and limitations in treatment for specific patient populations. Furthermore, studies have shown that treatments targeting a single TAA site may cause disease relapse due to tumor escape mechanisms, thus limiting treatment effectiveness.
[0005] The development of trispecific and / or tetraspecific antibodies has been proposed to effectively recruit immune cells to tumor sites and improve therapeutic efficacy. To this end, various multivalent, multispecific antibody formats have been described in recent years. However, the diverse requirements of different therapeutic products in terms of therapeutic functionality and behavior mean that there is no single "best format" applicable to most different desired molecular combinations. Therefore, achieving multispecificity requires consideration of multiple factors, including, for example, the spatial distribution or size of different target antigens and the expression density of tumor-associated antigens on the surface of tumor cells. In many cases, antibody formats effective for specific target antigen combinations must be identified by generating and comparing the functionality of different antibody formats.
[0006] B-cell maturation antigen (BCMA, also known as CD269 or TNFRSF17) is a member of the tumor necrosis factor receptor superfamily (TNFRSF). BCMA is a type III transmembrane protein containing a cysteine-rich domain (CRD) characteristic of TNFR family members within its extracellular domain (ECD). This domain forms a ligand-binding motif. BCMA ligands include B-cell activating factor (BAFF) and B-cell proliferation-inducing ligand (APRIL). APRIL binds to BCMA with a higher affinity, promoting tumor cell proliferation.
[0007] Preclinical models and human tumor studies have revealed that BCMA is overexpressed in multiple myeloma (MM) cells. It upregulates both classical and non-classical NF-κB signaling, promoting MM cell growth, survival, and adhesion, and inducing osteoclast activation, angiogenesis, metastasis, and immunosuppression. BCMA expression has become an important biomarker for MM diagnosis. Furthermore, serum sBCMA levels are elevated in MM patients, positively correlated with the number of MM cells in the bone marrow, and its concentration changes are closely related to MM prognosis and treatment response. Multiple myeloma, also known as plasmacytoma or Kaller's disease, is a refractory B-cell malignancy characterized by abnormal plasma cell proliferation. Given that BCMA is expressed only in plasma cells and not in native or memory B cells, it has become a popular therapeutic target for B-cell malignancies, especially multiple myeloma. There is a need in this field to develop antibodies against BCMA, particularly multispecific antibodies.
[0008] Although existing technologies, such as WO2022174813A1, disclose a trispecific antibody that specifically binds to CD3, BCMA, and GPRC5D, the BCMA antigen-binding region in this molecular structure is in the form of an scFv located at the C-terminus of the Fc. This presents the following problems: low antibody purification yield and high aggregate size; the scFv region of the BCMA antigen-binding region has low affinity for the antigen and is poorly positioned, resulting in weak BCMA-mediated tumor cell killing; the BCMA antigen-binding region contains some hotspot sites with poor drug-like properties.
[0009] Therefore, there is a need for a new anti-GPRC5D / BCMA / CD3 trispecific antibody that can overcome the above-mentioned shortcomings, has better tumor killing effect, and is easier to purify and drug.
[0010] Invention Overview
[0011] The present invention provides a trispecific antibody comprising a first antigen-binding region that specifically binds to BCMA, and second and third antigen-binding regions that specifically bind to other antigens.
[0012] In some implementations, the second antigen-binding region specifically binds to CD3, and the third antigen-binding region specifically binds to GPRC5D.
[0013] In some embodiments, the trispecific antibody of the present invention prevents light chain mismatch by applying charge mutations and disulfide bond mutations. In some embodiments, the first antigen-binding region that specifically binds to BCMA in the trispecific antibody of the present invention is Fab.
[0014] In some implementations, the second antigen-binding region that specifically binds to CD3 is Fab.
[0015] In some embodiments, the antigen-binding region specifically binding to BCMA, such as Fab, is located at the N-terminus of the antigen-binding region specifically binding to CD3, such as Fab. In some embodiments, when the trispecific antibody forms an immune synapse for T-cell killing, the T cells are closer to the tumor cells than with trispecific antibodies known in the prior art (e.g., the trispecific antibody disclosed in WO2022174813A1, particularly the scFv specifically binding to BCMA located at the C-terminus of Fc), thus the trispecific antibody of the present invention has stronger T-cell killing. In some embodiments, in the structure of the trispecific antibody of the present invention, the first antigen-binding region specifically binding to BCMA can mask the function of CD3, thus avoiding activation of peripheral nonspecific T cells and the resulting toxicity in the absence of tumor antigens.
[0016] In some embodiments, the trispecific antibody of the present invention has a specific antigen-binding region that specifically binds to BCMA, thereby having improved drugability and / or reduced antibody immunogenicity.
[0017] Therefore, the trispecific antibody of the present invention has one or more of the following advantages, particularly compared to the trispecific antibody disclosed in WO2022174813A1:
[0018] i) It has improved affinity for BCMA;
[0019] ii) It has enhanced BCMA-mediated tumor killing;
[0020] iii) It has a reduced tendency for antibody molecules to aggregate and / or an increased purification yield;
[0021] iv) It has stronger T-cell killing ability;
[0022] v) It has reduced non-specific cytotoxicity, for example, it can avoid activation of peripheral non-specific T cells and the resulting toxicity in the absence of tumor antigens;
[0023] vi) Has reduced antibody immunogenicity; and / or
[0024] vii) has improved drug-like properties. Attached Figure Description
[0025] The preferred embodiments of the invention described in the following detailed description will be better understood when read in conjunction with the accompanying drawings. The drawings show presently preferred embodiments for illustrative purposes. However, it should be understood that the invention is not limited to the precise arrangement and means of the embodiments shown in the drawings.
[0026] Figure 1 shows exemplary structures of trispecific antibodies, where Figure 1A corresponds to the B3 and B3b forms, Figure 1B corresponds to the B5 structure, and Figure 1C corresponds to the F2 form.
[0027] Figure 2A shows the cell-based affinity of the example antibody for human BCMA (GS-CHO-hBCMA)-1.
[0028] Figure 2B shows the cell-based affinity of the example antibody for human BCMA (GS-CHO-hBCMA)-2.
[0029] Figure 2C shows the cell-based affinity of the example antibody to cynomolgus monkey BCMA (GS-CHO-cynoBCMA-1).
[0030] Figure 2D shows the cell-based affinity of the example antibody for human GPRC5D (GS-CHO-hGPRC5D)-1.
[0031] Figure 2E shows the cell-based affinity of the example antibody for human GPRC5D (GS-CHO-hGPRC5D)-2.
[0032] Figure 2F shows the cell-based affinity of the example antibody for cynomolgus monkey GPRC5D (GS-CHO-cynoGPRC5D).
[0033] Figure 2G shows the cell-based affinity of the example antibody for human CD3 (Jurkat)-1.
[0034] Figure 2H shows the example antibody versus human CD3 (CD8) + T cells, CD4 + Cell-based affinity of T cells.
[0035] Figure 2I shows the cell affinity of the example antibody with 293T cells expressing the mutant BCMA antigen.
[0036] Figure 2J shows the cell affinity of the example antibody to GS CHO cells expressing the mutant BCMA antigen.
[0037] Figure 3A shows the example antibody-mediated killing effect of PBMCs on H929 ko GPRC5D cells-1.
[0038] Figure 3B shows the example antibody-mediated killing effect of PBMCs on H929 ko GPRC5D cells-2.
[0039] Figure 3C shows the example antibody-mediated killing effect of PBMCs on H929 ko GPRC5D cells-3.
[0040] Figure 3D shows the example antibody-mediated killing effect of PBMCs on H929 ko BCMA cells-1.
[0041] Figure 3E shows the example antibody-mediated killing effect of PBMCs on H929 ko BCMA cells-2.
[0042] Figure 3F shows the example antibody-mediated killing effect of PBMCs on H929 ko BCMA cells-3.
[0043] Figure 3G shows the example antibody-mediated killing effect of PBMCs on H929 cells-1.
[0044] Figure 3H shows the example antibody-mediated killing effect of PBMCs on H929 cells-2.
[0045] Figure 3I shows the example antibody-mediated killing effect of PBMCs on H929 cells-3.
[0046] Figure 3J shows the example antibody-mediated killing effect of PBMCs on L363 cells-1.
[0047] Figure 3K shows the example antibody-mediated killing effect of PBMCs on L363 cells-2.
[0048] Figure 3L shows the example antibody-mediated killing effect of PBMCs on L363 cells-3.
[0049] Figure 3M shows the example antibody-mediated killing effect of PBMCs on L363 cells-4.
[0050] Figure 3N shows the example antibody-mediated killing effect of PBMCs on mixed cells-1.
[0051] Figure 3O shows the example antibody-mediated killing effect of PBMCs on mixed cells-2.
[0052] Figure 3P shows the example antibody-mediated killing effect of PBMCs on non-target cells Calu-6.
[0053] Figure 3Q shows the release of three cytokines (at three antibody concentrations) during the example antibody-mediated killing of H929 by PBMCs -1.
[0054] Figure 3R shows the release of three cytokines (at three antibody concentrations) during the example antibody-mediated killing of H929 by PBMCs -2.
[0055] Figure 3S shows the amount of non-antigen-specific cytokines released by example antibody-mediated PBMCs (no target cells, 3 antibody concentrations)-1.
[0056] Figure 3T shows the amount of non-antigen-specific cytokines released by example antibody-mediated PBMCs (no target cells, 3 antibody concentrations)-2.
[0057] Figure 3U shows the example antibody-mediated killing effect of PBMCs on the BCMA-overexpressing mutant GS CHO.
[0058] Figure 4A shows the activation of CD4 T cells in PBMCs mediated by an example antibody in the presence of sBCMA.
[0059] Figure 4B shows the activation of CD8 T cells in PBMCs mediated by an example antibody in the presence of sBCMA.
[0060] Figure 4C shows the example antibody-mediated killing of H929 cells by PBMCs in the presence of sBCMA.
[0061] Figure 5A shows the antitumor effect of the example antibody in the H929 ko GPRC5D tumor-bearing humanized mouse model. The dosage and statistical methods are labeled in the figure caption. The administration times are day 7, day 14 and day 21 after tumor cell inoculation.
[0062] Figure 5B shows the tumor-suppressive effect of the example antibody in the H929 ko BCMA tumor-bearing humanized mouse model. The dosage and statistical methods are labeled in the figure captions. The administration times were day 7 and day 14 after tumor cell inoculation, respectively.
[0063] Figure 5C shows the tumor-suppressive effect of the example antibody in an MM1S tumor-bearing humanized mouse model. The dosage is labeled in the figure caption, and the administration times are day 7 and day 14 after tumor cell inoculation, respectively.
[0064] Figure 5D shows the tumor-suppressive effect of the example antibody in the L363 tumor-bearing humanized mouse model, with administration times on day 7 and day 18 after tumor cell inoculation.
[0065] Figure 6 shows the flow cytometry results of BCMA and GPRC5D expression in H929, H929 ko GPRC5D, and H929 ko BCMA cell lines.
[0066] Figure 7 shows the aggregate differences between B3(24) molecules and the control molecule (F2(24)).
[0067] Invention Details
[0068] Unless otherwise specified, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. All publications, patent applications, patents, and other references mentioned herein are incorporated herein by reference in their entirety. Furthermore, the materials, methods, and examples described herein are illustrative only and are not intended to be limiting. Other features, objects, and advantages of the invention will become apparent from this specification and the accompanying drawings, and from the appended claims.
[0069] definition
[0070] It should be understood that the present invention is not limited to the specific methodologies, schemes, and reagents described herein, as these can vary. It should also be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to limit the scope of the invention, which is limited only by the appended claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains.
[0071] For the purpose of interpreting this specification, the following definitions will be used, and terms used in the singular may also include plural forms, where appropriate.
[0072] The term “about” when used in conjunction with a numeric value means to cover a range of numeric values that have a lower limit of 5% less than the specified numeric value and an upper limit of 5% greater than the specified numeric value.
[0073] As used herein, the term “and / or” means any one of the options or two or more or all of the options.
[0074] As used herein, the terms “comprising” or “including” mean to include the stated elements, integers, or steps, but do not exclude any other elements, integers, or steps. In this document, when the terms “comprising” or “including” are used, they also cover situations consisting of the stated elements, integers, or steps, unless otherwise specified. For example, when referring to an antibody variable region “comprising” a specific sequence, it is also intended to cover the antibody variable region consisting of that specific sequence.
[0075] The term "GPRC5D" refers to member D of the tumor-associated antigen G protein-coupled receptor family, group C5 (e.g., human GPRC5D protein under accession number UniProt Q9NZD1). In one embodiment, flow cytometry analysis shows that the antigen-binding region of the antibody molecule of the present invention, which binds to GPRC5D, exhibits high affinity binding activity to cells expressing GPRC5D, for example, 1-150 nM, such as 20-135 nM, for cells expressing human GPRC5D. 50 Value. In one embodiment, the antigen binding specificity is cross-reactive to human and monkey GPRC5D.
[0076] The term "BCMA" refers to the tumor-associated antigen B-cell maturation antigen, also known as BCMA, TR17-human, TNFRSF17 (e.g., human BCMA protein under accession number UniProt Q02223). "BCMA" encompasses not only wild-type proteins but also mutants, such as natural variants or variants mutated in disease (especially variants with mutations leading to drug resistance). In one embodiment, the antigen-binding region of the antibody molecule of the present invention, which binds to BCMA, can exhibit high affinity binding activity to BCMA, for example, 0.1-10 nM, such as 0.125 nM, for human BCMA, as detected by biofilm layer optical interference technology. D Value. In one embodiment, the antigen binding specificity exhibits cross-reactivity with human and monkey BCMA.
[0077] The term "CD3" refers to the T cell adaptor antigen, the T cell surface glycoprotein CD3 (e.g., the human CD3 protein under accession number UniProt P07766). In one embodiment, the antigen-binding region of the antibody molecule of the present invention, detected by biofilm layer optical interference technology, exhibits high affinity binding activity to CD3 (e.g., CD3E&G) and a KD value of, for example, 10-100 nM, such as 10-70 nM, for human CD3E&G. In one embodiment, the antigen-binding specificity exhibits cross-reactivity with human and monkey CD3.
[0078] When “first,” “second,” and “third” are mentioned in this article, they are only used to distinguish the three domains, three chains, or three antigen-binding regions, and do not in any way indicate the location of the three domains or three antigen-binding regions.
[0079] In describing the antibody structure of the present invention, the term "N-terminus / N-terminus" refers to the last amino acid at the N-terminus, and the term "C-terminus / C-terminus" refers to the last amino acid at the C-terminus.
[0080] As used herein, the terms “binding” or “specific binding” mean that the binding is selective for the antigen and can be distinguished from unwanted or nonspecific interactions. The ability of an antigen-binding site to bind to a specific antigen can be determined by enzyme-linked immunosorbent assay (ELISA) or conventional binding assays known in the art.
[0081] “Affinity” or “binding affinity” refers to the inherent binding affinity that reflects the interaction between members of a binding pair. The affinity of molecule X for its partner Y can usually be represented by the dissociation constant (KD), which is the ratio of the dissociation rate constant to the association rate constant (kdis and kon, respectively). Affinity can be measured by common methods known in the art. One specific method used to measure affinity is the ForteBio kinetic binding determination described in this paper.
[0082] The term "target" refers to the substance that the binding molecule is directed against. A target can be an antigen, a ligand, or a receptor. The term "antigen" refers to a molecule that elicits an immune response. This immune response may involve antibody production or activation of specific immune cells, or both. Those skilled in the art will understand that any macromolecule, including virtually all proteins or peptides, can be used as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. As used herein, the term "epitope" refers to a portion of an antigen that specifically interacts with an antibody molecule. In some embodiments, the antigen is a tumor-associated antigen (i.e., an antigen associated with the development and progression of tumors) or a T-cell connector.
[0083] As used herein, the term "target-binding region" refers to the portion of a multispecific binding molecule, such as a trispecific binding molecule, that binds to a specific target or antigen. The target-binding region can be, for example, the antibody or immunoglobulin itself or an antibody fragment. Such a target-binding region may or may not have a tertiary structure independent of the remaining portion of the multispecific antibody molecule and may bind to or not bind to its target as a standalone entity. The target-binding region can also be a receptor or ligand, or a ligand-binding domain of a receptor. In the case of multispecific antibodies, the "target-binding region" is also referred to as the "antigen-binding region." In one embodiment, the antigen-binding region of the multispecific antibody molecule of the present invention comprises a VH / VL pair consisting of a variable region (VL) of the antibody light chain and a variable region (VH) of the antibody heavy chain, said VH / VL pair may be contained in two separate polypeptide chains (e.g., in the Fab heavy chain and the Fab light chain, respectively). In one embodiment, the antigen-binding region of the trispecific antibody molecule of the present invention may be Fab.
[0084] The “IgG-like multispecific antibody” mentioned in this article refers to a multispecific antibody containing an Fc dimer.
[0085] The term "multispecific binding molecule" refers to a multispecific binding molecule that is at least bispecific, such as a trispecific binding molecule, meaning that the molecule comprises at least a first target binding region, a second target binding region, and a third target binding region, wherein the first target binding region binds to one target, the second target binding region binds to another target, and the third target binding region binds to a third target. Therefore, the multispecific binding molecule according to the present invention comprises specificity for at least two different targets. In some embodiments, when the binding molecule is an antibody, the target is an antigen. In some embodiments, the multispecific binding molecule of the present invention is a multispecific antibody, such as a trispecific antibody.
[0086] As used herein, the term "multispecific" antibody refers to an antibody having at least two antigen-binding regions, each of which binds to a different epitope of the same antigen or to a different epitope of a different antigen. A multispecific antibody is an antibody that has binding specificity to at least two different antigenic epitopes. In one embodiment, this document provides a trispecific antibody having binding specificity against a first antigen, a second antigen, and a third antigen. For example, the present invention provides a trispecific antibody against BCMA, GPRC5D, and CD3.
[0087] When "first antigen-binding region" is mentioned in multispecific or trispecific antibodies, it refers to the region that binds to the first antigen, and is not intended to limit the number of such antigen-binding regions contained in the antibody. For example, a multispecific antibody may contain one or more first antigen-binding regions. Similarly, a trispecific antibody may contain a first antigen-binding region, a second antigen-binding region, and a third antigen-binding region, but may contain one or more first antigen-binding regions and one or more second antigen-binding regions or one or more third antigen-binding regions. In some embodiments, the antibody molecule of the present invention contains at least one antigen-binding region specifically binding to GPRC5D, at least one antigen-binding region specifically binding to BCMA, and at least one antigen-binding region specifically binding to CD3. In some embodiments, the antibody molecule of the present invention contains one antigen-binding region specifically binding to GPRC5D, one antigen-binding region specifically binding to BCMA, and one antigen-binding region specifically binding to CD3.
[0088] When it is mentioned that "the antigen-binding region is derived from the antibody," it means that the binding domain constituting the antigen-binding region is or is derived from the binding domain of the antibody's specific antigen-binding domain. For example, the antigen-binding region's specific antigen-binding fragment, such as Fab, is or is derived from the corresponding fragment of the antibody, such as Fab; or the heavy chain variable region and / or light chain variable region of the antigen-binding region are or are derived from the heavy chain variable region and / or light chain variable region of the antibody; or one, two, three, four, five, or six CDRs of the antigen-binding region are CDRs of the antibody. The term "derived from" means that the fragment in the antigen-binding region is substantially the same as the fragment from the antibody from which it originates, but has mutations at one or more sites, such as substitution, deletion, or addition. In one specific embodiment, the mutation is not in the antibody's CDR. In one specific embodiment, the mutation is not in the antibody's variable region.
[0089] The terms "full-length antibody" or "complete antibody" are used interchangeably herein and refer to antibody molecules that have the molecular structure of natural immunoglobulins. In the case of a conventional four-chain IgG antibody, a full-length antibody consists of two heavy chains (H) and two light chains (L) linked together by disulfide bonds. In the case of a heavy chain antibody that has only heavy chains and lacks light chains, a full-length antibody consists of two heavy chains (H) linked together by disulfide bonds. For a conventional four-chain IgG antibody, the heavy chain of a full-length antibody typically consists of a heavy chain variable region (abbreviated as VH in this document) and a heavy chain constant region, wherein the heavy chain constant region contains at least three domains CH1, CH2, and CH3. The light chain of a full-length antibody consists of a light chain variable region (abbreviated as VL in this document) and a light chain constant region, wherein the light chain constant region consists of one domain CL. Each heavy chain variable region VH and each light chain variable region consists of three CDRs and four FRs, arranged in the following order from the amino terminus to the carboxyl terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The term "antibody fragment" includes a portion of a complete antibody. In a preferred embodiment, the antibody fragment is an antigen-binding fragment.
[0090] The term "antigen-binding fragment" in antibody refers to a molecule distinct from a full-length antibody. It contains a portion of the full-length antibody but can bind to the antigen of the full-length antibody or compete with the full-length antibody (i.e., the full-length antibody from which the antigen-binding fragment originates) for antigen binding. Antigen-binding fragments can be prepared using recombinant DNA technology or by enzymatic or chemical cleavage of intact antibodies. Antigen-binding fragments include, but are not limited to, Fab, Fab', F(ab')2, Fv, single-chain Fv, diabody, single-domain antibody (sdAb), and nanobodies. For example, Fab fragments can be obtained by digesting a full-length antibody with papain. Furthermore, digestion of a complete antibody with pepsin below the disulfide bonds in the hinge region produces F(ab')2, a dimer of Fab' and a divalent antibody fragment. F(ab')2 can be reduced under neutral conditions by breaking the disulfide bonds in the hinge region, thereby converting the F(ab')2 dimer into Fab' monomers. Fab' monomers are essentially Fab fragments with hinge regions. Fv fragments consist of the VL and VH domains of the antibody's single arm. The two domains VL and VH of the Fv fragment can be encoded by independent genes, but they can also be produced as a single protein chain by using a recombinant approach, connecting the two domains with a synthetic linker peptide, and pairing the VL and VH regions in the single protein chain to form a single-chain Fv (scFv).
[0091] The term "variable region" refers to a domain of the heavy or light chain of an antibody that participates in antibody-antigen binding. The variable regions of the heavy and light chains of natural antibodies typically have similar structures, with each domain containing four conserved frame regions (FRs) and three complementarity-determining regions. In some cases, a single VH or VL domain may be sufficient to provide antigen-binding specificity.
[0092] The term "Fab fragment" or "Fab" is used interchangeably herein to refer to an immunoglobulin fragment consisting of two polypeptide chains containing the immunoglobulin heavy chain variable region VH, the heavy chain constant domain CH1, the light chain variable region VL, and the light chain constant domain CL. One polypeptide chain contains VH and a constant domain selected from CH1 and CL from the N-terminus to the C-terminus, and the other polypeptide chain contains VL and another constant domain selected from CL and CH1 from the N-terminus to the C-terminus. The VH and VL domains pair to form an antigen-binding site. In this document, the Fab polypeptide chain containing the heavy chain constant region CH1 is also referred to as the "Fab heavy chain"; correspondingly, the Fab polypeptide chain containing the light chain constant region CL is also referred to as the "Fab light chain."
[0093] The complementarity-determining region (CDR) or CDR is a region in the antibody variable region that is highly variable in sequence and forms a structurally defined loop ("hypervariant loop") and / or contains antigen contact residues ("antigen contact sites"). The CDR is primarily responsible for binding to antigen epitopes. The CDRs of the heavy and light chains are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus. CDRs located within the antibody heavy chain variable region are called HCDR1, HCDR2, and HCDR3, while those located within the antibody light chain variable region are called LCDR1, LCDR2, and LCDR3. In a given light chain variable region or heavy chain variable region amino acid sequence, the precise amino acid sequence boundaries of each CDR can be determined using any one or a combination of many known antibody CDR assignment schemes, including, for example: Chothia (Chothia et al. (1989) Nature 342:877-883, Al-Lazikani et al., “Standard conformations for the canonical structures of immunoglobulins”, Journal of Molecular Biology, 273, 927-948 (1997)) based on antibody three-dimensional structure and CDR loop topology; Kabat (Kabat et al., Sequences of Proteins of Immunological Interest, 4th ed., USDapartment of Health and Human Services, National Institutes of Health (1987)) based on antibody sequence variability; AbM (University of Bath); Contact (University College London); and the International ImMunoGeneTics. The database (IMGT) (on the World Wide Web at imgt.cines.fr / ) and the North CDR definition based on affinity propagation clustering using a large number of crystal structures.
[0094] The term "Fc domain" or "Fc region" is used herein to define the C-terminal region of an immunoglobulin heavy chain containing at least a portion of its constant region. This term includes native sequence Fc regions and variant Fc regions. A native immunoglobulin "Fc domain" contains two or three constant domains: a CH2 domain, a CH3 domain, and optionally a CH4 domain. For example, in native antibodies, an immunoglobulin Fc domain contains the second and third constant domains (CH2 and CH3 domains) of two heavy chains derived from IgG, IgA, and IgD antibodies; or it contains the second, third, and fourth constant domains (CH2, CH3, and CH4 domains) of two heavy chains derived from IgM and IgE antibodies. Unless otherwise stated herein, amino acid residues in the Fc region or heavy chain constant region are numbered according to the EU numbering system (also known as the EU index) as described in Kabat et al., Sequences of Proteins of Immunological Interes, 5th Edition, Public Health Service, National Institutes of Health, Bethesda, MD, 1991. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Two Fc regions can dimerize to form a dimer Fc, and two distinct Fc regions can heterodimerize to form a heterodimeric Fc. In this document, the terms “Fc region,” “Fc portion,” and “dimeric Fc (e.g., heterodimeric Fc)” do not include the heavy chain variable region VH and light chain variable region VL of immunoglobulins, nor the heavy chain constant region CH1 and light chain constant region CL, but in some cases may include the hinge region at the N-terminus of the heavy chain constant region. In one embodiment, the Fc region of the human IgG heavy chain extends from Asp221 or from Cys226 or from Asp231 to the carboxyl terminus of the heavy chain.
[0095] In some embodiments, the multispecific antibody of the present invention comprises an Fc region. In one embodiment, the Fc region is a human Fc region. In one embodiment, the Fc region belongs to the human IgG4 subclass. In one embodiment, the Fc region belongs to the human IgG1 subclass.
[0096] In one embodiment, the human IgG1 Fc region polypeptide (including the hinge region) comprises the following amino acid sequence:
[0097] The human IgG4 Fc region polypeptide (including the hinge region) contains the following amino acid sequence:
[0098] In this article, "heterodimeric Fc or Fc heterodimer" refers to a scaffold containing two different Fc regions or formed by dimerization of two different Fc regions, which can be connected to an antigen-binding domain (e.g., the heavy chain and / or light chain variable region of an antibody that can bind to a target molecule or an antigen-binding fragment of an antibody, or a soluble portion of a ligand or receptor that can bind to a target molecule) at its N-terminus or C-terminus to form a multispecific antibody, such as a bispecific antibody.
[0099] The term "CH1 region" refers to the portion of the antibody heavy chain polypeptide extending from EU position 118 to EU position 220 (EU numbering system). In one embodiment, the CH1 domain contains the amino acid sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC (SEQ ID NO: 82). In one embodiment, the internal disulfide bond is removed by mutating a cysteine residue in CH1 to a non-cysteine residue, or a new disulfide bond is remodeled by mutating a non-cysteine residue to a cysteine residue.
[0100] The term "CH2 region" refers to the portion of the antibody heavy chain polypeptide extending from EU position 231 to EU position 340 (EU numbering system). In one embodiment, the CH2 domain contains...
[0101] Amino acid sequence of APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK (SEQ ID NO: 83).
[0102] The term "CH3 region" refers to the portion of the antibody heavy chain polypeptide extending from EU position 341 to EU position 447. In one embodiment, the CH3 domain comprises the amino acid sequence GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 84).
[0103] The term "hinge region" refers to a portion of an antibody heavy chain polypeptide that connects the CH1 and CH2 regions in the wild-type antibody heavy chain, such as the IgG1 hinge region, for example, the sequence D221 to P230 according to EU designations. Hinge regions of other IgG subclasses can be identified by aligning cysteine residues of the hinge region with the IgG1 subclass sequence. Hinge regions are typically dimer molecules composed of two polypeptides having the same amino acid sequence. In one embodiment, the hinge region has the amino acid sequence DKTHTCPXCP (SEQ ID NO: 99), where X is S or P. In one embodiment, the hinge region comprises the amino acid sequence HTCPXCP (SEQ ID NO: 19), where X is S or P. In one embodiment, the hinge region comprises the amino acid sequence CPXCP (SEQ ID NO: 81), where X is S or P. In one embodiment, the internal disulfide bonds of the hinge region are removed by mutating cysteine residues in the hinge region to non-cysteine residues.
[0104] As used herein, the amino acid positions of all variable regions of the heavy and light chains are numbered according to the Kabat numbering system described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991), and referred to herein as the “Kabat numbering”.
[0105] As used herein, when referring to amino acid positions in domains other than the variable region of an antibody (e.g., constant regions, such as the Fc region), the positions are numbered according to the EU numbering system described in Edelman, G.M. et al., Proc. Natl. Acad. USA, 63, 78-85 (1969) and referred to herein as “EU numbers”. When a position number and / or amino acid residue is assigned to a particular antibody isotype, it is intended to be applicable to the corresponding position and / or amino acid residue in any other antibody isotype, as is known to those skilled in the art.
[0106] As used herein, the term "connector" refers to any molecule that enables the direct linking of different parts of a multispecific antibody. Examples of connectors that establish covalent links between different parts of a multispecific antibody include peptide connectors and non-protein polymers, including but not limited to polyethylene glycol (PEG), polypropylene glycol, polyoxyethylene, or copolymers of PEG and polypropylene glycol. In some embodiments, the term "peptide connector" according to the invention refers to a sequence of amino acids that links the amino acid sequences of the various parts of the multispecific antibody together. Preferably, the peptide connector has a length sufficient to connect two entities in such a way that they maintain their conformation relative to each other without hindering the desired activity. Peptide connectors may or may not primarily comprise the following amino acid residues: Gly, Ser, Ala, or Thr. Useful connectors include glycine-serine polymers, including, for example, (GS). n (SEQ ID NO:112), (GSGGS) n (SEQ ID NO:113), (GGGGS) n (SEQ ID NO:114), (GGGS) n (SEQ ID NO:115) and (GGGGS) n G (SEQ ID NO: 116), where n is an integer of at least 1 (and preferably 2, 3, 4, 5, 6, 7, 8, 9, 10). Useful connectors also include glycine-alanine polymers, alanine-serine polymers, and other flexible connectors.
[0107] "Separated" antibodies refer to antibodies that have been separated from components of their natural environment. In some embodiments, antibodies are purified to a purity of more than 95% or 99%, as determined by, for example, electrophoresis (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatography (e.g., ion exchange or reversed-phase HPLC).
[0108] "Isolated" nucleic acids refer to nucleic acid molecules that have been separated from components of their natural environment. Isolated nucleic acids include those contained in cells that normally contain them, but which are located extrachromosomally or at chromosomal locations other than their natural chromosomal locations. "Isolated nucleic acids encoding antibodies" refers to one or more nucleic acid molecules whose chains or fragments encode antibodies, including such nucleic acid molecules in a single or separate vector, and such nucleic acid molecules present at one or more locations within a host cell.
[0109] The following is a calculation of sequence identity between sequences.
[0110] To determine the percentage of identity between two amino acid sequences or two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., vacancies may be introduced in one or both of the first and second amino acid sequences or nucleic acid sequences for optimal alignment, or non-homologous sequences may be discarded for comparison purposes). In a preferred embodiment, for comparison purposes, the length of the reference sequence being aligned is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the reference sequence length. The amino acid residues or nucleotides at corresponding amino acid or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide at the corresponding position in the second sequence, the molecules are identical at that position.
[0111] The term "amino acid substitution" or "amino acid mutation" refers to the replacement of at least one amino acid residue in a predetermined parental amino acid sequence with a different "substituted" amino acid residue. This substituted residue or residues can be "naturally occurring amino acid residues" (i.e., encoded by the genetic code) and are selected from: alanine (Ala); arginine (Arg); asparagine (Asn); aspartic acid (Asp); cysteine (Cys); glutamine (Gln); glutamic acid (Glu); glycine (Gly); histidine (His); isoleucine (Ile); leucine (Leu); lysine (Lys); methionine (Met); phenylalanine (Phe); proline (Pro); serine (Ser); threonine (Thr); tryptophan (Trp); tyrosine (Tyr); and valine (Val). The definition of amino acid substitution in this document also includes substitution with one or more non-naturally occurring amino acid residues. "Non-naturally occurring amino acid residues" refer to residues other than those listed above that are naturally occurring amino acid residues, which can covalently bind to adjacent amino acid residues in a polypeptide chain. Examples of non-naturally occurring amino acid residues include ornithine, ornithine, valine, homoserine, Aib, and other amino acid residue analogs.
[0112] The term "conservative alteration" or "conservative modification" refers to amino acid modifications or changes that do not significantly affect or alter the binding characteristics of an antibody or antibody fragment containing an amino acid sequence. Such conserved modifications include conserved amino acid substitutions, additions, and deletions. Modifications can be introduced into the antibodies or antibody fragments of the present invention using standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative substitution is an amino acid substitution in which an amino acid residue is replaced by an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), β-side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0113] Amino acid mutations are represented as (original amino acid, amino acid position, mutated amino acid). For example, when the mutation site is located in the V region, "Q39D" means that the glutamine amino acid at position 39 of the Kabat line is replaced by aspartic acid (D); when the mutation site is located in the C region, "Q124C" means that the glutamine at position 124 of the EU line is replaced by cysteine (C). When referring to amino acid positions in this invention, unless otherwise specified, it refers to the amino acid position numbered according to the IgG1 heavy chain or kappa light chain, that is, it encompasses the amino acid positions based on the IgG1 heavy chain or kappa light chain number, as well as amino acid positions on other heavy chains or light chains corresponding to the stated amino acid position. It should be noted that when describing mutations, the original amino acid at a specific position can be the described amino acid or another amino acid at the corresponding position.
[0114] The term "knob-in-hole" mutation, or "knob-in-hole" mutation, is used herein to refer to the introduction of mutations into a first Fc polypeptide and a second Fc polypeptide, respectively, using a "knob-in-hole" technique to form a protrusion ("knob") and a complementary hole ("hole") at the interface between the first and second Fc polypeptides. Knob-in-hole techniques are known in the art to modify interfaces between different chains of an antibody molecule to facilitate proper association between the chains. Typically, this technique involves introducing a "protrusion" at the interface of one chain and a corresponding "hole" at the interface of the chain to be paired with it, allowing the protrusion to be placed within the hole. A preferred interface comprises the CH3 domain of the heavy chain constant domain of one chain and the CH3 domain of the heavy chain constant domain of the chain to be paired with it. The protrusion can be constructed by replacing a small amino acid side chain from the CH3 domain interface of the heavy chain constant domain of one chain with a larger side chain (e.g., tyrosine or tryptophan). By replacing large amino acid side chains with smaller side chains (e.g., alanine or threonine), compensating holes of the same or similar size as the protrusions are constructed at the interface of the CH3 domain of the heavy chain constant domain of the other chain to be paired. Another alternative interface is the CL domain of the Fab fragment described above, containing the light chain and the CH1 domain of the heavy chain, which promotes proper heterodimerization between the two chains of the Fab fragment by constructing protrusion-hole interactions.
[0115] The term "effective function" refers to those biological activities attributable to the Fc region of immunoglobulins that vary with immunoglobulin isotype. Examples of immunoglobulin effector functions include: Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen-presenting cells, C1q binding and complement-dependent cytotoxicity (CDC), downregulation of cell surface receptors (e.g., B cell receptors), and B cell activation.
[0116] The term "antibody-dependent cell-mediated cytotoxicity (ADCC)" refers to one of the main mechanisms by which certain cytotoxic effector cells (e.g., natural killer (NK) cells) mediate the killing of target cells and foreign host cells. In some embodiments, the antibodies of the present invention provide antibody-dependent cytotoxic effects of T lymphocytes and enhance antibody-dependent cytotoxic effects of NK cells.
[0117] The term "antibody-dependent phagocytosis (ADCP)" refers to a cellular response in which antibodies binding to target cells bind to FcγRIIIa on the surface of macrophages, inducing macrophage activation, thereby internalizing the target cells and acidifying and degrading the phagosomes. ADCP can also be mediated by FcγRIIa and FcγRI, but to a lesser extent.
[0118] The term "pharmaceutical composition" refers to a composition which is present in a form that allows the biological activity of the active ingredient contained therein to be effective, and which does not contain any additional ingredients that would have unacceptable toxicity to a subject administering the composition.
[0119] The term "pharmaceutical excipients" refers to pharmaceutically acceptable carriers, diluents, adjuvants (e.g., Freund's adjuvants (complete and incomplete)), excipients, buffers, or stabilizers that are applied together with the active substance.
[0120] "Conjugate" is an antibody conjugated to one or more other substances (including but not limited to therapeutic agents or labels).
[0121] The terms “individual” or “subject” are used interchangeably and include mammals. Mammals include, but are not limited to, domesticated animals (e.g., cattle, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In particular, an individual or subject is a human being.
[0122] The term "tumor" refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues. The term "tumor" encompasses both solid tumors and liquid tumors. In some implementations, a tumor is cancer. The terms "cancer" and "cancerous" refer to physiological disorders of unregulated cell growth in mammals. The terms "cancer," "cancerous," and "tumor" are not mutually exclusive when used herein.
[0123] When used herein, "treatment" means to slow, interrupt, block, alleviate, stop, reduce, or reverse the progression or severity of existing symptoms, conditions, illnesses, or diseases. Desired therapeutic effects include, but are not limited to, preventing the onset or recurrence of disease, alleviating symptoms, reducing any direct or indirect pathological consequences of the disease, preventing metastasis, slowing the rate of disease progression, improving or mitigating the disease state, and alleviating or improving prognosis. In some embodiments, the antibody molecules of the present invention are used to delay disease development or to slow disease progression.
[0124] When used herein, “prevention” includes the suppression of the occurrence or development of a disease or condition or symptoms of a particular disease or condition. In some implementations, subjects with a family history of cancer are candidates for preventative protocols. Generally, in the context of cancer, the term “prevention” refers to the administration of a drug prior to the onset of signs or symptoms of cancer, particularly prior to the onset of cancer symptoms in subjects at risk of cancer.
[0125] The term "effective amount" refers to such an amount or dose of the antibody or composition of the present invention that, when administered to a patient in a single or multiple doses, produces the intended effect in a patient requiring treatment or prevention.
[0126] "Therapeutic effective dose" refers to the amount that, at the required dose and for the required duration, effectively achieves the desired therapeutic outcome. A therapeutic effective dose is also a dose in which any toxic or harmful effects of the antibody, antibody fragment, or combination thereof outweigh the beneficial therapeutic effects.
[0127] "Prophylactic effective dose" refers to the amount of medication administered at the required dose for the required duration to effectively achieve the desired preventive outcome. Typically, because prophylactic doses are administered to individuals before or at an early stage of the disease, the prophylactic effective dose will be less than the therapeutic effective dose.
[0128] The term "drug combination" refers to non-fixed combination products or fixed combination products, including but not limited to pillboxes. The term "non-fixed combination" means that active ingredients (e.g., (i) the antibodies of the present invention, and (ii) other therapeutic agents) are administered to a patient simultaneously, without a specific time limit, or sequentially at the same or different time intervals, in separate entities, wherein such administration to the patient provides a preventive or therapeutically effective level. In some embodiments, the antibodies of the present invention used in the drug combination are administered at levels not exceeding those achieved when used alone. The term "fixed combination" means that two or more active agents are administered to a patient simultaneously in the form of a single entity. Preferably, the dosage and / or time interval of the two or more active agents are selected so that the combined use of the components produces an effect greater than that achieved by using any one component alone in treating a disease or condition. The components may each be in separate formulations, and their formulations may be the same or different.
[0129] The term "combination therapy" refers to the administration of two or more therapeutic agents or treatment modalities (e.g., radiation therapy or surgery) to treat the disease described herein. Such administration includes the co-administration of these therapeutic agents in a substantially simultaneous manner, such as in a single capsule containing active ingredients in a fixed proportion. Alternatively, such administration includes the co-administration of individual active ingredients in multiple or separate containers (e.g., tablets, capsules, powders, and liquids). Powders and / or liquids may be reconstituted or diluted to the desired dose prior to administration. Furthermore, such administration includes the sequential administration of each type of therapeutic agent at substantially the same time or at different times. In either case, the treatment regimen will provide the beneficial effect of the combination of drugs in treating the condition or symptom described herein.
[0130] The term "vector," as used herein, refers to a nucleic acid molecule capable of replicating another nucleic acid linked to it. This term includes vectors that function as self-replicating nucleic acid structures as well as vectors that bind to the genome of a host cell that has already been introduced therein. Some vectors are capable of directing the expression of nucleic acids operatively linked to them. Such vectors are referred to herein as "expression vectors."
[0131] The term "host cell" refers to a cell into which exogenous polynucleotides have been introduced, including the progeny of such cells. Host cells include "transformers" and "transformed cells," which include primary transformed cells and their derived progeny, regardless of the number of passages. Host cells can be any type of cell system that can be used to produce the antibody molecules of this invention, including eukaryotic cells, such as mammalian cells, insect cells, and yeast cells; and prokaryotic cells, such as *E. coli* cells. Host cells include cultured cells, as well as cells within transgenic animals, transgenic plants, or cultured plant or animal tissues.
[0132] As used herein, the term "label" refers to a compound or composition that is directly or indirectly conjugated or fused to a reagent (such as an antibody) and facilitates the detection of the conjugated or fused reagent. The label itself may be detectable (e.g., radioisotope labeling or fluorescent labeling) or, in the case of enzymatic labeling, may catalyze a chemical change in a detectable substrate compound or composition. The term is intended to cover both direct labeling of probes or antibodies by conjugating (i.e., physically linking) a detectable substance to the probe or antibody, and indirect labeling of probes or antibodies by reacting with another directly labeled reagent. Examples of indirect labeling include the detection of a first antibody using a fluorescently labeled second antibody and the end labeling of a biotinylated DNA probe, making it detectable with a fluorescently labeled streptomycin protein.
[0133] "Subject / Patient Sample" refers to a collection of cells, tissues, or body fluids obtained from a patient or subject. The source of tissue or cell samples can be solid tissue, such as fresh, frozen, and / or preserved organ or tissue samples, biopsy samples, or puncture samples; blood or any blood component; body fluids, such as cerebrospinal fluid, amniotic fluid (amniotic fluid), peritoneal fluid (ascites), or interstitial fluid; or cells from any stage of pregnancy or development in the subject. Tissue samples may contain compounds naturally occurring and not contaminated with tissues, such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, etc. Examples of tumor samples in this document include, but are not limited to, tumor biopsies, fine-needle aspirations, bronchoalveolar lavage fluid, pleural fluid (pleural effusion), sputum, urine, surgical specimens, circulating tumor cells, serum, plasma, circulating plasma proteins, ascites, primary cell cultures or cell lines derived from tumors or exhibiting tumor-like characteristics, and preserved tumor samples, such as formalin-fixed, paraffin-embedded, or frozen tumor samples.
[0134] The term "detection" as used herein includes both quantitative and qualitative detection. Exemplary detection methods include, but are not limited to, immunohistochemistry, immunocytochemistry, flow cytometry (e.g., FACS), magnetic beads with antibody molecules, ELISA assays, and PCR techniques (e.g., RT-PCR). In some embodiments, the biological sample includes body fluids, cells, or tissues. In some embodiments, the biological sample is blood, serum, or other liquid samples of biological origin.
[0135] All publications, patent applications, patents, and other references mentioned herein are incorporated herein by reference in their entirety. Any or all features discussed above and throughout this application may be combined in various embodiments of the invention. Furthermore, the materials, methods, and examples described herein are illustrative only and are not intended to be limiting. Other features, objects, and advantages of the invention will become apparent from this specification and the accompanying drawings and from the appended claims.
[0136] I. Multispecific antibodies
[0137] One aspect of the present invention relates to a multispecific antibody, such as a trispecific antibody, comprising a first antigen-binding region that specifically binds to BCMA, and a second antigen-binding region and a third antigen-binding region that specifically bind to a second and a third antigen.
[0138] One aspect of this invention relates to a trispecific antibody that specifically binds to GPRC5D, BCMA, and CD3, comprising a first antigen-binding region that specifically binds to BCMA, a second antigen-binding region that specifically binds to CD3, and a third antigen-binding region that specifically binds to GPRC5D.
[0139] In some embodiments, the first antigen-binding region originates from the anti-BCMA antibody or its antigen-binding fragment, such as the Fab fragment of the anti-BCMA antibody.
[0140] In some embodiments, the second antigen-binding region originates from the anti-CD3 antibody or its antigen-binding fragment, such as the Fab fragment of an anti-CD3 antibody.
[0141] In some embodiments, the third antigen-binding region originates from the anti-GPRC5D antibody or its antigen-binding fragment, such as the Fab fragment of the anti-GPRC5D antibody. In some embodiments, the third antigen-binding region originates from the anti-GPRC5D antibody or its antigen-binding fragment described herein.
[0142] The first antigen-binding region of the trispecific antibody applicable to the present invention may comprise, or be composed of, the full-length anti-BCMA antibody of the present invention or its antigen-binding fragment, as long as it can specifically bind to BCMA, including but not limited to, for example, a full-length antibody that specifically binds to BCMA, single-chain Fv, Fab, Fab', (Fab)2, single-domain antibody, VHH, or heavy chain antibody, etc. Preferably, the first antigen-binding region is a Fab that specifically binds to BCMA.
[0143] The second antigen-binding region of the trispecific antibody applicable to the present invention may comprise, or be composed of, a full-length anti-CD3 antibody or its antigen-binding fragment, as long as it can specifically bind to CD3, including but not limited to, for example, a full-length antibody that specifically binds to CD3, a single-chain Fv, Fab, Fab', (Fab)2, a single-domain antibody, VHH, or a heavy-chain antibody. Preferably, the second antigen-binding region is a Fab that specifically binds to CD3.
[0144] The third antigen-binding region of the trispecific antibody applicable to the present invention may comprise, or be composed of, a full-length anti-GPRC5D antibody or its antigen-binding fragment, as long as it can specifically bind to GPRC5D, including but not limited to, for example, a full-length antibody specifically binding to GPRC5D, single-chain Fv, Fab, Fab', (Fab)2, single-domain antibody, VHH, or heavy-chain antibody. Preferably, the third antigen-binding region is a Fab that specifically binds to GPRC5D.
[0145] In some embodiments, the trispecific antibody of the present invention is an IgG-like trispecific antibody. In some embodiments, the trispecific antibody of the present invention comprises an Fc dimer, for example, an Fc heterodimer.
[0146] In some embodiments, the trispecific antibody of the present invention comprises a Fab that specifically binds to BCMA as a first antigen-binding region.
[0147] In some embodiments, the three antigen-binding regions of the trispecific antibody of the present invention are all Fab fragments.
[0148] The antigen-binding region of the trispecific antibody applicable to this invention
[0149] In some embodiments, the antigen-binding region of the trispecific antibody of the present invention is a Fab fragment.
[0150] The Fab fragment suitable for the antigen-binding region of a trispecific antibody consists of two polypeptide chains containing antibody VH, CH1, VL, and CL domains, wherein VH pairs with VL and CH1 pairs with CL to form the antigen-binding region. In some embodiments, in the Fab, one chain contains VH and CH1 from the N-terminus to the C-terminus (i.e., VH-CH1), and the other chain contains VL and CL from the N-terminus to the C-terminus (i.e., VL-CL).
[0151] In some embodiments, in the trispecific antibody, the Fab can be fused to the N-terminus of the Fc domain of the antibody via the C-terminus of a chain containing VH; or via the N-terminus of a chain containing VH, wherein the Fc domain may or may not contain a hinge region. In some embodiments, the Fab comprises a VH-CH1 chain and a VL-CL chain, and is fused to the N-terminus of the Fc domain of the antibody via the C-terminus of the CH1 of the VH-CH1 chain, or via the N-terminus of the VH linked to the VH of the VH chain to the C-terminus of the Fc domain of the antibody.
[0152] In some embodiments, the fusion is a direct fusion or a fusion via a connector. In some embodiments, the connector is (GGGGS)n, where n = 1, 2, 3, or 4.
[0153] In some embodiments, the antigen-binding region, such as Fab, in the trispecific antibody of the present invention is mutated to reduce mismatches.
[0154] In some embodiments, an antigen-binding region of the trispecific antibody of the present invention, such as a Fab fragment, contains a disulfide bond remodeling mutation.
[0155] In some embodiments, an antigen-binding region, such as a Fab fragment, of the trispecific antibody of the present invention contains a charge mutation, wherein the charge mutation is to mutate the two amino acids in the amino acid pair to amino acids with opposite charges.
[0156] In some embodiments, an antigen-binding region of the trispecific antibody of the present invention, such as a Fab fragment, contains charge mutations and disulfide bond remodeling mutations.
[0157] In some embodiments, the two antigen-binding regions of the trispecific antibody of the present invention, such as two Fab fragments, include, in which one antigen-binding region contains a charge mutation and the other antigen-binding region contains both a charge mutation and a disulfide bond remodeling mutation. In some embodiments, the two antigen-binding regions contain charge mutations at corresponding positions; preferably, the charge mutations contained in the two antigen-binding regions are opposite.
[0158] Disulfide bond remodeling mutation:
[0159] In some embodiments, the disulfide remodeling mutation is such that in the CH1-CL of the antigen-binding region, the heavy chain CH1 (e.g., IgG1, IgG2, IgG3, or IgG4) has a substitution of one non-cysteine amino acid to one cysteine amino acid at position 126 (EU number), and the light chain CL has a substitution of one non-cysteine amino acid to one cysteine amino acid at position 124 (EU number). In some embodiments, the disulfide remodeling mutation is such that CH1 in the antigen-binding region contains 126C (e.g., F126C), and CL contains 124C (e.g., Q124C) (EU number). In some embodiments, the disulfide remodeling mutation further includes replacing a native cysteine with a non-cysteine. In some embodiments, CH1 in the antigen-binding region has a cysteine amino acid substituted with a non-cysteine amino acid at position 220 (EU number). In some embodiments, the light chain CL in the antigen-binding region has a substitution of one cysteine amino acid to one non-cysteine amino acid at position 214 (EU number). In some embodiments, the disulfide bond remodeling mutation comprises C220S / A / V (IgG1 subtype, or C131S / A / V at the corresponding position of IgG2, IgG3, or IgG4) in CH1 of the antigen-binding region, and C214S / A / V (EU number) in CL. In some embodiments, the Fab comprises CH1 and CL, the CH1 comprising the F126C mutation, and the CL comprising the Q124C mutation (EU number). In some embodiments, the antigen-binding region comprises CH1 and CL, the CH1 comprising the F126C and C220S mutations (or the corresponding C131S), and the CL comprising the Q124C and C214S mutations (EU number).
[0160] In some embodiments, the Fab fragment containing the disulfide bond remodeling mutation comprises CH1, wherein CH1 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:85, and comprises F126C. In some embodiments, CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:85. In some embodiments, CH1 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:86, and comprises F126C and C220S. In some embodiments, CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:86.
[0161] In some embodiments, the Fab fragment containing the disulfide bond remodeling mutation comprises a CL, wherein the CL comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:97, and comprises Q124C. In some embodiments, the CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:97. In some embodiments, the CL comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:98, and comprises Q124C and C124S. In some embodiments, the CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:98.
[0162] Charge mutation:
[0163] In some embodiments, the charge mutation is a mutation of an amino acid pair at the contact surface of the heavy and light chains in at least one antigen-binding region, wherein the two amino acids in the amino acid pair are mutated to have opposite charges. In some embodiments, the charge mutation includes mutating two amino acids to amino acids with opposite charges at the following positions: position 39 of the heavy chain variable region and position 38 of the light chain variable region (Kabat number). In some embodiments, the charge mutation includes mutating two amino acids to amino acids with opposite charges at the following positions: Q39 of the heavy chain variable region and Q38 of the light chain variable region (Kabat number).
[0164] In some embodiments, in an antigen-binding region, the amino acid at position 39 of the heavy chain variable region is replaced with K, and the amino acid at position 38 of the light chain variable region is replaced with D.
[0165] In this paper, "two antigen-binding regions containing opposite charge mutations" means that the first and second antigen-binding regions contain charge mutations at the positions of one or more identical amino acid pairs, but the charge mutations on the amino acid pairs in one antigen-binding region are different from those in the other antigen-binding region. For example, at the same position, the charge of the mutated amino acid in the first antigen-binding region is opposite to that in the second antigen-binding region. For example, in the first antigen-binding region, the heavy chain amino acid at position X1 is mutated to a positively charged amino acid, and the light chain amino acid at position X2 is mutated to a negatively charged amino acid. Simultaneously, in the second antigen-binding region, the heavy chain amino acid at position X1 is mutated to a negatively charged amino acid, and the light chain amino acid at position X2 is mutated to a positively charged amino acid. The positively charged amino acids in the first and second antigen-binding regions can be the same or different, for example, the same; and the negatively charged amino acids in the first and second antigen-binding regions can be the same or different, for example, the same.
[0166] In some embodiments, in the first antigen-binding region, the amino acid at position 39 of the heavy chain variable region is replaced with a positively charged amino acid, and the amino acid at position 38 of the light chain variable region is replaced with a negatively charged amino acid; and / or in the second antigen-binding region, the amino acid at position 39 of the heavy chain variable region is replaced with a negatively charged amino acid, and the amino acid at position 38 of the light chain variable region is replaced with a positively charged amino acid.
[0167] In one embodiment, the trispecific antibody of the present invention comprises two antigen-binding regions, wherein
[0168] In one antigen-binding region, the amino acid at position 39 of the heavy chain variable region is replaced with K, and the amino acid at position 38 of the light chain variable region is replaced with D. Meanwhile, in another antigen-binding region, the amino acid at position 39 of the heavy chain variable region is replaced with D, and the amino acid at position 38 of the light chain variable region is replaced with K.
[0169] antigen-binding region
[0170] In some embodiments, the trispecific antibody of the present invention comprises an antigen-binding region that specifically binds to BCMA, an antigen-binding region that specifically binds to CD3, and an antigen-binding region that specifically binds to GPRC5D.
[0171] Specifically binds to the antigen-binding region of BCMA
[0172] In some embodiments, the antigen-binding region that specifically binds to BCMA includes three complementarity-determining regions (HCDRs) from the heavy chain variable region: HCDR1, HCDR2, and HCDR3. In some embodiments, the antigen-binding region that specifically binds to CD3 includes three complementarity-determining regions (LCDRs) from the light chain variable region: LCDR1, LCDR2, and LCDR3. In some embodiments, the antigen-binding region that specifically binds to CD3 includes three complementarity-determining regions (HCDRs) from the heavy chain variable region and three complementarity-determining regions (LCDRs) from the light chain variable region.
[0173] In some aspects, the antigen-binding region that specifically binds to BCMA includes a heavy chain variable region (VH). In some aspects, the antigen-binding region that specifically binds to CD3 includes a light chain variable region (VL). In some aspects, the antigen-binding region that specifically binds to BCMA includes both a heavy chain variable region (VH) and a light chain variable region (VL). In some embodiments, the heavy chain variable region includes three complementarity-determining regions (CDRs) from the heavy chain variable region, HCDR1, HCDR2, and HCDR3. In some embodiments, the light chain variable region includes three complementarity-determining regions (CDRs) from the light chain variable region, LCDR1, LCDR2, and LCDR3. In some embodiments, HCDRs and LCDRs are determined using the Kabat scheme (Kabat numbering system described in Sequences of Proteins of Immunological Interest, 5th edition, Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
[0174] In some implementations, the heavy chain variable region VH specifically binds to the antigen-binding region of BCMA.
[0175] (i) comprising or consisting of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence of SEQ ID NO:56; or
[0176] (ii) Containing or consisting of the amino acid sequence of SEQ ID NO:56; or
[0177] (iii) An amino acid sequence comprising one or more (preferably no more than 10, more preferably no more than 5, 4, 3, 2, or 1) amino acid changes (preferably amino acid substitutions, more preferably conservative amino acid substitutions) compared to the amino acid sequence of SEQ ID NO:56, preferably, the amino acid changes do not occur in the CDR region.
[0178] In some implementations, the light chain variable region VL specifically binds to the antigen-binding region of BCMA.
[0179] (i) comprising or consisting of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence of SEQ ID NO: 60; or
[0180] (ii) Containing or consisting of the amino acid sequence of SEQ ID NO:60; or
[0181] (iii) An amino acid sequence comprising one or more (preferably no more than 10, more preferably no more than 5, 4, 3, 2, or 1) amino acid changes (preferably amino acid substitutions, more preferably conservative amino acid substitutions) compared to the amino acid sequence of SEQ ID NO:60, preferably, the amino acid changes do not occur in the CDR region.
[0182] In some implementations, the three complementary determinant regions (HCDRs) from the heavy chain variable region that specifically bind to the antigen-binding region of BCMA, HCDR1, HCDR2 and HCDR3 are the three complementary determinant regions HCDR1, HCDR2 and HCDR3 contained in the VH as shown in SEQ ID NO:56.
[0183] In some embodiments, the three complementary determinant regions (LCDRs) from the light chain variable region that specifically bind to the antigen-binding region of BCMA, LCDR1, LCDR2 and LCDR3 are the three complementary determinant regions LCDR1, LCDR2 and LCDR3 contained in the VL as shown in any of SEQ ID NO:60.
[0184] In some embodiments, the antigen-binding region of the present invention specifically binds to BCMA.
[0185] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:57; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:58; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:59; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:61; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:62; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:63.
[0186] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to BCMA includes VH and VL, wherein
[0187] The VH contains the amino acid sequence shown in SEQ ID NO:56 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence, and the VL contains the amino acid sequence shown in SEQ ID NO:60 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0188] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to BCMA includes the three complementary determinant regions HCDR1, HCDR2 and HCDR3 contained in VH as shown in SEQ ID NO:56, and the three complementary determinant regions LCDR1, LCDR2 and LCDR3 contained in VL as shown in SEQ ID NO:60.
[0189] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to BCMA includes: HCDR1 as shown in SEQ ID NO:57, HCDR2 as shown in SEQ ID NO:58, HCDR3 as shown in SEQ ID NO:59; LCDR1 as shown in SEQ ID NO:61, LCDR2 as shown in SEQ ID NO:62, and LCDR3 as shown in SEQ ID NO:63.
[0190] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to BCMA comprises VH and VL, wherein VH contains the amino acid sequence shown in SEQ ID NO:56, and VL contains the amino acid sequence shown in SEQ ID NO:60. In some specific embodiments of the present invention, the antigen-binding region that specifically binds to BCMA comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:56, and VL consists of the amino acid sequence shown in SEQ ID NO:60.
[0191] In one embodiment, the antigen-binding region that specifically binds to BCMA is an antigen-binding fragment of an anti-BCMA antibody, selected from antibody fragments such as Fab, Fab', Fab'-SH, Fv, single-chain antibodies (e.g., scFv), (Fab')2, single-domain antibodies such as VHH, dAb (domain antibody), or linear antibodies. Preferably, the antigen-binding region that specifically binds to BCMA is Fab.
[0192] In some embodiments, the first antigen-binding region included in the trispecific antibody of the present invention is a Fab fragment that specifically binds to BCMA. In some embodiments, the Fab fragment that specifically binds to BCMA included in the trispecific antibody of the present invention is derived from an anti-BCMA antibody.
[0193] In some embodiments, the Fab fragment of the trispecific antibody suitable for use in this invention that specifically binds to BCMA contains a disulfide remodeling mutation, for example, it contains F126C in CH1, or contains F126C and C220S, and it contains Q124C in CL, or contains Q124C and C214S.
[0194] In some embodiments, the Fab fragment of the trispecific antibody suitable for use in this invention that specifically binds to BCMA contains a charge mutation, for example, it contains Q39K in the heavy chain variable region and Q38D in the light chain variable region; or it contains Q38K in the light chain variable region and Q39D in the heavy chain variable region.
[0195] The Fab fragment of the trispecific antibody applicable to this invention that specifically binds to BCMA contains disulfide bond remodeling mutations and charge mutations, for example, it contains Q39K in the heavy chain variable region and F126C in CH1, or contains F126C and C220S; and it contains Q38D in the light chain variable region and Q124C in CL, or contains Q124C and C214S.
[0196] The Fab fragment of the trispecific antibody applicable to this invention that specifically binds to BCMA contains disulfide bond remodeling mutations and charge mutations, for example, it contains Q39D in the heavy chain variable region and F126C in CH1, or contains F126C and C220S; and it contains Q38K in the light chain variable region and Q124C in CL, or contains Q124C and C214S.
[0197] In some embodiments, the Fab of the trispecific antibody of the present invention that specifically binds to BCMA comprises a Fab heavy chain and a Fab light chain, wherein the Fab heavy chain includes a heavy chain variable region and the Fab light chain includes a light chain variable region.
[0198] The heavy chain variable region of the Fab heavy chain
[0199] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:76, or
[0200] (ii) Containing an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:76, and containing a Q39K mutation; and / or
[0201] The light chain variable region of the Fab light chain
[0202] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:75, or
[0203] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:75, and contains a Q38D mutation.
[0204] Specifically binds to the antigen-binding region of GPRC5D
[0205] In some embodiments, the antigen-binding region that specifically binds to GPRC5D includes three complementarity-determining regions (HCDRs) from the heavy chain variable region: HCDR1, HCDR2, and HCDR3. In some embodiments, the antigen-binding region that specifically binds to CD3 includes three complementarity-determining regions (LCDRs) from the light chain variable region: LCDR1, LCDR2, and LCDR3. In some embodiments, the antigen-binding region that specifically binds to CD3 includes three HCDRs from the heavy chain variable region and three LCDRs from the light chain variable region.
[0206] In some aspects, the antigen-binding region that specifically binds to GPRC5D includes a heavy chain variable region (VH). In some aspects, the antigen-binding region that specifically binds to GPRC5D includes a light chain variable region (VH). In some aspects, the antigen-binding region that specifically binds to GPRC5D includes both a heavy chain variable region (VH) and a light chain variable region (VL). In some embodiments, the heavy chain variable region includes three complementarity-determining regions (CDRs) from the heavy chain variable region, HCDR1, HCDR2, and HCDR3. In some embodiments, the light chain variable region includes three complementarity-determining regions (CDRs) from the light chain variable region, LCDR1, LCDR2, and LCDR3. In some embodiments, HCDRs and LCDRs are determined using the Kabat scheme (Kabat numbering system described in Sequences of Proteins of Immunological Interest, 5th edition, Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
[0207] In some embodiments, the antigen-binding region is derived from an antibody that specifically binds to GPRC5D, such as the antibody that specifically binds to GPRC5D disclosed in PCT / CN2022 / 076832. In some embodiments, the antigen-binding region comprises 1, 2, 3, 4, 5, or 6 CDRs of a known antibody that specifically binds to GPRC5D. In some embodiments, the antigen-binding region comprises 1, 2, and 3 heavy chain variable region CDRs of a known antibody that specifically binds to GPRC5D, namely HCDR1, HCDR2, and HCDR3. In some embodiments, the antigen-binding region comprises 1, 2, and 3 light chain variable region CDRs of a known antibody that specifically binds to GPRC5D, namely LCDR1, LCDR2, and LCDR3. In some embodiments, the antigen-binding region comprises 3 heavy chain variable region CDRs and 3 light chain variable region CDRs of a known antibody that specifically binds to GPRC5D. In some embodiments, the antigen-binding region comprises both heavy chain variable regions and light chain variable regions of a known antibody that specifically binds to GPRC5D.
[0208] In some implementations, the heavy chain variable region VH of the antigen-binding region specifically binds to GPRC5D.
[0209] (i) comprising or consisting of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence of SEQ ID NO: 40 or 48; or
[0210] (ii) Containing or consisting of an amino acid sequence of SEQ ID NO:40 or 48; or
[0211] (iii) An amino acid sequence comprising one or more (preferably no more than 10, more preferably no more than 5, 4, 3, 2, or 1) amino acid changes (preferably amino acid substitutions, more preferably conservative amino acid substitutions) compared to the amino acid sequence of SEQ ID NO:40 or 48, preferably, the amino acid changes do not occur in the CDR region.
[0212] In some implementations, the light chain variable region VL of the antigen-binding region specifically binds to GPRC5D.
[0213] (i) comprising or consisting of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence of SEQ ID NO: 44 or 52; or
[0214] (ii) Containing or consisting of an amino acid sequence of SEQ ID NO:44 or 52; or
[0215] (iii) An amino acid sequence comprising one or more (preferably no more than 10, more preferably no more than 5, 4, 3, 2, or 1) amino acid changes (preferably amino acid substitutions, more preferably conservative amino acid substitutions) compared to the amino acid sequence of SEQ ID NO:44 or 52, preferably, the amino acid changes do not occur in the CDR region.
[0216] In some embodiments, the three complementary determinant regions (HCDRs) from the heavy chain variable region that specifically bind to the antigen-binding region of GPRC5D, HCDR1, HCDR2 and HCDR3 are the three complementary determinant regions HCDR1, HCDR2 and HCDR3 contained in the VH as shown in any of SEQ ID NO:40 or 48.
[0217] In some embodiments, the three complementary determinant regions (LCDRs) from the light chain variable region that specifically bind to the antigen-binding region of GPRC5D, LCDR1, LCDR2 and LCDR3 are the three complementary determinant regions LCDR1, LCDR2 and LCDR3 contained in the VL as shown in any of SEQ ID NO:44 or 52.
[0218] In some embodiments, the present invention specifically binds to the antigen-binding region of GPRC5D.
[0219] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:41; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:42; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:43; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:45; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:46; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:47; or
[0220] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:49; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:50; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:51; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:53; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:54; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:55.
[0221] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to GPRC5D comprises VH and VL, wherein
[0222] The VH contains the amino acid sequence shown in SEQ ID NO:40 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence; and the VL contains the amino acid sequence shown in SEQ ID NO:44 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence; or
[0223] The VH contains the amino acid sequence shown in SEQ ID NO:48 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence, and the VL contains the amino acid sequence shown in SEQ ID NO:52 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0224] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to GPRC5D includes the three complementary determinant regions HCDR1, HCDR2, and HCDR3 contained in VH as shown in SEQ ID NO:40, and the three complementary determinant regions LCDR1, LCDR2, and LCDR3 contained in VL as shown in SEQ ID NO:44. In some specific embodiments of the present invention, the antigen-binding region that specifically binds to GPRC5D includes the three complementary determinant regions HCDR1, HCDR2, and HCDR3 contained in VH as shown in SEQ ID NO:48, and the three complementary determinant regions LCDR1, LCDR2, and LCDR3 contained in VL as shown in SEQ ID NO:52.
[0225] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to GPRC5D includes: HCDR1 as shown in SEQ ID NO:41, HCDR2 as shown in SEQ ID NO:42, and HCDR3 as shown in SEQ ID NO:43; LCDR1 as shown in SEQ ID NO:45, LCDR2 as shown in SEQ ID NO:46, and LCDR3 as shown in SEQ ID NO:47. In some specific embodiments of the present invention, the antigen-binding region that specifically binds to GPRC5D includes: HCDR1 as shown in SEQ ID NO:49, HCDR2 as shown in SEQ ID NO:50, and HCDR3 as shown in SEQ ID NO:51; LCDR1 as shown in SEQ ID NO:53, LCDR2 as shown in SEQ ID NO:54, and LCDR3 as shown in SEQ ID NO:55.
[0226] In some specific embodiments of the present invention, the antigen-binding region specifically binding to GPRC5D comprises VH and VL, wherein VH contains the amino acid sequence shown in SEQ ID NO:40, and VL contains the amino acid sequence shown in SEQ ID NO:44. In some specific embodiments of the present invention, the antigen-binding region specifically binding to GPRC5D comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:40, and VL consists of the amino acid sequence shown in SEQ ID NO:44.
[0227] In some specific embodiments of the present invention, the antigen-binding region specifically binding to GPRC5D comprises VH and VL, wherein VH contains the amino acid sequence shown in SEQ ID NO:48, and VL contains the amino acid sequence shown in SEQ ID NO:52. In some specific embodiments of the present invention, the antigen-binding region specifically binding to GPRC5D comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:48, and VL consists of the amino acid sequence shown in SEQ ID NO:52.
[0228] In one embodiment, the antigen-binding region that specifically binds to GPRC5D is an antigen-binding fragment of an anti-GPRC5D antibody, selected from antibody fragments such as Fab, Fab', Fab'-SH, Fv, single-chain antibodies (e.g., scFv), (Fab')2, single-domain antibodies such as VHH, dAb (domain antibody), or linear antibodies. Preferably, the antigen-binding region that specifically binds to GPRC5D is Fab.
[0229] In some embodiments, the third antigen-binding region included in the trispecific antibody of the present invention is a Fab fragment that specifically binds to GPRC5D. In some embodiments, the Fab fragment that specifically binds to GPRC5D included in the trispecific antibody of the present invention is derived from an anti-GPRC5D antibody.
[0230] In some embodiments, the Fab fragment of the trispecific antibody suitable for use in this invention that specifically binds to GPRC5D contains a disulfide remodeling mutation, for example, it contains F126C in CH1, or contains F126C and C220S, and it contains Q124C in CL, or contains Q124C and C214S.
[0231] In some embodiments, the Fab fragment of the trispecific antibody suitable for use in this invention that specifically binds to GPRC5D contains a charge mutation, for example, it contains Q39K in the heavy chain variable region and Q38D in the light chain variable region; or it contains Q38K in the light chain variable region and Q39D in the heavy chain variable region.
[0232] The Fab fragment of the trispecific antibody applicable to this invention that specifically binds to GPRC5D contains disulfide remodeling mutations and charge mutations, for example, it contains Q39K in the heavy chain variable region and F126C in CH1, or contains F126C and C220S; and it contains Q38D in the light chain variable region and Q124C in CL, or contains Q124C and C214S.
[0233] The Fab fragment of the trispecific antibody applicable to this invention that specifically binds to GPRC5D contains disulfide bond remodeling mutations and charge mutations, for example, it contains Q39D in the heavy chain variable region and F126C in CH1, or contains F126C and C220S; and it contains Q38K in the light chain variable region and Q124C in CL, or contains Q124C and C214S.
[0234] In some embodiments, the Fab of the trispecific antibody of the present invention that specifically binds to GPRC5D comprises a Fab heavy chain and a Fab light chain, wherein the Fab heavy chain includes a heavy chain variable region and the Fab light chain includes a light chain variable region.
[0235] The heavy chain variable region of the Fab heavy chain
[0236] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:80, or
[0237] (ii) Containing an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:80, and containing a Q39K mutation; and / or
[0238] The light chain variable region of the Fab light chain
[0239] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:79, or
[0240] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:79, and contains a Q38D mutation.
[0241] Specifically binds to the antigen-binding region of CD3
[0242] In some embodiments, the CD3-specific antigen-binding region comprises three complementarity-determining regions (HCDRs) from the heavy chain variable region: HCDR1, HCDR2, and HCDR3. In some embodiments, the CD3-specific antigen-binding region comprises three complementarity-determining regions (LCDRs) from the light chain variable region: LCDR1, LCDR2, and LCDR3. In some embodiments, the CD3-specific antigen-binding region comprises three HCDRs from the heavy chain variable region and three LCDRs from the light chain variable region.
[0243] In some aspects, the antigen-binding region that specifically binds to CD3 includes a heavy chain variable region (VH). In some aspects, the antigen-binding region that specifically binds to CD3 includes a light chain variable region (VH). In some aspects, the antigen-binding region that specifically binds to CD3 includes both a heavy chain variable region (VH) and a light chain variable region (VL). In some embodiments, the heavy chain variable region includes three complementarity-determining regions (CDRs) from the heavy chain variable region, HCDR1, HCDR2, and HCDR3. In some embodiments, the light chain variable region includes three complementarity-determining regions (CDRs) from the light chain variable region, LCDR1, LCDR2, and LCDR3. In some embodiments, HCDRs and LCDRs are determined using the Kabat scheme (Kabat numbering system described in Sequences of Proteins of Immunological Interest, 5th edition, Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
[0244] In some implementations, the antigen-binding region is derived from an antibody that specifically binds to CD3, such as the CD3 antibody disclosed in WO2022068809, for example, sp34.24 or sp34.87.
[0245] In some implementations, the antigen-binding region contains known antibodies that specifically bind to CD3, such as the CD3 antibodies disclosed in WO2022068809, such as CDRs 1, 2, 3, 4, 5, or 6 of sp34.24 or sp34.87.
[0246] In some embodiments, the antigen-binding region contains known antibodies that specifically bind to CD3, such as the CD3 antibodies disclosed in WO2022068809, such as the 1st, 2nd and 3rd heavy chain variable regions CDR of sp34.24 or sp34.87, namely HCDR1, HCDR2 and HCDR3.
[0247] In some embodiments, the antigen-binding region contains known antibodies that specifically bind to CD3, such as the CD3 antibodies disclosed in WO2022068809, such as the 1st, 2nd, and 3rd light chain variable regions (CDRs) of sp34.24 or sp34.87, namely LCDR1, LCDR2, and LCDR3.
[0248] In some embodiments, the antigen-binding region contains known antibodies that specifically bind to CD3, such as the CD3 antibodies disclosed in WO2022068809, such as the three heavy chain variable regions CDR and three light chain variable regions CDR of sp34.24 or sp34.87 therein.
[0249] In some embodiments, the antigen-binding region comprises a known antibody that specifically binds to CD3, such as the CD3 antibody disclosed in WO2022068809, such as the heavy chain variable region and light chain variable region of sp34.24 or sp34.87 therein, as well as the mutations described in this invention.
[0250] In some implementations, the heavy chain variable region VH specifically binds to the antigen-binding region of CD3.
[0251] (i) comprising or consisting of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence of SEQ ID NO: 64 or 72; or
[0252] (ii) Containing or consisting of an amino acid sequence of SEQ ID NO: 64 or 72; or
[0253] (iii) An amino acid sequence comprising one or more (preferably no more than 10, more preferably no more than 5, 4, 3, 2, or 1) amino acid changes (preferably amino acid substitutions, more preferably conservative amino acid substitutions) compared to the amino acid sequence of SEQ ID NO: 64 or 72, preferably, the amino acid changes do not occur in the CDR region.
[0254] In some implementations, the light chain variable region VL specifically binds to the antigen-binding region of CD3.
[0255] (i) comprising or consisting of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence of SEQ ID NO: 68; or
[0256] (ii) Containing or consisting of the amino acid sequence of SEQ ID NO:68; or
[0257] (iii) An amino acid sequence comprising one or more (preferably no more than 10, more preferably no more than 5, 4, 3, 2, or 1) amino acid changes (preferably amino acid substitutions, more preferably conservative amino acid substitutions) compared to the amino acid sequence of SEQ ID NO:68, preferably, the amino acid changes do not occur in the CDR region.
[0258] In some embodiments, the three complementary determinant regions (HCDRs) from the heavy chain variable region that specifically bind to the antigen-binding region of CD3, HCDR1, HCDR2 and HCDR3 are the three complementary determinant regions HCDR1, HCDR2 and HCDR3 contained in the VH as shown in any of SEQ ID NO:64 or 72.
[0259] In some embodiments, the three complementary determinant regions (LCDRs) from the light chain variable region that specifically bind to the antigen-binding region of CD3, LCDR1, LCDR2 and LCDR3 are the three complementary determinant regions LCDR1, LCDR2 and LCDR3 contained in the VL as shown in any of SEQ ID NO:68.
[0260] In some embodiments, the antigen-binding region of the present invention specifically binds to CD3,
[0261] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:65; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:66; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:67 or 73; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:69; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:70; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:71.
[0262] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to CD3 includes VH and VL, wherein
[0263] The VH contains the amino acid sequence shown in SEQ ID NO:64 or 72, or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence; and the VL contains the amino acid sequence shown in SEQ ID NO:68, or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0264] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to CD3 includes the three complementary determinant regions HCDR1, HCDR2 and HCDR3 contained in VH as shown in SEQ ID NO:64 or 72, and the three complementary determinant regions LCDR1, LCDR2 and LCDR3 contained in VL as shown in SEQ ID NO:68.
[0265] In some specific embodiments of the present invention, the antigen-binding region that specifically binds to CD3 includes: HCDR1 as shown in SEQ ID NO:65, HCDR2 as shown in SEQ ID NO:66, HCDR3 as shown in SEQ ID NO:67 or 73; LCDR1 as shown in SEQ ID NO:69, LCDR2 as shown in SEQ ID NO:70, and LCDR3 as shown in SEQ ID NO:71.
[0266] In some specific embodiments of the present invention, the antigen-binding region specifically binding to CD3 comprises VH and VL, wherein the VH contains the amino acid sequence shown in SEQ ID NO:64 or 72, and the VL contains the amino acid sequence shown in SEQ ID NO:68. In some specific embodiments of the present invention, the antigen-binding region specifically binding to CD3 comprises VH and VL, wherein the VH consists of the amino acid sequence shown in SEQ ID NO:64 or 72, and the VL consists of the amino acid sequence shown in SEQ ID NO:68.
[0267] In one embodiment, the antigen-binding region that specifically binds to CD3 is an antigen-binding fragment of an anti-CD3 antibody, selected from antibody fragments such as Fab, Fab', Fab'-SH, Fv, single-chain antibodies (e.g., scFv), (Fab')2, single-domain antibodies such as VHH, dAb (domain antibody), or linear antibodies. Preferably, the antigen-binding region that specifically binds to CD3 is Fab.
[0268] In some embodiments, the second antigen-binding region included in the trispecific antibody of the present invention is a Fab fragment that specifically binds to CD3. In some embodiments, the Fab fragment that specifically binds to CD3 included in the trispecific antibody of the present invention is derived from an anti-CD3 antibody.
[0269] In some embodiments, the Fab fragment of the trispecific antibody suitable for use in this invention that specifically binds to CD3 contains a disulfide remodeling mutation, for example, it contains F126C in CH1, or contains F126C and C220S, and it contains Q124C in CL, or contains Q124C and C214S.
[0270] In some embodiments, the Fab fragment of the trispecific antibody suitable for use in this invention that specifically binds to CD3 contains a charge mutation, for example, it contains Q39K in the heavy chain variable region and Q38D in the light chain variable region; or it contains Q38K in the light chain variable region and Q39D in the heavy chain variable region.
[0271] The Fab fragment of the trispecific antibody applicable to the present invention that specifically binds to CD3 contains disulfide bond remodeling mutations and charge mutations, for example, it contains Q39K in the heavy chain variable region and F126C in CH1, or contains F126C and C220S; and it contains Q38D in the light chain variable region and Q124C in CL, or contains Q124C and C214S.
[0272] The Fab fragment of the trispecific antibody applicable to this invention that specifically binds to CD3 contains disulfide bond remodeling mutations and charge mutations, for example, it contains Q39D in the heavy chain variable region and F126C in CH1, or contains F126C and C220S; and it contains Q38K in the light chain variable region and Q124C in CL, or contains Q124C and C214S.
[0273] In some embodiments, the Fab of the trispecific antibody of the present invention that specifically binds to CD3 comprises a Fab heavy chain and a Fab light chain, wherein the Fab heavy chain includes a heavy chain variable region and the Fab light chain includes a light chain variable region.
[0274] The heavy chain variable region of the Fab heavy chain
[0275] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:77 or 78, or
[0276] (ii) Containing an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO: 77 or 78, and containing a Q39D mutation; and / or
[0277] The light chain variable region of the Fab light chain
[0278] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:74, or
[0279] (ii) Contains amino acids having a content of at least 90%, 91%, 92%, 93%, or 94% of the amino acid sequence shown in SEQ ID NO:74.
[0280] Amino acid sequences with 95%, 96%, 97%, 98%, or 99% identity, and containing the Q38K mutation.
[0281] Fc dimers suitable for the trispecific antibodies of this invention
[0282] In one embodiment, the two Fc regions of the trispecific antibody of the present invention dimerize to form dimer Fc. Preferably, the two Fc regions heterodimerize to form heterodimer Fc.
[0283] In some implementations, the first Fc region and the second Fc region are different, and they are capable of dimerizing to form a heterodimeric Fc scaffold.
[0284] In some embodiments, the Fc region encompasses both the native sequence Fc region and the variant Fc region. The native sequence Fc region encompasses the Fc sequences of various naturally occurring immunoglobulins, such as the Fc regions of various Ig subtypes and their allotypes (Gestur Vidarsson et al., IgG subclasses and allotypes: from structure to effector functions, 20 October 2014, doi:10.3389 / fimmu.2014.00520). In some embodiments, the Fc region is a human IgG Fc, such as human IgG1 Fc, human IgG2 Fc, human IgG3 Fc, or human IgG4 Fc. In one embodiment, the Fc region comprises or is composed of the amino acid sequence SEQ ID NO:87 or 88 or an amino acid sequence having at least 90% identity with it, such as 95%, 96%, 97%, 99%, or higher.
[0285] In some embodiments, the Fc region of the present invention comprises antibodies CH2 and CH3. In some embodiments, the antibody Fc region may also have an IgG hinge region or a partial IgG hinge region at its N-terminus, for example, an IgG1 hinge region or a partial IgG1 hinge region. Mutations may be contained in said hinge region.
[0286] As those skilled in the art will understand, in order to promote the formation of heterodimers in the multispecific antibodies of the present invention, the Fc regions comprising the multispecific antibodies of the present invention may contain mutations that facilitate heterodimerization of the first Fc region and the second Fc region. In one embodiment, mutations are introduced in the CH3 regions of both Fc regions.
[0287] Methods for promoting heterodimerization of Fc regions are known in the art. For example, the CH3 regions of the first and second Fc regions are engineered in a complementary manner such that each CH3 region (or the heavy chain containing it) can no longer homodimerize with itself but is forced to heterodimerize with other complementary engineered CH3 regions (so that the CH3 regions of the first and second Fc regions heterodimerize and no homodimer is formed between the two first CH3 regions or the two second CH3 regions). Preferably, based on Knob-in-Hole technology, corresponding Knob mutations and Hole mutations are introduced into the first and second Fc regions.
[0288] In one particular embodiment, in the CH3 region of one Fc region, the threonine residue at position 366 is replaced with a tryptophan residue (T366W) (knob mutation); while in the CH3 region of another Fc region, the tyrosine residue at position 407 is replaced with a valine residue (Y407V) (hole mutation), optionally the threonine residue at position 366 is replaced with a serine residue (T366S), and / or the leucine residue at position 368 is replaced with an alanine residue (L368A) (numbering in accordance with EU index).
[0289] In yet another embodiment, in the CH3 region of one Fc region, the threonine residue at position 366 is replaced with a tryptophan residue (T366W) and the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamate residue at position 356 is replaced with a cysteine residue (E356C) (in particular, the serine residue at position 354 is replaced with a cysteine residue); while in the CH3 region of another Fc region, the tyrosine residue at position 407 is replaced with a valine residue (Y407V) (hole mutation), optionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numbered according to EU index), optionally the tyrosine residue at position 349 is replaced with a cysteine residue (Y349C) (numbered according to EU index).
[0290] In one specific implementation, one Fc region contains amino acid substitution T366W, and another Fc region contains amino acid substitutions T366S, L368A, and Y407V (numbered according to EU index).
[0291] In one specific implementation, one Fc region contains amino acid substitutions S354C and T366W, and another Fc region contains amino acid substitutions Y349C, T366S, L368A, and Y407V (numbered according to the EU index).
[0292] Therefore, in one specific embodiment, the trispecific antibody of the present invention comprises two Fc regions heterodimerized, wherein one Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:92.
[0293] Therefore, in one specific embodiment, the trispecific antibody of the present invention comprises two heterodimerized Fc regions, wherein one Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:92.
[0294] Therefore, in one specific embodiment, the trispecific antibody of the present invention comprises two heterodimerized Fc regions, wherein one Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:92 and comprises the mutation T366W, and the other Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:91 and comprises the mutations T366S, L368A, and Y407V.
[0295] In some implementations, the Fc region also contains other mutations that facilitate heterodimer purification.
[0296] The Fc region of the binding molecule of the present invention, such as an antibody, can also be mutated to obtain the desired properties. Mutations of the Fc region are known in the art.
[0297] In one embodiment, the Fc region is modified to enhance its effector function (e.g., complement activation function). In another embodiment, the effector function has been reduced or eliminated relative to the wild-type isotype Fc region. In one embodiment, the effector function is reduced or eliminated by a method selected from: using a naturally occurring Fc isotype with reduced or eliminated effector function; or by modifying the Fc region.
[0298] In a preferred embodiment, the Fc region has reduced effector functions mediated by the Fc region, such as reduced or eliminated ADCC, ADCP, or CDC effector functions, for example, containing mutations that achieve the above functions.
[0299] As those skilled in the art will understand, in accordance with the intended use of the binding molecules, such as antibody molecules, according to the present invention, the binding molecules, such as antibody molecules, may also include modifications in the Fc domain that alter the binding affinity for one or more Fc receptors. In one embodiment, the Fc receptor is an Fcγ receptor, particularly a human Fcγ receptor. In some embodiments, the Fc region contains mutations that reduce binding to the Fcγ receptor. For example, in some embodiments, the Fc region used in the present invention has an L234A / L235A mutation that reduces binding to the Fcγ receptor. In yet another preferred embodiment, the Fc fragment may have mutations that result in an increased serum half-life, such as mutations that improve the binding of the Fc fragment to FcRn.
[0300] In some embodiments, the Fc region containing the mutation that reduces binding to the Fcγ receptor comprises or consists of the amino acid sequence shown in SEQ ID NO:89 or 90 or an amino acid sequence having at least 90% identity with it, such as 95%, 96%, 97%, 99% or higher.
[0301] In some embodiments, the Fc region contains an amino acid sequence that has at least 90% identity with the amino acid sequence shown in SEQ ID NO:89 or 90, for example, 95%, 96%, 97%, 99% or higher identity and contains the L234A / L235A mutation.
[0302] In a preferred embodiment, the heterodimeric Fc of the trispecific antibody suitable for this invention comprises two Fc regions, wherein
[0303] One Fc region contains or consists of the amino acid sequence shown in SEQ ID NO:93, and the other Fc region contains SEQ ID NO:93.
[0304] The amino acid sequence shown in ID NO:94 or composed of it; or
[0305] One Fc region polypeptide contains an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:94 and contains the mutations L234A / L235A and T366W, while another Fc region polypeptide contains an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:93 and contains the mutations L234A / L235A, T366S, L368A, and Y407V.
[0306] The trispecific antibody structure and exemplary trispecific antibody of the present invention
[0307] In some embodiments, the present invention provides a trispecific antibody comprising a first Fab that specifically binds to BCMA, a Fab that specifically binds to CD3, a Fab that specifically binds to GPRC5D, and an Fc heterodimer.
[0308] In some embodiments, the present invention provides a trispecific antibody comprising a first Fab that specifically binds to BCMA, a Fab that specifically binds to CD3, a Fab that specifically binds to GPRC5D, and an Fc heterodimer.
[0309] In some preferred embodiments, the trispecific antibody of the present invention comprises a first Fab that specifically binds to a first antigen, a second Fab that specifically binds to a second antigen, and a third Fab that specifically binds to a third antigen, and an Fc heterodimer, wherein the first antigen is selected from one of BCMA, CD3, and GPRC5D, the second antigen is selected from one of BCMA, CD3, and GPRC5D, and the third antigen is selected from one of BCMA, CD3, and GPRC5D, and the first, second, and third antigens are different.
[0310] (1) The first Fab that specifically binds to the first antigen fuses at the C-terminus of CH1 of the Fab heavy chain to CH2 or hinge region of one of the Fc regions of the Fc heterodimer (the first Fc region, such as the Fc region containing the Knob mutation or the Fc region containing the hole mutation).
[0311] The second Fab, which specifically binds to the second antigen, fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region (the second Fc region, such as an Fc region containing a hole mutation or an Fc region containing a knob) of the Fc heterodimer, and the third Fab, which specifically binds to the third antigen, fuses at the C-terminus of CH1 of the Fab heavy chain to the N-terminus of the VH of the second Fab heavy chain; or
[0312] The third Fab that specifically binds to the third antigen fuses at the C-terminus of CH1 of the Fab heavy chain to CH2 or the hinge region of one of the Fc regions of the Fc heterodimer (the first Fc region, such as the Fc region containing the Knob mutation or the Fc region containing the hole mutation).
[0313] The second Fab that specifically binds to the second antigen fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region (the second Fc region, such as the Fc region containing a hole mutation or the Fc region containing a knob) of the Fc heterodimer, and the first Fab that specifically binds to the first antigen fuses at the C-terminus of CH1 of the Fab heavy chain to the N-terminus of the VH of the second Fab heavy chain.
[0314] For example, the structure shown in Figure 1A;
[0315] (2) The first Fab that specifically binds to the first antigen fuses at the C-terminus of CH1 of the Fab heavy chain to CH2 or hinge region of one of the Fc regions of the Fc heterodimer (the first Fc region, such as the Fc region containing the Knob mutation or the Fc region containing the hole).
[0316] The second Fab, which specifically binds to the second antigen, fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region (the second Fc region, such as the Fc region containing a hole mutation or the Fc region containing a knob) of the Fc heterodimer, and the third Fab, which specifically binds to the third antigen, fuses at the N-terminus of the VH of the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab; or
[0317] The third Fab that specifically binds to the third antigen fuses at the C-terminus of CH1 of the Fab heavy chain to CH2 or the hinge region of one of the Fc regions of the Fc heterodimer (the first Fc region, such as the Fc region containing the Knob mutation or the Fc region containing the hole).
[0318] The second Fab that specifically binds to the second antigen fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region (the second Fc region, such as the Fc region containing a hole mutation or the Fc region containing a knob) of the Fc heterodimer, and the first Fab that specifically binds to the first antigen fuses at the N-terminus of VH of the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab.
[0319] For example, the structure shown in Figure 1B.
[0320] In some embodiments, the second antigen is CD3. In some embodiments, the first antigen and the third antigen are GPRC5D or BCMA, respectively, or the third antigen and the first antigen are GPRC5D or BCMA, respectively.
[0321] In some implementations, the first antigen is BCMA, the second antigen is CD3, and the third antigen is GPRC5D; or the first antigen is GPRC5D, the second antigen is CD3, or the third antigen is BCMA.
[0322] In some implementations, fusion includes direct fusion or fusion via a connector. In some implementations, the connector is (GGGGS)n, where n = 1, 2, 3, or 4.
[0323] In some embodiments, the first Fc region contains a knob mutation, and the second Fc region contains a hole mutation. In some embodiments, the first Fc region contains a hole mutation, and the second Fc region contains a knob mutation. In some embodiments, one or both of the first and second Fc regions contain L234A and L235A mutations. In some embodiments, the first Fc region contains a knob mutation and L234A and L235A mutations, and the second Fc region contains a hole mutation and L234A and L235A mutations. In some embodiments, the first Fc region contains a hole mutation and L234A and L235A mutations, and the second Fc region contains a knob mutation and L234A and L235A mutations.
[0324] In some embodiments, the second Fab contains a charge mutation. In some embodiments, one or both of the first or third Fab contain a charge mutation and a disulfide bond remodeling mutation.
[0325] In some embodiments, the second Fab contains a charge mutation, and one of the first or third Fabs contains both a charge mutation and a disulfide bond remodeling mutation. In some embodiments, the two Fabs containing charge mutations each contain opposite charge mutations.
[0326] In some embodiments, the second Fab contains a charge mutation, specifically a Q38K mutation in the Fab light chain and a Q39D mutation in the Fab heavy chain. In some embodiments, the first or third Fab contains a charge mutation and a disulfide remodeling mutation, specifically Q39K and F126C mutations in the Fab heavy chain and Q38D and Q124C mutations in the Fab light chain. In some embodiments, the first or third Fab contains a charge mutation and a disulfide remodeling mutation, specifically Q39K, F126C, and C220S mutations in the Fab heavy chain and Q38D, Q124C, and C214S mutations in the Fab light chain.
[0327] In some embodiments, the second Fab contains a charge mutation, specifically a Q38D mutation in the Fab light chain and a Q39K mutation in the Fab heavy chain. In some embodiments, the first or third Fab contains a charge mutation and a disulfide remodeling mutation, specifically Q39D and F126C mutations in the Fab heavy chain and Q38K and Q124C mutations in the Fab light chain. In some embodiments, the first or third Fab contains a charge mutation and a disulfide remodeling mutation, specifically Q39D, F126C, and C220S mutations in the Fab heavy chain and Q38K, Q124C, and C214S mutations in the Fab light chain.
[0328] In some implementations, the first or third Fab, which includes charge mutations and disulfide bond remodeling mutations, is fused with the second Fab, or fused with the second Fab via the Fc region.
[0329] In some specific embodiments, the tri-characteristic antibody of the present invention is a left-right asymmetric IgG-like pentamer composed of five polypeptide chains, which is composed of the following polypeptide chains:
[0330] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0331] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0332] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to BCMA, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0333] A peptide chain #4 containing a Fab light chain that specifically binds to BCMA, and
[0334] A peptide chain #5 consisting of a Fab light chain that specifically binds to CD3.
[0335] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the first and second Fabs, as shown in Figure 1A.
[0336] In some specific embodiments, peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence;
[0337] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence;
[0338] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence;
[0339] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or
[0340] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0341] In some specific embodiments, peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:15, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:15, or is composed of said amino acid sequence;
[0342] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:14, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:14, or is composed of said amino acid sequence;
[0343] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence;
[0344] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or
[0345] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0346] In some specific embodiments, the tri-characteristic antibody of the present invention is a left-right asymmetric IgG-like pentamer composed of five polypeptide chains, which is composed of the following polypeptide chains:
[0347] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to BCMA and an Fc domain.
[0348] A peptide chain #2 containing a Fab light chain that specifically binds to BCMA.
[0349] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to GPRC5D, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0350] A peptide chain #4 containing a Fab light chain that specifically binds to GPRC5D, and
[0351] A peptide chain #5 containing a Fab light chain that specifically binds to CD3.
[0352] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the first Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the third and second Fabs, as shown in Figure 1A.
[0353] In some specific embodiments, peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:11, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:11, or is composed of said amino acid sequence;
[0354] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:10, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:10, or is composed of said amino acid sequence;
[0355] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:9, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:9, or is composed of said amino acid sequence;
[0356] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:8, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:8, or is composed of said amino acid sequence; and
[0357] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0358] In some specific embodiments, the tri-characteristic antibody of the present invention is a left-right asymmetric IgG-like pentamer composed of five polypeptide chains, which is composed of the following polypeptide chains:
[0359] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0360] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0361] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to CD3, an Fc domain, and an antigen-binding region of a Fab heavy chain that specifically binds to BCMA.
[0362] A peptide chain 4# containing a Fab light chain that specifically binds to CD3, and
[0363] A peptide chain #5 containing a Fab light chain that specifically binds to an antigen-binding region of BCMA.
[0364] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the second and first Fabs, as shown in Figure 1B.
[0365] In some specific embodiments, peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence;
[0366] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence;
[0367] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:7, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:7, or is composed of said amino acid sequence;
[0368] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence; and / or
[0369] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence.
[0370] II. Production and purification of multispecific antibodies
[0371] In one embodiment, the present invention provides a method for preparing an antibody molecule or a fragment thereof or a chain thereof, wherein the method comprises culturing a host cell under conditions suitable for expressing a nucleic acid encoding an antibody molecule or a fragment thereof or a chain thereof, and optionally isolating the antibody or a fragment thereof or a chain thereof. In one embodiment, the method further comprises recovering the antibody molecule or a fragment thereof or a chain thereof from the host cell.
[0372] Polynucleotides encoding the polypeptide chain of the present invention can be inserted into one or more vectors for further cloning and / or expression in host cells. Expression vectors can be constructed using methods well known to those skilled in the art. Once an expression vector containing one or more nucleic acid molecules of the present invention has been prepared for expression, the expression vector can be transfected or introduced into suitable host cells. Various techniques can be used to achieve this, such as protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, liposome-based transfection, or other conventional techniques.
[0373] The antibody molecules prepared as described herein can be purified using known existing techniques such as high-performance liquid chromatography (HPLC), ion-exchange chromatography, gel electrophoresis, affinity chromatography, and size exclusion chromatography. The actual conditions used to purify a specific protein also depend on factors such as net charge, hydrophobicity, and hydrophilicity, which are obvious to those skilled in the art. The purity of the antibody molecules of this invention can be determined by any of a variety of well-known analytical methods, including size exclusion chromatography, gel electrophoresis, and HPLC.
[0374] III Immunoconjugates
[0375] In some embodiments, the present invention provides immune conjugates comprising any antibodies and other substances, such as therapeutic agents or markers, provided herein. In some embodiments, the therapeutic agent may be a therapeutic agent suitable for forming immune conjugates with antibodies. In some embodiments, the therapeutic agent is selected from any of the following categories (i)-(iii): (i) drugs that enhance antigen presentation (e.g., tumor antigen presentation); (ii) drugs that enhance effector cell responses (e.g., B cell and / or T cell activation and / or mobilization); (iii) drugs that reduce immunosuppression; and (iv) drugs that have antitumor effects. In some embodiments, the therapeutic agent shown is a chemotherapeutic agent.
[0376] In some implementations, the immunoconjugate is an antibody-drug conjugate (ADC).
[0377] IV. Nucleic Acids and Host Cells
[0378] This invention provides nucleic acids encoding any strand or monomer, domain, or antigen-binding region of the multispecific antibody, such as a trispecific antibody, of this invention. Polynucleotide sequences encoding each strand can be generated using methods well-known in the art. Furthermore, the polynucleotides and nucleic acids of this invention may include segments encoding secretion signal peptides and be operatively linked to antibodies or proteins encoding the multispecific antibody, such as a trispecific antibody, of this invention, thereby guiding the secretory expression of the multispecific antibody, such as a trispecific antibody, and its strands.
[0379] This invention also provides vectors containing the nucleic acids of this invention. In one embodiment, the vector is an expression vector, such as a eukaryotic expression vector. Vectors include, but are not limited to, viruses, plasmids, granules, λ phages, or yeast artificial chromosomes (YAC). In a preferred embodiment, the expression vector of this invention is a pCNDA vector, such as the pCDNA3.1 expression vector.
[0380] This invention also provides host cells comprising the said nucleic acid or the said vector. Host cells suitable for replicating and supporting the expression of the multispecific antibodies, such as trispecific antibodies, of this invention are well known in the art. Such cells can be transfected or transduced with specific expression vectors, and large quantities of vector-containing cells can be grown for inoculation into large-scale fermenters to obtain sufficient quantities of multispecific antibodies, such as trispecific antibodies, for clinical applications.
[0381] In one embodiment, the host cell is eukaryotic. In another embodiment, the host cell is selected from yeast cells, mammalian cells (e.g., CHO cells or 293 cells, such as Expi293 cells or HEK293 cells). Examples of available mammalian host cell lines include the monkey kidney CV1 line (COS-7) transformed from SV40; human embryonic kidney line (293 or 293T cells, as described in Graham et al., J Gen Virol 36, 59 (1977)); young rat kidney cells (BHK); mouse setoli cells (TM4 cells, as described, for example, in Mather, Biol Reprod 23, 243-251 (1980)); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical cancer cells (HELA); canine kidney cells (MDCK); buffalo rat hepatocytes (BRL3A); human lung cells (W138); human hepatocytes (HepG2); mouse mammary tumor cells (MMT060562); TRI cells (as described, for example, in Mather et al., Annals N.Y. Acad Sci 383, 44-68 (1982)); MRC5 cells; and FS4 cells. Other available mammalian host cell lines include Chinese hamster ovary (CHO) cells, including dhfr-CHO cells (Urlaub et al., ProcNatlAcadSciUSA77,4216 (1980)); and myeloma cell lines such as YO, NSO, P3X63, and Sp2 / O. In one embodiment, the host cell is a eukaryotic cell, preferably a mammalian cell such as Chinese hamster ovary (CHO) cells, human embryonic kidney (HEK) cells, or lymphocytes (e.g., YO, NSO, Sp20 cells).
[0382] V. Pharmaceutical compositions, drug combinations, and reagent kits
[0383] In one aspect, the present invention provides compositions, pharmaceuticals, or formulations, such as pharmaceutical compositions comprising the trispecific antibody molecule of the present invention, and optionally pharmaceutical excipients. In some embodiments, the pharmaceutical excipient is a pharmaceutically acceptable carrier.
[0384] The compositions of the present invention can be in a variety of forms. These forms include, for example, liquid, semi-solid, and solid dosage forms, such as liquid solutions (e.g., injectable and infusionable solutions), dispersions or suspensions, liposomes, and suppositories. Preferred forms depend on the intended mode of administration and therapeutic use. Commonly preferred compositions are in the form of injectable or infusionable solutions. Preferred modes of administration are parenteral injection or infusion. As used herein, the phrases “parenteral administration” and “parenteral route of administration” mean modes of administration other than enteral and local administration, typically administered by injection, and including but not limited to intravenous, intramuscular, intra-arterial, intradermal, intraperitoneal, tracheal, subcutaneous injection, and infusion.
[0385] In one preferred embodiment, the antibody molecule is administered via intravenous infusion or injection. In another preferred embodiment, the antibody molecule is administered via intramuscular, intraperitoneal, or subcutaneous injection.
[0386] In some embodiments, the antibody molecule of the present invention is the sole active ingredient in the pharmaceutical composition. In other embodiments, the pharmaceutical composition may comprise the antibody molecule described herein along with one or more other therapeutic agents.
[0387] The pharmaceutical compositions of the present invention may contain a "therapeutic effective amount" or a "preventive effective amount" of the antibody molecule described in the present invention.
[0388] Kits containing the antibody molecules described herein are also within the scope of this invention. Kits may include one or more other elements, such as: instructions for use; other reagents, such as markers or conjugation agents; a pharmaceutically acceptable carrier; and a device or other material for administration to a subject.
[0389] In another aspect, the present invention also provides pharmaceutical combinations or pharmaceutical combination products comprising the antibody molecules described herein and one or more other therapeutic agents.
[0390] The present invention also provides a complete set of pillboxes containing the aforementioned drug combination, for example, the complete set of pillboxes comprising, within the same package:
[0391] - A first container containing a pharmaceutical composition comprising the trispecific antibody of the present invention;
[0392] - A second container containing a pharmaceutical composition comprising other therapeutic agents.
[0393] Other therapeutic agents suitable for use in the pharmaceutical compositions and pharmaceutical combinations of the present invention may be therapeutic agents selected from any of the following categories (i)-(iii): (i) drugs that enhance antigen presentation (e.g., tumor antigen presentation); (ii) drugs that enhance effector cell responses (e.g., B cell and / or T cell activation and / or mobilization); (iii) drugs that reduce immunosuppression; and (iv) drugs that have antitumor effects. In some embodiments, the other therapeutic agents are chemotherapeutic agents.
[0394] VI. Uses and methods of the molecules of this invention
[0395] In one aspect, the present invention provides in vivo and in vitro uses and methods of applying the antibody molecules of the present invention.
[0396] In some embodiments, the use and methods of the present invention relate to applying the antibody molecules of the present invention in vivo and / or in vitro:
[0397] - With high affinity, it binds to GPRC5D antigen, including GPRC5D antigen expressed on the cell surface;
[0398] - To enable T cells (e.g., CD4+ and / or CD8+ T cells) to target cells that express GPRC5D on their surface, especially GPRC5D-positive tumor cells;
[0399] - Enable T cells (e.g., CD4+ and / or CD8+ T cells) to target cells that express BCMA on their surface, especially BCMA-positive tumor cells;
[0400] -Activate the CD3 downstream signaling pathway in T cells;
[0401] -Mediates the killing effect of T cells on GPRC5D positive tumor cells and / or BCMA positive tumor cells;
[0402] - Induces T cells to release cytokines, such as TNF-α, IFN-γ, and IL-2;
[0403] - Inhibit or kill GPRC5D-positive and / or BCMA-positive tumor cells, or
[0404] - Treat GPRC5D-positive and / or BCMA-positive tumors, such as multiple myeloma, for example, treating BCMA-positive patients, GPRC5D-positive patients, or GPRC5D-positive patients who lose BCMA after binding to anti-BCMA molecules.
[0405] - Used to prevent tumor recurrence mediated by BCMA escape, such as recurrence of multiple myeloma.
[0406] In some embodiments, the present invention provides methods for preventing or treating GPRC5D and / or BCMA-related diseases in subjects, including administering the trispecific antibody of the present invention, or an immunoconjugate, composition, or drug or formulation containing the present invention, to the subject. In some embodiments, the present invention provides methods for use in subjects for the above purposes, including administering the trispecific antibody of the present invention, or an immunoconjugate, composition, or drug or formulation containing the present invention, to the subject.
[0407] In some embodiments, the disease is, for example, a tumor, such as cancer. The cancer can be in an early, intermediate, or late stage, or metastatic stage. In some embodiments, the cancer is a GPRC5D single-positive cancer, a BCMA single-positive cancer, a GPRC5D and BCMA double-positive cancer, or a cancer expressing both BCMA and GPRC5D at low levels, such as a cancer expressing low levels of GPRC5D and / or BCMA (e.g., cancer that has relapsed after anti-BCMA or anti-GPRC5D treatment). In some embodiments, the cancer can be a solid tumor or a hematologic malignancy. In some embodiments, the cancer is multiple myeloma.
[0408] Due to their antigen-binding specificity against BCMA and GRPC5D, the trispecific antibody molecules of the present invention can treat a broader patient population of cancer patients than bispecific antibodies targeting BCMA and CD3 and bispecific antibodies targeting GPRC5D and CD3. In some embodiments, the present invention provides the application of the trispecific antibody molecules of the present invention to treat GPRC5D single-positive cancers. In some embodiments, the present invention provides the application of the trispecific antibody molecules of the present invention to treat BCMA single-positive cancers. In some embodiments, the present invention provides the application of the trispecific antibody molecules of the present invention to treat GPRC5D and BCMA double-positive cancers. In some embodiments, the present invention also provides a method of applying the trispecific antibody molecules of the present invention to treat cancers with low expression of BCMA and / or GPCR5D, such as cancers with low expression of GRPC5D and / or low expression of BCMA or cancers with double low expression of BCMA and GPRC5D (e.g., cancers that relapse after anti-BCMA treatment and / or anti-GPRC5D treatment).
[0409] The term "GPRC5D single-positive cancer" as used in this invention refers to cancer cells that express only GPRC5D, or cancer cells where GPRC5D expression is elevated compared to healthy cells (e.g., cells from the same tissue of a healthy subject or healthy cells adjacent to cancer cells) (i.e., overexpression). The term "GPRC5D low-expression cancer" as used in this invention refers to cancer cells with lower GPRC5D expression, for example, slightly higher than the expression level in normal healthy tissue cells.
[0410] The "BCMA single-positive cancer" described in this invention refers to cancer cells that express only BCMA, or cancer cells where BCMA expression is elevated (i.e., overexpression) compared to healthy cells (e.g., cells from the same tissue of a healthy subject or healthy cells adjacent to cancer cells). The "BCMA low-expression cancer" described in this invention refers to cancer cells with lower BCMA expression, for example, slightly higher than the expression level in normal healthy tissue cells.
[0411] The "GPRC5D and BCMA double-positive cancer" as described in this invention refers to cancer cells that express both GPRC5D and BCMA, or cancer cells in which GPRC5D and BCMA expression is elevated compared to healthy cells (e.g., identical tissue cells from a healthy subject or healthy cells adjacent to cancer cells). "GPRC5D and BCMA double-positive cancer" also encompasses cancers that express both BCMA and GPRC5D, but with lower expression of either or both, such as cancers with low BCMA and / or GPCR5D expression, such as cancers with low GRPC5D and / or low BCMA expression, or cancers with low expression of both BCMA and / or GPRC5D (e.g., cancers that relapse after anti-BCMA treatment and / or anti-GPRC5D treatment).
[0412] When “BCMA positive” is used herein, it encompasses not only the expression of wild-type BCMA but also the expression of BCMA variants. BCMA variants can be variants obtained through mutations such as deletions or amino acid substitutions. In some embodiments, BCMA mutations lead to resistance to immunotherapies targeting BCMA in an individual. Therefore, “BCMA positive cancer” of the present invention also encompasses cancer cells that express BCMA variants, or cancer cells in which BCMA variant expression is elevated (i.e., overexpressed) compared to healthy cells (e.g., the same tissue cells of a healthy subject or healthy cells adjacent to cancer cells).
[0413] In some implementations, BCMA variants contain one or more of the following mutations:
[0414] (i) Proline P deletion at position 34 (P34del);
[0415] (ii) S deletion of serine at position 30 (S30del);
[0416] (iii) Substitution of the 39th amino acid, for example, arginine R is replaced with alanine A (R39A);
[0417] (iv) Substitution of the 27th amino acid, for example, replacing arginine R with proline P (R27P).
[0418] In some embodiments, the present invention provides a method for inhibiting or killing GPRC5D-positive and / or BCMA-positive cells.
[0419] In some embodiments, the GPRC5D positive cells are cells that express or overexpress GPRC5D. In some embodiments, the BCMA positive cells are cells that express or overexpress BCMA.
[0420] In some embodiments, the BCMA variants in the BCMA-positive cells contain one or more of the following mutations:
[0421] (i) Proline P deletion at position 34 (P34del);
[0422] (ii) S deletion of serine at position 30 (S30del);
[0423] (iii) Substitution of the 39th amino acid, for example, arginine R is replaced with alanine A (R39A);
[0424] (iv) Substitution of the 27th amino acid, for example, replacing arginine R with proline P (R27P).
[0425] In some embodiments, the BCMA-positive cells of the present invention, expressing or overexpressing a BCMA variant, are resistant to immunotherapies targeting BCMA (e.g., Elranatamab or Teclistamab treatment). In some embodiments, the BCMA-positive cells of the present invention, expressing or overexpressing a BCMA variant, are resistant to immunotherapies targeting BCMA and GPRC5D.
[0426] In some embodiments, the BCMA-positive cells of the present invention, which express or overexpress BCMA variants, have BCMA with mutations of P34del, S30del, R39A, or R27P. In some embodiments, the BCMA-positive cells of the present invention, which express or overexpress BCMA variants, have BCMA with mutations of P34del, S30del, R39A, or R27P expressed, or their expression is higher than in healthy cells (e.g., identical tissue cells of a healthy subject or healthy cells adjacent to cancer cells) (i.e., overexpression).
[0427] In some embodiments, the BCMA-positive cells of the present invention, which express or overexpress BCMA variants, have expression or overexpression of BCMA variants containing P34del or R27P mutations and are resistant to Elranatamab.
[0428] In some embodiments, the BCMA-positive cells of the present invention, which express or overexpress BCMA variants, have expression or overexpression of BCMA variants containing P34del, S30del, R39A, or R27P mutations and are resistant to Teclistamab.
[0429] In some embodiments, the antibody molecules of the present invention or pharmaceutical compositions containing the antibody molecules of the present invention are used as drugs for treating and / or preventing GRPC5D and / or BCMA-related diseases in individuals, or for killing or inhibiting GRPC5D-positive and / or BCMA-positive cells, or as diagnostic tools for GRPC5D and / or BCMA-related diseases, preferably, said individuals are mammals, more preferably humans.
[0430] In other respects, the present invention provides the use of the trispecific antibody of the present invention or an immunoconjugate or composition thereof or a combination product thereof in the production or preparation of a medicament for the purposes described herein, such as for the prevention or treatment of the related diseases or conditions mentioned herein or for the killing or inhibition of GPRC5D positive and / or BCMA positive cells.
[0431] In some embodiments, the trispecific antibodies of the present invention (and immunoconjugates, compositions, pharmaceutical compositions, formulations, etc. comprising them) may also be administered in combination with one or more other therapies, such as treatments and / or other therapeutic agents, for the purposes described herein, such as for the prevention and / or treatment of the related diseases or conditions mentioned herein, or for the killing or inhibition of GPRC5D-positive and / or BCMA-positive cells.
[0432] In some implementations, the treatment method is, for example, surgery or radiation therapy.
[0433] In one aspect, the present invention provides a diagnostic method for detecting the presence of a relevant antigen in biological samples, such as serum, semen, or urine, or tissue biopsy samples (e.g., from hyperplastic or cancerous lesions), either in vitro or in vivo. The diagnostic method comprises: (i) contacting the sample (and optionally, a control sample) with an antibody molecule as described herein, under conditions that allow for interaction, or administering the antibody molecule to a subject; and (ii) detecting the formation of a complex between the antibody molecule and the sample (and optionally, the control sample). The formation of the complex indicates the presence of the relevant antigen and may demonstrate the suitability or need for the treatment and / or prevention described herein.
[0434] In some implementations, the relevant antigen, such as GRPC5D and / or BCMA, is detected before treatment, for example, before initiating treatment or before a treatment interval. Possible detection methods include immunohistochemistry, immunocytochemistry, FACS, ELISA assays, PCR techniques (e.g., RT-PCR), or in vivo imaging techniques. Generally, antibody molecules used in in vivo and in vitro detection methods are directly or indirectly labeled with a detectable substance to facilitate the detection of bound or unbound conjugates. Suitable detectable substances include a variety of biologically active enzymes, cofactors, fluorescent substances, luminescent substances, paramagnetic (e.g., NMR-active) substances, and radioactive substances.
[0435] In some embodiments, the level and / or distribution of relevant antigens, such as GRPC5D and / or BCMA, are determined in vivo, for example, non-invasively (e.g., by detecting detectable antibody molecules labeled with the present invention using suitable imaging techniques, such as positron emission tomography (PET) scans). In one embodiment, the level and / or distribution of relevant antigens are determined in vivo, for example, by detecting antibody molecules of the present invention labeled detectably with PET reagents (e.g., 18F-fluorodeoxyglucose (FDG)).
[0436] In one embodiment, the present invention provides a diagnostic kit comprising the antibody molecule described herein and instructions for use.
[0437] VII. Specific Implementation Plan
[0438] In one aspect of the invention, the invention relates to the following specific embodiments:
[0439] 1. A trispecific antibody that specifically binds to BCMA, comprising a first antigen-binding region that specifically binds to BCMA, and second and third antigen-binding regions that specifically bind to other antigens.
[0440] 2. The trispecific antibody of implementation scheme 1, wherein the second antigen-binding region specifically binds to CD3, and / or the third antigen-binding region specifically binds to GPRC5D.
[0441] 3. The trispecific antibody according to implementation scheme 1 or 2, wherein the first antigen-binding region, the second antigen-binding region and the third antigen-binding region are the first Fab, the second Fab and the third Fab, respectively.
[0442] 4. The trispecific antibody of implementation scheme 3, wherein
[0443] (1) The first Fab fuses at the C end of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C end of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region of the Fc heterodimer; and the third Fab fuses at the C end of CH1 of the Fab heavy chain to the N end of the VH of the Fab heavy chain of the second Fab fragment.
[0444] or
[0445] The third Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of the other Fc region of the Fc heterodimer, and the first Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the N-terminus of the VH of the Fab heavy chain of the second Fab fragment.
[0446] or
[0447] (2) The first Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of the other Fc region of the Fc heterodimer; and the third Fab fuses at the N-terminus of VH of the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab; or
[0448] The third Fab fuses at the C-terminus of CH1 in the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 in the Fab heavy chain to the CH2 or hinge region of another Fc region of the Fc heterodimer, and the first Fab fuses at the N-terminus of VH in the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab.
[0449] 5. The trispecific antibody of implementation scheme 4, wherein the fusion includes direct fusion or fusion through a linker.
[0450] 6. The trispecific antibody of implementation scheme 5, wherein the linker is (GGGGS)n, where n = 1, 2, 3 or 4.
[0451] 7. A trispecific antibody according to any one of embodiments 3-6, wherein the second Fab contains a charge mutation, and the first or third Fab fused to the second Fab or fused to the second Fab through the Fc region contains a charge mutation and a disulfide bond remodeling mutation.
[0452] 8. The trispecific antibody of embodiment 7, wherein the charge mutation is a mutation to D or K at position 39 of VH in Fab and a mutation to K or D at position 38 of VL in Fab, for example.
[0453] The second Fab comprises VH and VL, wherein VH comprises 39D and VL comprises 38K, and
[0454] The first or third Fab fused with the second Fab via the Fc region comprises VH and VL, wherein the VH comprises 39K and the VL comprises 38D; or
[0455] The second Fab comprises VH and VL, wherein VH comprises 39K and VL comprises 38D, and
[0456] The first or third Fab fused with the second Fab via the Fc region includes VH and VL, wherein the VH includes 39D and the VL includes 38K.
[0457] 9. The trispecific antibody of embodiment 7 or 8, wherein the disulfide bond remodeling mutation is such that F126C is contained in CH1 of Fab and Q124C is contained in CL of Fab.
[0458] 10. The trispecific antibody of embodiment 9, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1, wherein CH1
[0459] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:85, and contains F126C; or
[0460] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:85.
[0461] 11. The trispecific antibody of embodiment 9 or 10, wherein the Fab containing the disulfide bond remodeling mutation comprises CL, wherein the CL
[0462] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:97, and contains Q124C; or
[0463] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:97.
[0464] 12. The trispecific antibody of embodiment 9, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1 and CL, wherein CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:85, and the CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:97.
[0465] 13. The trispecific antibody of embodiment 7 or 8, wherein the disulfide bond remodeling mutation comprises F126C and C220S in CH1 of Fab and Q124C and C214S in CL of Fab.
[0466] 14. The trispecific antibody of embodiment 13, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1, wherein CH1
[0467] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:86, and includes F126C and C220S; or
[0468] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:86.
[0469] 15. The trispecific antibody according to embodiment 13 or 14, wherein the Fab containing the disulfide bond remodeling mutation comprises CL, wherein the CL
[0470] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:98, and contains Q124C and C214S; or
[0471] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:98.
[0472] 16. The trispecific antibody of embodiment 13, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1 and CL, wherein CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:86, and the CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:98.
[0473] 17. A trispecific antibody according to any one of embodiments 1-16, wherein the trispecific antibody comprises a first Fc region and a second Fc region, wherein the first Fc region and the second Fc region are the same or different.
[0474] 18. The trispecific antibody of embodiment 17, wherein the first Fc region and the second Fc region are human IgG Fc, for example, human IgG1Fc, human IgG2Fc, human IgG3Fc, or human IgG4Fc, for example, containing or consisting of an amino acid sequence SEQ ID NO: 87 or 88 or having at least 90% identity with it, for example, 95%, 96%, 97%, 99% or higher.
[0475] 19. The trispecific antibody of embodiment 18, wherein the first and / or second Fc region contains the L234A / L235A mutation.
[0476] 20. The trispecific antibody of embodiment 19, wherein the first and / or second Fc region comprises an amino acid sequence SEQ ID NO:89 or 90; or comprises an amino acid sequence having at least 90% identity, such as 95%, 96%, 97%, 99% or higher identity, and comprises an amino acid substitution L234A / L235A.
[0477] 21. A trispecific antibody according to any one of embodiments 17-20, wherein one of the first and second Fc regions contains a Knob mutation and the other contains a Hole mutation.
[0478] 22. The trispecific antibody of embodiment 21, wherein one Fc region contains amino acid substitution T366W, and the other Fc region contains amino acid substitutions T366S, L368A and Y407V (numbered according to EU index).
[0479] 23. The trispecific antibody of embodiment 22, wherein one Fc region polypeptide contains an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide contains an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:92.
[0480] 24. The trispecific antibody of embodiment 23, wherein one Fc region polypeptide contains or is composed of the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide contains or is composed of the amino acid sequence shown in SEQ ID NO:92.
[0481] 25. The trispecific antibody of embodiment 17, wherein one Fc region contains amino acid substitutions L234A / L235A and T366W, and the other Fc region contains amino acid substitutions L234A / L235A and T366S, L368A and Y407V (numbered according to EU index).
[0482] 26. The trispecific antibody of embodiment 25, wherein one Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:94, and the other Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:93.
[0483] 27. The trispecific antibody of embodiment 26, wherein one Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:94, and the other Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:93.
[0484] 28. A trispecific antibody according to any one of embodiments 1-27, wherein the first antigen-binding region specifically binding to BCMA comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3, wherein...
[0485] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:57; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:58; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:59; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:61; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:62; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:63.
[0486] 29. The trispecific antibody of embodiment 28, wherein the VH of the first antigen-binding region that specifically binds to BCMA contains the amino acid sequence shown in SEQ ID NO:56 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0487] 30. The trispecific antibody of embodiment 28 or 29, wherein the VL that specifically binds to the first antigen-binding region of BCMA contains the amino acid sequence shown in SEQ ID NO:60 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0488] 31. The trispecific antibody of embodiment 30, wherein the first antigen-binding region specifically binding to BCMA comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:56, and the VL of the first antigen-binding region specifically binding to BCMA consists of the amino acid sequence shown in SEQ ID NO:60.
[0489] 32. The trispecific antibody of embodiment 28, wherein the first antigen-binding region specifically binding to BCMA comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K.
[0490] For example,
[0491] VH of the first antigen-binding region
[0492] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:76, or
[0493] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:76, and contains a Q39K mutation;
[0494] and / or the VL of the first antigen-binding region
[0495] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:75, or
[0496] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:75, and contains a Q38D mutation.
[0497] 33. A trispecific antibody according to any one of embodiments 1-32, wherein the third antigen-binding region specifically binds to GPRC5D and comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3, wherein...
[0498] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:41; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:42; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:43; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:45; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:46; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:47; or
[0499] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:49; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:50; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:51; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:53; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:54; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:55.
[0500] 34. The trispecific antibody of embodiment 33, wherein the VH that specifically binds to the third antigen-binding region of GPRC5D contains
[0501] (i) The amino acid sequence shown in SEQ ID NO:40 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or composed of said amino acid sequence; or
[0502] (ii) The amino acid sequence shown in SEQ ID NO:48 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with it, or composed of said amino acid sequence.
[0503] 35. The trispecific antibody of embodiment 33 or 34, wherein the VL that specifically binds to the third antigen-binding region of GPRC5D contains
[0504] (i) The amino acid sequence shown in SEQ ID NO:44 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or composed of said amino acid sequence; or
[0505] (ii) The amino acid sequence shown in SEQ ID NO:52 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with it, or composed of said amino acid sequence.
[0506] 36. The trispecific antibody of embodiment 35, wherein the third antigen-binding region that specifically binds to GPRC5D comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:48 and VL consists of the amino acid sequence shown in SEQ ID NO:52; or VH consists of the amino acid sequence shown in SEQ ID NO:40 and VL consists of the amino acid sequence shown in SEQ ID NO:44.
[0507] 37. A trispecific antibody according to any one of embodiments 33-36, wherein the third antigen-binding region specifically binding to GPRC5D comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K, for example...
[0508] The VH that specifically binds to the third antigen-binding region of GPRC5D
[0509] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:80, or
[0510] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:80, and contains a Q39K mutation;
[0511] Furthermore, the VL that specifically binds to the third antigen-binding region of GPRC5D
[0512] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:79, or
[0513] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:79, and contains a Q38D mutation.
[0514] 38. A trispecific antibody according to any one of embodiments 1-37, wherein the second antigen-binding region specifically binds to CD3 and includes a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region includes HCDR1, HCDR2, and HCDR3, and the light chain variable region includes LCDR1, LCDR2, and LCDR3.
[0515] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:65; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:66; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:67 or 73; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:69; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:70; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:71.
[0516] 39. The trispecific antibody of embodiment 38, wherein the VH of the second antigen-binding region that specifically binds to CD3 contains the amino acid sequence shown in SEQ ID NO: 64 or 72 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0517] 40. The trispecific antibody of embodiment 38 or 39, wherein the VL of the second antigen-binding region that specifically binds to CD3 contains the amino acid sequence shown in SEQ ID NO:68 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0518] 41. The trispecific antibody of embodiment 40, wherein the second antigen-binding region specifically binding to CD3 comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:64 or 72, and VL of the second antigen-binding region consists of the amino acid sequence shown in SEQ ID NO:68.
[0519] 42. A trispecific antibody according to any one of embodiments 38-41, wherein the second antigen-binding region that specifically binds to CD3 comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K.
[0520] 43. The trispecific antibody of embodiment 42, wherein the VH specificly binds to the second antigen-binding region of CD3.
[0521] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:77 or 78, or
[0522] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO: 77 or 78, and contains a Q39D mutation;
[0523] And the VL that specifically binds to the second antigen-binding region of CD3
[0524] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:74, or
[0525] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:74, and contains a Q38K mutation.
[0526] 44. The trispecific antibody of any one of the implementation schemes 3-43 is a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, which is composed of the following polypeptide chains:
[0527] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0528] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0529] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to BCMA, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0530] A peptide chain #4 containing a Fab light chain that specifically binds to BCMA, and
[0531] A peptide chain #5 consisting of a Fab light chain that specifically binds to CD3.
[0532] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the first and second Fabs.
[0533] 45. The trispecific antibody of implementation scheme 44, wherein...
[0534] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence;
[0535] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence;
[0536] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence;
[0537] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or
[0538] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0539] 46. The trispecific antibody of implementation scheme 44, wherein...
[0540] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:15, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:15, or is composed of said amino acid sequence;
[0541] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:14, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:14, or is composed of said amino acid sequence;
[0542] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence;
[0543] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or
[0544] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0545] 47. The trispecific antibody of any one of the implementation schemes 1-43 is a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, which is composed of the following polypeptide chains:
[0546] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to BCMA and an Fc domain.
[0547] A peptide chain #2 containing a Fab light chain that specifically binds to BCMA.
[0548] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to GPRC5D, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0549] A peptide chain #4 containing a Fab light chain that specifically binds to GPRC5D, and
[0550] A peptide chain #5 containing a Fab light chain that specifically binds to CD3.
[0551] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the first Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the third and second Fabs.
[0552] 48. The trispecific antibody of implementation scheme 47, wherein...
[0553] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:11, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:11, or is composed of said amino acid sequence;
[0554] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:10, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:10, or is composed of said amino acid sequence;
[0555] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:9, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:9, or is composed of said amino acid sequence;
[0556] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:8, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:8, or is composed of said amino acid sequence; and / or
[0557] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0558] 49. The trispecific antibody of any one of the implementation schemes 1-43 is a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, which is composed of the following polypeptide chains:
[0559] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0560] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0561] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to CD3, an Fc domain, and an antigen-binding region of a Fab heavy chain that specifically binds to BCMA.
[0562] A peptide chain 4# containing a Fab light chain that specifically binds to CD3, and
[0563] A peptide chain #5 containing a Fab light chain that specifically binds to an antigen-binding region of BCMA.
[0564] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the second and first Fabs.
[0565] 50. The trispecific antibody of implementation scheme 49, wherein...
[0566] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence;
[0567] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence;
[0568] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:7, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:7, or is composed of said amino acid sequence;
[0569] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence; and / or
[0570] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence.
[0571] 51. A nucleic acid molecule that encodes any one chain of a trispecific antibody according to any one of embodiments 1-50, or is composed of the nucleic acid sequence.
[0572] 52. An expression vector comprising the nucleic acid molecule of embodiment 51, such as the expression vector being a pCNDA vector, for example, the pCDNA3.1 expression vector.
[0573] 53. A host cell comprising the nucleic acid molecule described in embodiment 51 or the expression vector described in embodiment 52, preferably, the host cell is prokaryotic or eukaryotic, such as 293 cells or CHO cells, such as HEK293 cells.
[0574] 54. A method for preparing a trispecific antibody according to any one of embodiments 1-50, the method comprising culturing a host cell containing a nucleic acid molecule as described in embodiment 51 or an expression vector as described in embodiment 52 under conditions suitable for chain expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
[0575] 55. An immunoconjugate comprising a trispecific antibody of any one of embodiments 1-50.
[0576] 56. A pharmaceutical composition or drug or formulation comprising a trispecific antibody of any one of embodiments 1-50, or an immunoconjugate of embodiment 55, and optionally a pharmaceutical excipient.
[0577] 57. A drug combination comprising a trispecific antibody of any one of embodiments 1-50, or an immunoconjugate of embodiment 55, and one or more other therapeutic agents, such as chemotherapeutic agents.
[0578] 58. A method for preventing or treating cancer in a subject, comprising administering to the subject an effective amount of any of the three-specific antibodies of embodiments 1-50, or the immunoconjugate of embodiment 55, or the pharmaceutical composition or formulation of embodiment 56; or the pharmaceutical combination of embodiment 57.
[0579] 59. The method of implementation scheme 58, wherein the cancer is a single positive GPRC5D cancer, a single positive BCMA cancer, a double positive GPRC5D and BCMA cancer, or a cancer with low expression of both BCMA and GPCR5D, such as cancer with low expression of GRPC5D and / or low expression of BCMA (e.g., cancer that relapses after anti-BCMA treatment or anti-GPRC5D treatment).
[0580] 60. The method of implementation 58 or 59, wherein the cancer is a solid tumor or a hematologic malignancy, such as multiple myeloma.
[0581] 61. The method of any one of embodiments 58-60, wherein the method further comprises administration in combination with other therapies such as treatment modalities (e.g., surgery or radiotherapy) and / or other therapeutic agents (e.g., chemotherapy agents).
[0582] In one aspect, the present invention also relates to the following specific embodiments:
[0583] 1. A trispecific antibody that specifically binds to GPRC5D, comprising a first antigen-binding region, a second antigen-binding region, and a third antigen-binding region that specifically bind to BCMA, wherein the first antigen-binding region comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3, wherein...
[0584] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:57; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:58; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:59; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:61; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:62; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:63.
[0585] Preferably, the second antigen-binding region specifically binds to CD3 and / or the third antigen-binding region specifically binds to GPRC5D.
[0586] 2. The trispecific antibody of embodiment 1, wherein the VH of the first antigen-binding region that specifically binds to BCMA contains the amino acid sequence shown in SEQ ID NO:56 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0587] 3. The trispecific antibody of embodiment 1 or 2, wherein the VL that specifically binds to the first antigen-binding region of BCMA contains the amino acid sequence shown in SEQ ID NO:60 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0588] 4. The trispecific antibody of embodiment 1, wherein the first antigen-binding region specifically binding to BCMA comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:56, and VL of the first antigen-binding region consists of the amino acid sequence shown in SEQ ID NO:60.
[0589] 5. A trispecific antibody according to any one of embodiments 1-4, wherein the first antigen-binding region that specifically binds to BCMA comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K.
[0590] 6. The trispecific antibody of implementation scheme 5, wherein the VH specificly binds to the first antigen-binding region of BCMA.
[0591] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:76, or
[0592] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:76, and contains a Q39K mutation;
[0593] And the VL that specifically binds to the first antigen-binding region of BCMA
[0594] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:75, or
[0595] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:75, and contains a Q38D mutation.
[0596] 7. A trispecific antibody according to any one of embodiments 1-6, wherein the first antigen-binding region that specifically binds to BCMA is Fab.
[0597] 8. A trispecific antibody according to any one of embodiments 1-7, wherein the third antigen-binding region specifically binding to GPRC5D comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3.
[0598] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:41; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:42; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:43; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:45; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:46; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:47; or
[0599] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:49; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:50; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:51; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:53; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:54; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:55.
[0600] 9. The trispecific antibody of embodiment 8, wherein the VH that specifically binds to the third antigen-binding region of GPRC5D contains
[0601] (i) The amino acid sequence shown in SEQ ID NO:40 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or composed of said amino acid sequence; or
[0602] (ii) The amino acid sequence shown in SEQ ID NO:48 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with it, or composed of said amino acid sequence.
[0603] 10. The trispecific antibody of embodiment 8 or 9, wherein the VL that specifically binds to the third antigen-binding region of GPRC5D contains
[0604] (i) The amino acid sequence shown in SEQ ID NO:44 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or composed of said amino acid sequence; or
[0605] (ii) The amino acid sequence shown in SEQ ID NO:52 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with it, or composed of said amino acid sequence.
[0606] 11. The trispecific antibody of embodiment 8, wherein the third antigen-binding region that specifically binds to GPRC5D comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:48 and VL consists of the amino acid sequence shown in SEQ ID NO:52; or VH consists of the amino acid sequence shown in SEQ ID NO:40 and VL consists of the amino acid sequence shown in SEQ ID NO:44.
[0607] 12. A trispecific antibody according to any one of embodiments 1-11, wherein the third antigen-binding region that specifically binds to GPRC5D comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K.
[0608] 13. The trispecific antibody of embodiment 12, wherein the VH specificly binds to the third antigen-binding region of GPRC5D.
[0609] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:80, or
[0610] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:80, and contains a Q39K mutation;
[0611] And the VL of the third antigen-binding region
[0612] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:79, or
[0613] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:79, and contains a Q38D mutation.
[0614] 14. A trispecific antibody according to any one of embodiments 1-13, wherein the third antigen-binding region that specifically binds to GPRC5D is Fab.
[0615] 15. A trispecific antibody according to any one of embodiments 1-14, wherein the second antigen-binding region specifically binding to CD3 comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3.
[0616] HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:65; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:66; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:67 or 73; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:69; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:70; and / or LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:71.
[0617] 16. The trispecific antibody of embodiment 15, wherein the VH of the second antigen-binding region that specifically binds to CD3 contains the amino acid sequence shown in SEQ ID NO: 64 or 72 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0618] 17. The trispecific antibody of embodiment 15 or 16, wherein the VL of the second antigen-binding region that specifically binds to CD3 contains the amino acid sequence shown in SEQ ID NO:68 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence.
[0619] 18. The trispecific antibody of embodiment 15, wherein the second antigen-binding region specifically binding to CD3 comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:64 or 72, and the VL of the second antigen-binding region consists of the amino acid sequence shown in SEQ ID NO:68.
[0620] 19. A trispecific antibody according to any one of embodiments 15-18, wherein the second antigen-binding region that specifically binds to CD3 comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K.
[0621] 20. The trispecific antibody of embodiment 19, wherein the VH specificly binds to the second antigen-binding region of CD3.
[0622] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:77 or 78, or
[0623] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO: 77 or 78, and contains a Q39D mutation;
[0624] And the VL that specifically binds to the second antigen-binding region of CD3
[0625] (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:74, or
[0626] (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:74, and contains a Q38K mutation.
[0627] 21. A trispecific antibody of any one of the implementation schemes 1-20, wherein the second antigen-binding region that specifically binds to CD3 is Fab.
[0628] 22. A trispecific antibody according to any one of the embodiments 1-21, wherein the first antigen-binding region, the second antigen-binding region and the third antigen-binding region are the first Fab, the second Fab and the third Fab, respectively.
[0629] 23. The trispecific antibody of embodiment 22, wherein the first Fab or the third Fab further comprises a disulfide bond remodeling mutation.
[0630] 24. The trispecific antibody of embodiment 23, wherein the disulfide bond remodeling mutation is such that F126C is contained in CH1 of Fab and Q124C is contained in CL of Fab.
[0631] 25. The trispecific antibody of embodiment 24, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1, wherein CH1
[0632] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:85, and contains F126C; or
[0633] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:85.
[0634] 26. The trispecific antibody of embodiment 24 or 25, wherein the Fab containing the disulfide bond remodeling mutation comprises CL, wherein the CL
[0635] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:97, and contains Q124C; or
[0636] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:97.
[0637] 27. The trispecific antibody of embodiment 24, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1 and CL, wherein CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:85, and the CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:97.
[0638] 28. The trispecific antibody of embodiment 24, wherein the disulfide bond remodeling mutation comprises F126C and C220S in CH1 of Fab and Q124C and C214S in CL of Fab.
[0639] 29. The trispecific antibody of embodiment 28, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1, wherein CH1
[0640] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:86, and includes F126C and C220S; or
[0641] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:86.
[0642] 30. The trispecific antibody of embodiment 28 or 29, wherein the Fab containing the disulfide bond remodeling mutation comprises CL, wherein the CL
[0643] (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:98, and contains Q124C; or
[0644] (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:98.
[0645] 31. The trispecific antibody of embodiment 28, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1 and CL, wherein CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:86, and the CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:98.
[0646] 32. A trispecific antibody according to any one of embodiments 1-31, wherein the trispecific antibody comprises a first Fc region and a second Fc region, wherein the first Fc region and the second Fc region are the same or different.
[0647] 33. The trispecific antibody of embodiment 32, wherein the first Fc region and the second Fc region are human IgG Fc, for example, human IgG1Fc, human IgG2Fc, human IgG3Fc, or human IgG4Fc, for example, containing or consisting of an amino acid sequence SEQ ID NO: 87 or 88 or having at least 90% identity with it, for example, 95%, 96%, 97%, 99% or higher.
[0648] 34. The trispecific antibody of embodiment 33, wherein the first and / or second Fc region contains the L234A / L235A mutation.
[0649] 35. The trispecific antibody of embodiment 34, wherein the first and / or second Fc region comprises an amino acid sequence SEQ ID NO:89 or 90; or comprises an amino acid sequence having at least 90% identity, such as 95%, 96%, 97%, 99% or higher identity, and comprises an amino acid substitution L234A / L235A.
[0650] 36. A trispecific antibody according to any one of embodiments 32-35, wherein one of the first and second Fc regions contains a Knob mutation and the other contains a Hole mutation.
[0651] 37. The trispecific antibody of embodiment 36, wherein one Fc region contains amino acid substitution T366W, and the other Fc region contains amino acid substitutions T366S, L368A and Y407V (numbered according to EU index).
[0652] 38. The trispecific antibody of embodiment 37, wherein one Fc region polypeptide contains an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide contains an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:92.
[0653] 39. The trispecific antibody of embodiment 32, wherein one Fc region contains amino acid substitutions L234A / L235A and T366W, and the other Fc region contains amino acid substitutions L234A / L235A and T366S, L368A and Y407V (numbered according to EU index).
[0654] 40. The trispecific antibody of embodiment 39, wherein one Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:94, and the other Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:93.
[0655] 41. A trispecific antibody according to any one of embodiments 1-40, wherein the first antigen-binding region, the second antigen-binding region, and the third antigen-binding region are respectively the first Fab, the second Fab, and the third Fab, and wherein...
[0656] (1) The first Fab fuses at the C end of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C end of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region of the Fc heterodimer; and the third Fab fuses at the C end of CH1 of the Fab heavy chain to the N end of the VH of the Fab heavy chain of the second Fab fragment.
[0657] or
[0658] The third Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of the other Fc region of the Fc heterodimer, and the first Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the N-terminus of the VH of the Fab heavy chain of the second Fab fragment.
[0659] or
[0660] (2) The first Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of the other Fc region of the Fc heterodimer; and the third Fab fuses at the N-terminus of VH of the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab; or
[0661] The third Fab fuses at the C-terminus of CH1 in the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 in the Fab heavy chain to the CH2 or hinge region of another Fc region of the Fc heterodimer, and the first Fab fuses at the N-terminus of VH in the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab.
[0662] 42. The trispecific antibody of implementation scheme 41, wherein fusion includes direct fusion or fusion through a linker.
[0663] 43. The trispecific antibody of implementation scheme 42, wherein the linker is (GGGGS)n, where n = 1, 2, 3 or 4.
[0664] 44. A trispecific antibody according to any one of embodiments 41-43, wherein the second Fab contains a charge mutation, which contains a Q38K or Q38D mutation in the Fab light chain and a Q39D or Q39K mutation in the Fab heavy chain.
[0665] 45. A trispecific antibody according to any one of embodiments 41-44, wherein in the first or third Fab fused to the second Fab, or fused to the second Fab via the Fc region, the Fab heavy chain contains a Q39K or Q39D and F126C mutation, and the Fab light chain contains a Q38D or Q38K and Q124C mutation; or
[0666] In a first or third Fab fused with a second Fab, or fused with a second Fab via an Fc region, the Fab heavy chain contains Q39K or Q39D and F126C mutations and C220S, and the Fab light chain contains Q38D or Q38K and Q124C mutations and C214S.
[0667] 46. A trispecific antibody according to any one of implementation schemes 41-43, wherein...
[0668] The second Fab contains a charge mutation, which includes a Q38K mutation in the Fab light chain and a Q39D mutation in the Fab heavy chain; and is fused with the second Fab, or with the first or third Fab via the Fc region, wherein the Fab heavy chain contains Q39K and F126C mutations, and the Fab light chain contains Q38D and Q124C mutations; or
[0669] The second Fab contains a charge mutation, which includes a Q38K mutation in the Fab light chain and a Q39D mutation in the Fab heavy chain; and is fused with the second Fab, or with the second Fab via the Fc region in the first or third Fab, wherein the Fab heavy chain contains Q39K and F126C mutations and C220S, and the Fab light chain contains Q38D and Q124C mutations and C214S; or
[0670] The second Fab contains a charge mutation, which includes a Q38D mutation in the Fab light chain and a Q39K mutation in the Fab heavy chain; and is fused with the second Fab, or with the second Fab via the Fc region in the first or third Fab, wherein the Fab heavy chain contains Q39D and F126C mutations, and the Fab light chain contains Q38K and Q124C mutations; or
[0671] The second Fab contains a charge mutation, which contains a Q38D mutation in the Fab light chain and a Q39K mutation in the Fab heavy chain; and is fused with the second Fab, or fused with the second Fab through the Fc region in the first or third Fab, wherein the Fab heavy chain contains Q39D and F126C mutations and C220S, and the Fab light chain contains Q38K and Q124C mutations and C214S.
[0672] 47. The trispecific antibody of any one of the implementation schemes 1-46 is a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, which is composed of the following polypeptide chains:
[0673] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0674] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0675] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to BCMA, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0676] A peptide chain #4 containing a Fab light chain that specifically binds to BCMA, and
[0677] A peptide chain #5 consisting of a Fab light chain that specifically binds to CD3.
[0678] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the first and second Fabs.
[0679] 48. The trispecific antibody of implementation scheme 47, wherein...
[0680] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence;
[0681] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence;
[0682] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence;
[0683] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or
[0684] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0685] 49. The trispecific antibody of implementation scheme 47, wherein...
[0686] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:15, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:15, or is composed of said amino acid sequence;
[0687] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:14, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:14, or is composed of said amino acid sequence;
[0688] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence;
[0689] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or
[0690] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0691] 50. A trispecific antibody according to any one of implementation schemes 1-46, which is a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, and is composed of the following polypeptide chains:
[0692] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to BCMA and an Fc domain.
[0693] A peptide chain #2 containing a Fab light chain that specifically binds to BCMA.
[0694] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to GPRC5D, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0695] A peptide chain #4 containing a Fab light chain that specifically binds to GPRC5D, and
[0696] A peptide chain #5 containing a Fab light chain that specifically binds to CD3.
[0697] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the first Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the third and second Fabs.
[0698] 51. The trispecific antibody of implementation plan 50, wherein...
[0699] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:11, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:11, or is composed of said amino acid sequence;
[0700] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:10, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:10, or is composed of said amino acid sequence;
[0701] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:9, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:9, or is composed of said amino acid sequence;
[0702] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:8, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:8, or is composed of said amino acid sequence; and / or
[0703] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence.
[0704] 52. The trispecific antibody of any one of the implementation schemes 1-46 is a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, which is composed of the following polypeptide chains:
[0705] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0706] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0707] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to CD3, an Fc domain, and an antigen-binding region of a Fab heavy chain that specifically binds to BCMA.
[0708] A peptide chain 4# containing a Fab light chain that specifically binds to CD3, and
[0709] A peptide chain #5 containing a Fab light chain that specifically binds to an antigen-binding region of BCMA.
[0710] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the second and first Fabs.
[0711] 53. The trispecific antibody of implementation plan 52, wherein...
[0712] Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence;
[0713] Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence;
[0714] Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:7, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:7, or is composed of said amino acid sequence;
[0715] Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence; and / or
[0716] Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence.
[0717] 54. A nucleic acid molecule that encodes any one chain of a trispecific antibody according to any one of embodiments 1-53, or is composed of the nucleic acid sequence.
[0718] 55. An expression vector comprising the nucleic acid molecule of embodiment 54, such as a pCNDA vector, for example, a pCDNA3.1 expression vector.
[0719] 56. A host cell comprising the nucleic acid molecule described in embodiment 54 or the expression vector described in embodiment 52, preferably, the host cell is prokaryotic or eukaryotic, such as 293 cells or CHO cells, such as HEK293 cells.
[0720] 57. A method for preparing a trispecific antibody according to any one of embodiments 1-53, the method comprising culturing a host cell containing the nucleic acid molecule of embodiment 54 or the expression vector of embodiment 55 under conditions suitable for chain expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
[0721] 58. An immunoconjugate comprising a trispecific antibody of any one of embodiments 1-53.
[0722] 59. A pharmaceutical composition or drug or formulation comprising a trispecific antibody of any one of embodiments 1-53, or an immunoconjugate of embodiment 58, and optionally a pharmaceutical excipient.
[0723] 60. A drug combination comprising a trispecific antibody of any one of embodiments 1-53, or an immunoconjugate of embodiment 55, and one or more other therapeutic agents, such as chemotherapeutic agents.
[0724] 61. A method for preventing or treating cancer in a subject, comprising administering to the subject an effective amount of any of the trispecific antibodies of embodiments 1-53, or the immunoconjugate of embodiment 58, or the pharmaceutical composition or formulation of embodiment 59; or the pharmaceutical combination of embodiment 57.
[0725] 62. The method of implementation scheme 61, wherein the cancer is a single positive GPRC5D cancer, a single positive BCMA cancer, a double positive GPRC5D and BCMA cancer, or a cancer with low expression of both BCMA and GPCR5D, such as cancer with low expression of GRPC5D and / or low expression of BCMA (e.g., cancer that relapses after anti-BCMA treatment or anti-GPRC5D treatment).
[0726] 63. The method of implementation 61 or 62, wherein the cancer is a solid tumor or a hematologic malignancy, such as multiple myeloma.
[0727] 64. The method of any one of embodiments 58-60, wherein the method further comprises administration in combination with other therapies such as treatment modalities (e.g., surgery or radiotherapy) and / or other therapeutic agents (e.g., chemotherapy agents).
[0728] It should be understood that this invention also covers any combination of any technical features described herein, or any combination of any technical solutions. Example
[0729] Example 1. Molecular structure design and construction of trispecific antibodies (Ts)
[0730] The example antibody is a T-cell engager multispecific antibody that simultaneously targets GPRC5D, BCMA, and CD3. It can simultaneously bind to two tumor-associated antigens (GPRC5D and BCMA) on the surface of multiple myeloma (MM) cells and the CD3 receptor on the surface of T cells. Based on two anti-GPRC5D antibodies with different affinities (hz7F5.3, hz5E12.1.P1), one anti-BCMA antibody (ADI-38497), and two anti-CD3 antibodies with different affinities (hzsp34.24, hzsp34.87), a multispecific antibody simultaneously targeting GPRC5D, BCMA, and CD3, and containing disulfide bond remodeling mutations and charge mutations, was designed. The sequence numbers and specific sequences of the variable regions and CDR sequences of the above three antibodies are provided in the sequence information.
[0731] Specifically, this invention designed six example antibodies with the 1+1+1 structure (B3, B3b, B5) shown in Figure 1 and Table 1, achieving superior efficacy compared to bispecific antibodies. Furthermore, the example antibody design utilized specific mutation techniques (disulfide bond remodeling mutation and charge mutation; specific mutation information is available in the sequence information table) to resolve light chain mismatches other than BCMA and CD3Fab. Additionally, the Fc region employed a "knob-in-hole" technique to resolve heavy chain mismatches in asymmetric IgG-like bispecific antibodies. The Fc region is the constant region of the IgG1 heavy chain, and L234A and L235A (“EU” numbered) amino acid mutations that weaken the effector function are introduced.
[0732] The design structures of the above six example antibodies are shown in Figure 1 and Table 1.
[0733] Table 1. Fragment numbers and descriptions of example antibodies
[0734] The structures of the six example antibodies mentioned above are in the form of B3, B3b, and B5.
[0735] The B3 form (see Figure 1A for details such as chain #) consists of a left-right asymmetric IgG-like pentamer composed of 5 polypeptide chains, which is composed of the following polypeptide chains:
[0736] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0737] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0738] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to BCMA, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0739] A peptide chain #4 containing a Fab light chain that specifically binds to BCMA, and
[0740] A peptide chain #5 consisting of a Fab light chain that specifically binds to CD3.
[0741] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the first and second Fabs, as shown in Figure 1A-Format B3.
[0742] The B3b form (see Figure 1A for details such as chain #) is an asymmetric IgG-like pentamer composed of five polypeptide chains, which consists of the following polypeptide chains:
[0743] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to BCMA and an Fc domain.
[0744] A peptide chain #2 containing a Fab light chain that specifically binds to BCMA.
[0745] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to GPRC5D, a Fab heavy chain that specifically binds to CD3, and an Fc domain.
[0746] A peptide chain #4 containing a Fab light chain that specifically binds to GPRC5D, and
[0747] A peptide chain #5 containing a Fab light chain that specifically binds to CD3.
[0748] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the first Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the third and second Fabs, as shown in Figure 1A-Format B3b.
[0749] The B5 form (see Figure 1B for details such as chain #) is an asymmetric IgG-like pentamer composed of five polypeptide chains, and it consists of the following polypeptide chains:
[0750] A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain.
[0751] A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D.
[0752] A peptide chain #3 consisting of a Fab heavy chain that specifically binds to CD3, an Fc domain, and an antigen-binding region of a Fab heavy chain that specifically binds to BCMA.
[0753] A peptide chain 4# containing a Fab light chain that specifically binds to CD3, and
[0754] A peptide chain #5 containing a Fab light chain that specifically binds to an antigen-binding region of BCMA.
[0755] The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the second and first Fabs, as shown in Figure 1B.
[0756] Meanwhile, this patent expresses and purifies the following bispecific or trispecific antibodies:
[0757] Inno-B (control Hel / BCMA / CD3, Hel is an egg lysozyme antibody that does not bind to any human-related proteins and is used as a control), Inno-G (control Hel / GPRC5D / CD3), F2(24) (GPRC5D / BCMA / CD3, structure derived from WO2022174813A1 (BCMA antigen-binding region is scFv)), F2(87) (GPRC5D / BCMA / CD3, structure derived from WO2022174813A1 (BCMA antigen-binding region is scFv)), JNJ-BCMA / CD3 (BCMA / CD3, from Derived from patent WO2017031104A1, also known as Teclistamab), Roche-BCMA / CD3 (BCMA / CD3, derived from patent WO2018083204A1, also known as Alnuctamab), REGN-BCMA / CD3 (BCMA / CD3, derived from patent US20200024356A), JNJ-GPRC5D / CD3 (GPRC5D / CD3, derived from patent WO2018017786A2), Roche-GPRC5D / CD3 (GPRC5D / CD3, derived from patent WO 2019 / 154890A1), Elranatamab (Pfizer BCMAxCD3, derived from patent WO2016166629A1).
[0758] The following negative control antibody was also expressed and purified: anti-Hel antibody (labeled as IgG or hIgG1 in the figure), whose heavy chain sequence is SEQ ID NO:101 and light chain sequence is SEQ ID NO:100.
[0759] Example 2. Preparation and purification of trispecific antibodies
[0760] plasmid preparation
[0761] The nucleic acids encoding each strand of the antibodies of this invention were synthesized by Genewiz gene and constructed onto pCDNA3.1 template plasmids, and a certain amount of plasmids were prepared. The plasmids were filtered through a 0.22 μm filter and used for transient transfection expression in cells.
[0762] Transfection and expression
[0763] Passage Expi293 cells (Invitrogen) to the required transfection volume, and adjust the cell density to 3 × 10⁻⁶ cells the day before transfection. 6 Cells / ml. The cell density was adjusted again to 3 × 10⁶ cells / ml on the day of transfection. 6Cells / ml. Each molecule was divided into two bottles, A and B, for expression. Bottle A contained plasmids containing peptides #1 and #2 at a 1:1 ratio, while bottle B contained plasmids containing peptides #3, #4, and #5 at a 1:1:1 ratio. The plasmids were diluted with 1 / 10 (v / v) of Opti-MEM medium (Gibco catalog number: 31985-070) as transfection buffer and mixed well. Appropriate amounts of polyethyleneimine (PEI) (Polysciences, 23966) were added to the plasmids from the previous step (plasmid to PEI mass ratio of 1:3), mixed well, and incubated at room temperature for 10 min to obtain a DNA / PEI mixture. Gently pour the DNA / PEI mixture into HEK293 cells and mix well. Incubate at 37°C and 8% CO2 for 24 hours. Then, add VPA (Sigma, catalog number: P4543-100G) to a final concentration of 2mM and 2% (v / v) feed (1g / L Phytone Peptone + 1g / L Difco Select Phytone) and continue culturing for 6 days.
[0764] purification
[0765] The culture was collected and centrifuged at 4000 rpm for 30 minutes. The cell supernatant was filtered through a 0.45 μM filter membrane and purified by Protein A affinity chromatography. Further purification was carried out by Kappa Select affinity chromatography and Lambda Fab Select affinity chromatography. Finally, the intact molecules were purified by in vitro recombination and ion exchange chromatography.
[0766] The specific steps for Protein A affinity chromatography purification are as follows: The supernatant was purified using a pre-packed Hitrap Mabselect Sure (GE, 11-0034-95) column. The procedure was as follows: Before purification, the column was equilibrated with 5 column volumes of equilibration buffer (20 mM Tris, 150 mM NaCl, pH 7.2); the collected supernatant was passed through the column, and the column was washed with 10 column volumes of equilibration buffer to remove non-specific binding proteins; the column was washed with 5 column volumes of elution buffer (100 mM sodiumcitrate, pH 3.5), and the eluent was collected. 2 M Tris was added to neutralize the pH to 6.5. The purified antibody was then quantitatively determined using liquid chromatography-mass spectrometry (LC-MS) with the correct paired ratio.
[0767] The specific KappaSelect affinity chromatography purification procedure is as follows: Purify the supernatant using a pre-packed HiTrap KappaSelect (GE, 17-5458-11) column. The procedure is as follows: Equilibrate the column with 5 column volumes of equilibration buffer (PBS, pH 7.4) before purification; pass the collected supernatant through the column, then wash the column with 10 column volumes of equilibration buffer to remove non-specific binding proteins; wash the column with 5 column volumes of elution buffer (0.1M glycine buffer, pH 2.5) and collect the eluent. Add 2M Tris to neutralize the pH to 6.5. Quantitatively determine the purified antibody using liquid chromatography-mass spectrometry (LC-MS) with the correct paired ratio.
[0768] The specific LambdaFabSelect affinity chromatography purification procedure is as follows: Purify the supernatant using a pre-packed HiTrap LambdaFabSelect (GE, 17-5482-11) column. The procedure is as follows: Equilibrate the column with 5 column volumes of equilibration buffer (PBS, pH 7.4) before purification; pass the collected supernatant through the column, then wash the column with 10 column volumes of equilibration buffer to remove non-specific binding proteins; wash the column with 5 column volumes of elution buffer (0.1M acetate buffer, pH 3.5) and collect the eluent. Neutralize the pH to 6.5 with 2M Tris. Quantitatively determine the purified antibody using liquid chromatography-mass spectrometry (LC-MS) with the correct paired ratio.
[0769] In vitro recombinant
[0770] The specific in vitro recombination method is as follows: the A molecule obtained from bottle A and the B molecule obtained from bottle B are mixed at a molar ratio of 1:1, and GSH (Sigma Aldrich, G4251) with a final concentration of 5 mM and arginine (Sigma Aldrich, A5006) with a final concentration of 50 mM are added. The mixture is then incubated at 37°C for 6 hours.
[0771] Fine purification
[0772] The specific ion exchange chromatography purification procedure is as follows: The in vitro recombinant product was exchanged into pH 6.0 low-salt PB buffer (10 mM phosphate, pH 6.0) using an ultrafiltration concentrator (MILLIPORE, catalog number: UFC901096), and then finely purified using Capto HiRes S10 / 100 (GE, catalog number 29275879). Before purification, the packing column was equilibrated with 5 column volumes of pH 6.0 low-salt PB buffer. The sample after buffer exchange was passed through the column, and the packing column was washed with 10 column volumes of pH 6.0 low-salt PB buffer to remove non-specifically binding proteins. During elution, the concentration of pH 6.0 high-salt PB buffer (10 mM phosphate, pH 6.0, 1 M NaCl) was linearly increased (linear gradient: the proportion of pH 6.0 high-salt PB buffer was increased from 1% to 100% over 30 column volumes), and the main elution peak was collected. Use an ultrafiltration concentrator (MILLIPORE, catalog number: UFC901096) to exchange into PBS buffer (Gibco, catalog number: 70011-044).
[0773] Figure 7 shows the aggregate differences between B3(24) molecules and control molecules (F2(24)).
[0774] Compared to the trispecific antibody (F2(24)) in patent application WO2022174813A1, the B3(24) molecule of this invention shows significant improvements in protein properties. Specifically, the proportion of aggregates generated during cation exchange purification after in vitro recombination is greatly reduced. After in vitro recombination, the trispecific antibody F2(24) in patent application WO2022174813A1 showed approximately 35% aggregates in cation exchange chromatography (Figure 7A), while the aggregates generated by the B3(24) molecule after in vitro recombination were very few or almost invisible (Figure 7B). Since aggregates are also one of the impurities that need to be removed during purification, the significant reduction in aggregates can greatly improve the recovery rate during purification.
[0775] Example 3. Affinity determination of trispecific antibodies to cells expressing antigens
[0776] 3.1 Determination of the affinity of trispecific antibodies for cells expressing antigens
[0777] In the example of the trispecific antibodies, affinity for human (h-) and cynomolgus monkey (cyno-) BCMA was detected in GS-CHO-hBCMA and GS-CHO-cynoBCMA cell lines; affinity for human (h-) and cynomolgus monkey (cyno-) GPRC5D was detected in GS-CHO-hGPRC5D and GS-CHO-cynoGPRC5D cell lines; and affinity for human CD3 was detected in T cells from the Jurkat cell line (GM-C01459) and human cryopreserved PBMCs (Saily, SLB-HP050B).
[0778] The GS-CHO cell lines overexpressing GPRC5D (GS-CHO-hGPRC5D and GS-CHO-cynoGPRC5D) were obtained as follows: The coding nucleic acids of the full-length sequences of human and monkey GPRC5D (human GPRC5D (Q9NZD1, uniprot database); monkey GPRC5D (A0A2K5W6I7, uniprot database)) were inserted into the PEE17.4 plasmid (Lonza, GS Xceed Expression System), and stable cell lines were constructed through pressure selection.
[0779] The GS-CHO cell lines overexpressing BCMA (GS-CHO-hBCMA and GS-CHO-cynoBCMA) were obtained as follows: The coding nucleic acids of the full-length sequences of human and monkey BCMA (human BCMA (Q02223, uniprot database); monkey BCMA (A0A2K5UD97, uniprot database)) were inserted into the T2A-EGFP plasmid (Genewiz), and stable cell lines were constructed through pressure selection.
[0780] Specifically, cultured cells were obtained or T cells were isolated from human PBMCs according to relevant instructions. Cells were seeded at a rate of 1E5 cells / well in 96-well V plates. The test and control molecules were then serially diluted (see Figure 2) and incubated with cells expressing the corresponding antigens at 4°C for 40 minutes. Fluorescently labeled secondary antibodies (1:200 dilution; simultaneously mixed with cell viability staining agent DCM, 1:2000 dilution; CD4 and CD8 antibodies were added to the isolated human T cells to label and distinguish the corresponding T cells, both at a 1:200 dilution). Finally, the cell fluorescence intensity was detected by flow cytometry (BD), and the EC50 was calculated using GraphPad Prism 8.0 to fit the curve. 50 Values. Figures 2A-H and Tables 2-9 show the affinity of the antibodies of the present invention for binding to the corresponding antigens. Reagents and Materials
[0781] The specific results are shown in Figure 2 and Table 2-10.
[0782] Table 2. Affinity of example antibodies to human BCMA-1
[0783] ND: not detected
[0784] Table 3. Affinity of example antibodies to human BCMA-2
[0785] Table 4. Affinity of example antibodies to cynomolgus monkey BCMA-1
[0786] Table 5. Affinity of example antibodies to human GPRC5D -1
[0787] Table 6. Affinity of example antibodies to human GPRC5D -2
[0788] Table 7. Affinity of example antibodies to cynomolgus monkey GPRC5D-1
[0789] Table 8. Affinity of Example Antibodies to Human CD3-1
[0790] Table 9. Affinity of Example Antibodies to Human T Cells
[0791] 3.2 Determination of the affinity of trispecific antibodies for cells expressing mutant antigens
[0792] 293T cell lines overexpressing BCMA mutants (293T-hBCMA-P34del, 293T-hBCMA-S30del, 293T-hBCMA-R39A, 293T-hBCMA-R27P) and GS CHO cell lines overexpressing BCMA mutants (GS CHO-hBCMA-P34del, GS CHO-hBCMA-S30del, GS CHO-hBCMA-R39A, GS CHO-hBCMA-R39A, GS CHO-hBCMA-R27P) The method for obtaining CHO-hBCMA-R27P is as follows: The full-length human BCMA sequence (human BCMA (Q02223, uniprot database)) is subjected to corresponding point mutations or deletion mutations. The mutated coding nucleic acids are then inserted into the T2A-EGFP plasmid (Genewiz). Stable cell lines are constructed through pressure selection. The amino acid sequences and coding nucleic acid sequences of the full-length human BCMA sequence, hBCMA-P34del, hBCMA-S30del, hBCMA-R39A, and -hBCMA-R27P are provided in the sequence information.
[0793] 1. Specific construction method:
[0794] After 2-3 passages, the resuscitated 293T cells were discarded, washed with 10 ml PBS, digested with 2 ml trypsin, and centrifuged at 400 x g for 3 min with culture medium. The supernatant was discarded, the cells were resuspended in culture medium, and 20 μL of the cell suspension was transferred to a 1.5 ml EP tube for cell counting at 1.5 x 10⁻⁶ cells / mL. 7 Cells were seeded in T175 Flask, agitated, and incubated horizontally in a 37°C incubator overnight. The pre-coated 293T cells were removed, the culture medium was discarded, and 20 ml of DMEM medium containing 10% FBS and 1% PS was added to each flask to prepare transfection mixture 1.
[0795] Add mixture 1 slowly dropwise into mixture 2, mix well, and let stand at room temperature for 15 minutes.
[0796] Add the transfection mixture to the culture medium of 293T cells, label the cells, and shake the culture flask to distribute the transfection mixture evenly in the medium. 4-6 h after transfection, discard the culture medium and add 20 mL of fresh DMEM culture medium containing 2% FBS. Collect the cell culture supernatant at 48 and 72 h after transfection, centrifuge at 500×g for 10 min at 4℃, and filter through a 0.45 μm low protein binding filter membrane. Digest the cells with 2 mL of trypsin after removing the supernatant, stop the digestion with culture medium, centrifuge at 400×g for 3 min, discard the supernatant, resuspend the cells in the culture medium, and place them in a culture flask to obtain 293T cell lines overexpressing BCMA mutants (293T-hBCMA-P34del, 293T-hBCMA-S30del, 293T-hBCMA-R39A, 293T-hBCMA-R27P). Continue culturing the cells in an incubator.
[0797] Viral supernatant: Mix Takara virus concentrate at a ratio of 3:1 (v / v), seal with sealing film, and incubate overnight at 4°C; after incubation overnight, centrifuge the mixture at 1500×g for 45 min at 4°C, discard the supernatant; resuspend the lentivirus precipitate in 1 mL of CD CHO medium, place at 4°C until completely dissolved, aliquot and store at -80°C.
[0798] Construction of GS CHO cell line overexpressing BCMA mutant: Collect GS CHO cells by centrifugation at 400×g for 4 min, discard supernatant, resuspend in 3 mL of complete culture medium, count cells, and add 1×10⁻⁶ cells at a virus supernatant:resuspended cell ratio of 2:1. 6 Cells were seeded in 6-well plates, with each well replenished with 1 mL of culture medium. Four hours post-infection, the culture medium was replenished to 2 mL. Twenty-four hours post-infection, cells were transferred to centrifuge tubes and centrifuged at 400 × g for 4 min to collect the cells. The virus-containing medium was discarded, and the cells were resuspended in fresh CD CHO medium containing 10% FBS and 1% PS. The cells were then seeded in T25 Flask plates and cultured vertically in a CO2 incubator. After 48 hours of culture, the culture medium was replenished to 10 mL, and the cells were incubated in a CO2 incubator. The CHO cells cultured at 37°C were then removed, centrifuged at 400 × g for 4 min to collect the cells, and the supernatant was discarded. The cells were then seeded in 125 mL Erlenmeyer flasks and cultured at 37°C with shaking. GS CHO cell lines overexpressing the BCMA mutant (GS CHO-hBCMA-P34del, GS CHO-hBCMA-S30del, GS CHO-hBCMA-R39A, GS CHO-hBCMA-R27P) were obtained.
[0799] 2. Detection method:
[0800] Remove the cultured 293T cell lines overexpressing BCMA mutants (293T-hBCMA-P34del, 293T-hBCMA-S30del, 293T-hBCMA-R39A, 293T-hBCMA-R27P), discard the culture medium, wash the cells with 10 ml PBS, digest with 2 ml trypsin, stop with culture medium, centrifuge at 400 x g for 5 min and discard the supernatant, resuspend in culture medium, take 20 μl of cell suspension into 1.5 ml EP tubes, count, and seed in 96-well U plates at 1E5 cells / well. Then, serially dilute the test antibody and control molecules. The antibody is serially diluted 3-fold with PBS, starting at 1500 nM and diluting 12 times. Take 50 μl of the serially diluted drug and incubate with the plated cells at 4°C for 30 min. Then add the fluorescently labeled secondary antibody (Anti-human). Fc-PE (Abcam, ab98596, diluted 1:200) was co-incubated at 4°C for 30 minutes. Finally, the cell fluorescence intensity was detected by flow cytometry (BD), and the EC50 was calculated using GraphPad Prism 8.0 to fit the curve. 50 value.
[0801] The cultured GS CHO cell lines overexpressing BCMA mutants (GS CHO-hBCMA-P34del, GS CHO-hBCMA-S30del, GS CHO-hBCMA-R39A, GS CHO-hBCMA-R27P) were centrifuged at 400xg for 5 min, the supernatant was discarded, and the cells were resuspended in culture medium. 20 μL of the cell suspension was transferred to 1.5 ml EP tubes, and the cells were counted. Cells were seeded at a rate of 1E5 cells / well in 96-well U-plates. The test and control molecules were then serially diluted. The antibody was serially diluted 3-fold with PBS, starting at 800 nM and diluting to 12 concentrations. 50 μL of each serially diluted drug was incubated with the plated cells at 4°C for 30 min. Then, fluorescently labeled secondary antibody (1:200 dilution) was added, and the cells were incubated at 4°C for another 30 min. Finally, the cell fluorescence intensity was detected by flow cytometry (BD), and the EC50 was calculated using GraphPad Prism 8.0 to fit the curve. 50 value.
[0802] 3. Experimental Results:
[0803] Figures 2I and 2J show the following results:
[0804] B3(24) can bind to cells that overexpress wild-type BCMA, cells that overexpress BCMA-P34del, cells that overexpress BCMA-P30del, cells that overexpress BCMA-R39A, and cells that overexpress BCMA-R27P.
[0805] Alnuctamab (Roche-BCMAxCD3) can bind to cells that overexpress wild-type BCMA, cells that overexpress BCMA-P34del, cells that overexpress BCMA-P30del, cells that overexpress BCMA-R39A, and cells that overexpress BCMA-R27P.
[0806] Elranatamab (Pfizer BCMAxCD3) can bind to cells overexpressing wild-type BCMA, cells overexpressing BCMA-P34del, and weakly bind to cells overexpressing BCMA-R39A.
[0807] Teclistamab / JNJ-BCMA / CD3 (J&J BCMAxCD3) can weakly bind to cells overexpressing wild-type BCMA and has a very weak binding to cells overexpressing BCMA-R39A.
[0808] Example 4. Determination of trispecific antibody affinity by BLI
[0809] In the trispecific example antibody of this invention, the affinity of the anti-BCMA and anti-CD3 ends was detected using biofilm layer optical interferometry (BLI). This invention utilizes BLI based on a fiber optic biosensor to determine the binding kinetics of the example antibody with human BCMA, monkey BCMA, human CD3E&G, and monkey CD3E&G. When biomolecules bind to the sensor surface, a biofilm is formed. This biofilm interferes with the waveform of light transmitted through the sensor. This interference is detected as a phase shift, thereby allowing the detection of changes in the number of molecules bound to the sensor. A kinetic curve is fitted based on the changes in the real-time response value, and k is calculated. on k off K D .
[0810] Specifically, probes coupled with streptavidin protein (SA) or anti-human-Fc (AHC) were pre-wetted in 200 μL of SD buffer (1x PBS, 0.1% BSA, 0.05% Tween-20). Example antibodies and biotin-labeled or Fc-tag-tagged BCMA and CD3E&G heterodimeric antigens were diluted with SD buffer, and then 200 μL of each diluted sample (100 nM) was added to a 96-well black plate. The probes and samples were placed in an Octet (Fortebio, Red96e). Data Acquisition 10.0 was opened, "New Kinetic Experiment" was selected, the plate was arranged according to the sample location, the sensor positions were selected, and the run steps and times were set: Baseline 60s, Loading 250s, Baseline 100s, Association 600s, and Dissociation 600s. The experimental rotation speed was 1000 rpm and the temperature was 30℃.
[0811] The results were analyzed in the "Data Analysis 10.0" software. The buffer reference channel was deducted, and 1:1 binding was selected to fit the data and calculate the kon, koff, and KD values of the example antibody.
[0812] Antigen information
[0813] Reagent and material information
[0814] The results of the experiments performed as described above are shown in Table 10. The results show that the four example antibodies for B3 have similar affinities to BCMA and CD3 as the F2 antibody.
[0815] Table 10 Affinity of example antibodies as detected by BLI
[0816] ND: not detected
[0817] Example 5. Killing experiment of trispecific antibodies on human multiple myeloma cells and cytokine release.
[0818] When polyclonal antibodies bind to GPRC5D and / or BCMA on the surface of MM cells, and simultaneously bind to CD3E on the surface of primary T cells, they can stimulate T cell activation and mediate tumor cell killing through tumor-associated antigen (TAA, i.e., GPRC5D and / or BCMA)-dependent cross-linking. Because the expression of BCMA and GPRC5D in tumor cells is highly heterogeneous in actual multiple myeloma patients, this specificity manifests in the presence of different subtypes of tumor cells expressing one or more antigens, or in individual differences in the levels of antigens expressed by tumor cells.
[0819] Preparation and flow cytometry of KO cell lines
[0820] H929 ko BCMA and H929 ko GPRC5D were prepared by transfecting H929 cells via RNP. Using the gRNA design website (broadinstitute.org), gRNAs with high MIT specificity scores (Genescript) were selected. Chemically synthesized gRNAs (three for each target protein) were mixed with Cas9 protein (Genscript SC1841 NA) and transfected into cells via electroporation. After stable culture, primers were designed near the gRNA cleavage sites for PCR. The amplified products were sequenced, and the cleavage efficiency was calculated using Sanger sequencing (Genescript) followed by CRISPR analysis to determine the proportion of target gene cleavage. The knockout cell pool was then sorted using a flow cytometry (BD) system to label BCMA and GPRC5D, separating the target protein-negative cell population. Results: The final selected gRNA sequences and the flow cytometry analysis results of the obtained cell lines are shown in the table below and Figure 6.
[0821] Table 11. gRNA sequences selected from the H929 cell line knockout:
[0822] Killing experiments and cytokine release
[0823] To further examine the cytotoxic effect of the example antibody in multiple myeloma, 1) H929 cells expressing a single TAA, namely H929 ko BCMA and H929 ko GPRC5D cells (prepared as described above), and 2) H929 cells (MM cells, Nanjing Kebai, CBP60243) expressing high levels of both TAAs or L363 cells (MM cells, Nanjing Kebai, CBP60240) expressing low levels of both TAAs were co-incubated with PBMCs (Saily, SLB-HP050B) at an effector cell to tumor cell ratio of 10:1. The example antibody and control antibody were added, and after 16 hours, cell death was detected using the lactate dehydrogenase (LDH) release assay. Calu-6 cells (NSCLC cells, Chinese Academy of Sciences Cell Bank, TCHU144), which do not express either antigen, were co-incubated with the corresponding antibody and PBMCs as a control for non-specific killing. 3) H929 KO GPRC5D and H929 KO BCMA cells expressing a single TAA and parental H929 cells expressing two antigens were mixed 1:1:1 and co-incubated with PBMCs. Example antibody and control antibody were added, and the survival rate of target tumor cells was analyzed by flow cytometry after 16 hours. Reagents and materials:
[0824] Experimental procedure: PBMC cells (Saily, SLB-HP050B) were removed from liquid nitrogen and rapidly thawed in a 37°C water bath. They were then added to 9 ml of serum-free culture medium, centrifuged at 300g for 5 min, the supernatant was discarded, and the cells were resuspended in 10% FBS phenol red-free 1640 medium. The cell density was adjusted to 2 × 10⁶ cells / mL. 6 Cells / ml. Collect tumor cells in the logarithmic growth phase and wash twice with PBS to remove excess serum. If flow cytometry detection of cell death is required, add CTV staining solution (1 μM, CellTrace) after MM cell collection. TM Incubate the cells in Violet DMSO stock solution:PBS = 1:50,000; 2E6 cells / mL CTV staining solution at 37°C in the dark for 15 minutes. If using LDH to detect tumor cell death, skip this step and centrifuge directly. Centrifuge at 300×g for 5 minutes, discard the supernatant and retain the cell pellet. Resuspend the cells in phenol red-free medium and adjust the cell density to 4×10⁶ cells / mL. 5Cell / mL. The antibody was serially diluted 10-fold with complete culture medium to obtain 8 concentrations, depending on the cell line. (For H929 cells (including KO cells), the initial concentration was 200 nM, with a maximum final concentration of 50 nM. For L363 and Calu-6, the initial concentration was 400 nM, with a maximum final concentration of 100 nM). A final concentration of 0.96 was added. 50 μL of tumor cells, 50 μL of serially diluted antibody, and 100 μL of PBMC cells were added to each well of a 96-well cell culture plate (U-bottom, COSTAR, Cat. 7007) for co-incubation. If LDH detection of tumor cell death is required, two wells were set up: one containing only 50 μL of tumor cells for spontaneous LDH release from target cells, and another containing 50 μL of tumor cells with Lysis buffer (included in the LDH kit, diluted 1:10) for maximum LDH release from target cells. The volume was then brought to 200 μL / well with complete culture medium. The mixed cells were placed in a CO2 incubator at 37 degrees Celsius and incubated for 16 hours.
[0825] After co-incubation, the cell culture plates were centrifuged at 400g for 5 min. 160 μL of supernatant was aspirated from each well, and 50 μL of supernatant was transferred from each well to a new 96-well plate (Beyotime, Cat. FPT019) for LDH detection. The remaining supernatant was cryopreserved (-80℃) for subsequent cytokine assays. The cell pellet was used for flow cytometry to detect cell death.
[0826] LDH assay for tumor cell death: Add 50 μL of cell supernatant to each well of a 96-well white-background plate, followed by 50 μL of assay solution. Incubate at room temperature in the dark for 10-30 minutes (depending on cell type and reaction color), then add 50 μL of stop solution. Read the absorbance at 492 / 650 nm on a multi-functional microplate reader (SPARK) within 1 hour after adding the stop solution. Wells with 0 concentration antibody and tumor cells and immune cells serve as background; wells with only tumor cells are used as the minimum value; and wells with tumor cells treated with lysis buffer are used as the maximum value. The killing effect is calculated as (sample value - background value) / (maximum value - minimum value).
[0827] Flow cytometry detection of tumor cell death: Add 200 μL of FACS buffer (1XPBS, 2% FBS, 2mM EDTA) to each well of the cell culture plate, wash once, centrifuge, discard the liquid, add 45 μL of DCM staining solution (1:2000 with FACS buffer) to each well, incubate at 4°C in the dark for 20 min, wash once with 200 μL of FACS buffer, fold dry, resuspend in 150 μL of FACS buffer, and analyze by flow cytometry (BD). Kill rate is calculated as DCM. + CTV + Cell count / CTV+ Total number of cells.
[0828] Cisbio cytokine detection: Standards were dissolved in H2O to obtain the Standard Stock solution; a 3-fold dilution was performed using Diluent to obtain Std7 (Standard 7); then a 2-fold serial dilution was performed, resulting in 6 wells (Std1-6), with Std 0 serving as a Diluent blank control. 16 μL of the supernatant was added to each well of a 96-well plate (#66PL96025); 16 μL of the standard was also added to each well. Eu Cryptate and d2antibody were both diluted 1:20 with detection buffer. The two dilutions were mixed 1:1, and 4 μL of the mixture was added to each well. The plate was sealed with sealing film and incubated at room temperature for 2 hours. The emission signal was detected using a multi-mode microplate reader (SPARK); the relative values of cytokine levels were calculated at 665 nm / 620 nm.
[0829] Experimental results: The example antibody can activate and mediate the killing effect of PBMCs on MM cells in a dose-dependent manner (Figures 3A-3O, Tables 12-24).
[0830] 1. The cytotoxicity results of the corresponding antibodies in H929 ko GPRC5D and H929 ko BCMA expressing a single TAA are shown in Figures 3A-3F and Table 12-16. Specific experimental results are as follows:
[0831] The example antibody, like the corresponding antibody control molecule, dose-dependently activated T cells in PBMCs to kill T cells in cells expressing TAA. No killing effect was observed in non-target cells not expressing TAA (Fig. 3P). This indicates that the killing is a specific killing effect dependent on the corresponding TAA. The higher the anti-CD3 terminus affinity of the example antibody, the better its ability to kill tumor cells. Specifically, molecules with an antigen-binding region specifically binding to CD3 containing the heavy chain variable region from sp34.24 (SEQ ID NO: 77) (i.e., marked (24) in the figure) are more potent than molecules with an antigen-binding region specifically binding to CD3 from the heavy chain variable region from sp34.87 (SEQ ID NO: 78) (i.e., marked (87) in the figure).
[0832] In mediating the killing of H929 ko GPRC5D by PBMCs, the example antibodies in the B3, B3b, and B5 forms demonstrated superior ability to mediate tumor cell killing compared to the F2 form. This suggests that the design of B3, B3b, and B5, which avoids scFv, enhances the function of BCMA.
[0833] In mediating the killing of H929 ko BCMA by PBMCs, the ability of example antibodies in the B3 and B5 forms to mediate the killing of tumor cells is close to that of the F2 form and superior to that of the B3b form.
[0834] The above results indicate that the anti-GPRC5D and anti-BCMA ends of the example antibodies in the forms of B3, B5, and B3b can successfully serve as TAA antibodies for TCE and mediate the killing of tumor cells by T cells.
[0835] 2. In H929 and L363 cells that simultaneously express two antigens (Figures 3G-3M, Tables 18-24): the levels of BCMA and GPRC5D on the surface of L363 cells were relatively low; the levels of BCMA and GPRC5D on the surface of H929 cells were relatively high (compared to the antibody disclosed in WO2022174813). Specific results are shown below:
[0836] In H929 cells, as observed above, molecules with a CD3-specific antigen-binding region containing the heavy chain variable region from sp34.24 (SEQ ID NO:77) were more potent than molecules with a CD3-specific antigen-binding region from the heavy chain variable region from sp34.87 (SEQ ID NO:78). Furthermore, the trispecific example antibodies B3(24) and B3-7F5.3(24) showed superior cytotoxicity compared to JNJ's bispecific antibody control molecules, namely JNJ-BCMA / CD3 and JNJ-GPRC5D / CD3, and were slightly weaker or comparable to Roche's bispecific antibody control molecules, namely Roche-GPRC5D and Roche-BCMA / CD3.
[0837] Meanwhile, in the comparison of cytokine release induced during H929 cell killing, there was no significant difference in cytokine release induced by the trispecific example antibody and the control bispecific antibodies, namely JNJ-BCMA / CD3, JNJ-GPRC5D / CD3, and REGN-BCMA / CD3 (Figures 3Q-3R).
[0838] In the absence of target cells, the trispecific example antibody, like the bispecific antibody in the control, namely JNJ-BCMA / CD3, JNJ-GPRC5D / CD3, Roche-GPRC5D / CD3, Roche-BCMA / CD3, and REGN-BCMA / CD3, did not induce nonspecific cytokine release, i.e., the level was comparable to that of the hIgG control (Figures 3S-3T).
[0839] In L363 cells, the exemplary trispecific antibodies B3(24) and B3-7F5.3(24) showed stronger killing power than JNJ's bispecific antibody control molecules (JNJ-BCMA / CD3, JNJ-GPRC5D / CD3) and were comparable to Roche's control bispecific antibody molecules (Roche-GPRC5D / CD3, Roche-BCMA / CD3). When used for killing with control molecules (Inno-B, Inno-G, or Inno-G-7F5.3) respectively, both the anti-GPRC5D and anti-BCMA ends of the exemplary trispecific antibodies of the present invention were effective; when the control BCMA / CD3 and GPRC5D / CD3 bispecific antibody molecules of JNJ and Roche were mixed at a 1:1 ratio and compared with the same concentration of the exemplary trispecific antibody of the present invention, the killing power of the exemplary trispecific antibody of the present invention mediated by it was superior to the combination of the control BCMA / CD3 and GPRC5D / CD3 bispecific antibody molecules. The above results indicate that the anti-GPRC5D and anti-BCMA ends of the trispecific antibody have a synergistic effect on killing tumor cells, which is superior to the combination of two bispecific antibodies.
[0840] 3. After mixing H929 ko GPRC5D and H929 ko BCMA expressing a single TAA with parental H929 cells expressing two antigens in a 1:1:1 ratio, the killing curve of the exemplary trispecific antibody of the present invention was higher than that of the control molecule, that is, its maximum killing ratio was higher than that of the control molecule (Figure 3N, 3O).
[0841] Table 12 Example of antibody-mediated killing effect of PBMCs on H929 ko GPRC5D cells -1, NA indicates Not analyzed.
[0842] Table 13 Example of antibody-mediated killing effect of PBMCs on H929 ko GPRC5D cells -2
[0843] Table 14 Example of antibody-mediated killing effect of PBMCs on H929 ko GPRC5D cells -3
[0844] Table 15 illustrates the antibody-mediated killing effect of PBMCs on H929 ko BCMA cells -1. NA indicates Not analyzed.
[0845] Table 16 illustrates the antibody-mediated killing effect of PBMCs on H929 ko BCMA cells -2. NA indicates Not analyzed.
[0846] Table 17 Example of antibody-mediated killing effect of PBMCs on H929 ko BCMA cells -3. NA indicates Not analyzed.
[0847] Table 18 Example of antibody-mediated killing effect of PBMCs on H929 cells -1.
[0848] Table 19 Example of antibody-mediated killing effect of PBMCs on H929 cells -2.
[0849] Table 20 Example of antibody-mediated killing effect of PBMCs on H929 cells - 3
[0850] Table 21 Example of antibody-mediated killing effect of PBMCs on L363 cells -1.
[0851] Table 22 Example of antibody-mediated killing effect of PBMCs on L363 cells -2.
[0852] Table 23 illustrates the antibody-mediated killing effect of PBMCs on L363 cells -3.
[0853] Table 24 illustrates the antibody-mediated killing effect of PBMCs on L363 cells -4.
[0854] Killing experiment on cells expressing mutant antigens
[0855] Experimental procedure: PBMC cells (Saily, SLB-HP100B) were removed from liquid nitrogen and rapidly thawed in a 37°C water bath. They were then added to 9 ml of serum-free culture medium, centrifuged at 300g for 5 min, the supernatant was discarded, and the cells were resuspended in 10% FBS phenol red-free 1640 medium. The cell density was adjusted to 2 × 10⁶ cells / mL. 6 Cells / ml. Collect tumor cells in the logarithmic growth phase and wash twice with PBS to remove excess serum. Centrifuge the GS CHO cell line overexpressing the BCMA mutant constructed in Example 1 at 300×g for 5 minutes, discarding the supernatant and retaining the cell pellet. Resuspend the cells in phenol red-free medium and adjust the cell density to 4×10⁶ cells / ml. 5The antibody was serially diluted 10-fold using complete culture medium, resulting in eight concentrations (starting at 200 nM and ending at a maximum of 50 nM). A final concentration of 0.90 nM was added. 50 μL of tumor cells, 50 μL of serially diluted antibody, and 100 μL of PBMC cells were added to each well of a 96-well cell culture plate (U-bottom, COSTAR, Cat. 7007) for co-incubation. Two wells were set up for spontaneous LDH release from target cells (containing only 50 μL of tumor cells) and for maximum LDH release from target cells (containing 50 μL of tumor cells added to Lysis buffer (included in the LDH kit, diluted 1:10)). The volume was then adjusted to 200 μL / well with complete culture medium. The mixed cells were incubated at 37°C in a CO2 incubator for 16 hours.
[0856] After co-incubation, the cell culture plates were centrifuged at 400g for 5 min. 160 μL of supernatant was aspirated from each well, and 50 μL of supernatant was transferred from each well to a new 96-well flat-bottom plate (Beyotime, Cat.FPT019) for LDH detection.
[0857] LDH assay for tumor cell death: Add 50 μL of cell supernatant to each well of a 96-well white-background plate, followed by 50 μL of assay solution. Incubate at room temperature in the dark for 10-30 minutes (depending on cell type and reaction color), then add 50 μL of stop solution. Read the absorbance at 492 / 650 nm on a multi-functional microplate reader (SPARK) within 1 hour after adding the stop solution. Wells with 0 concentration antibody and tumor cells and immune cells serve as background; wells with only tumor cells are used as the minimum value; and wells with tumor cells treated with lysis buffer are used as the maximum value. The killing effect is calculated as (sample value - background value) / (maximum value - minimum value).
[0858] Experimental results: B3(24) can dose-dependently activate and mediate the killing effect of PBMC on GS CHO (GS CHO-hBCMA-P34del, GS CHO-hBCMA-S30del, GS CHO-hBCMA-R39A, GS CHO-hBCMA-R27P) overexpressing BCMA mutants; Teclistamab did not have in vitro killing function on BCMA mutants R27P and R39A (Fig. 3U).
[0859] Example 6. Trispecific antibodies overcome the effects of sBCMA
[0860] Soluble BCMA (sBCMA) is a result of cleavage by γ-secretase and detachment from the plasma cell surface. It is elevated in MM patients and associated with adverse clinical outcomes (https: / / www.ncbi.nlm.nih.gov / pmc / articles / PMC5395119 / ). Composed of an extracellular domain and a portion of the transmembrane domain of BCMA, sBCMA not only reduces the density of the target antigen but also provides a soluble decoy that can limit the potency of the BCMA / CD3 molecule. Because it contains the GPRC5D terminus, which is not restricted by sBCMA, the GPRC5D / BCMA / CD3 molecule is theoretically less affected by sBCMA.
[0861] Experimental procedure: Human cryopreserved PBMC cells (SAILY) were removed from liquid nitrogen and rapidly thawed in a 37°C water bath. They were then added to 9 ml of serum-free culture medium, centrifuged at 300 g for 4 min, the supernatant was discarded, and the cells were resuspended in 1% FBS phenol red-free 1640 medium (complete medium). The cell density was adjusted to 4 × 10⁶ cells / year. 6 Cells / ml. Collect cell culture medium into a 50ml sterile centrifuge tube, centrifuge at 300×g for 5 min, discard the supernatant and retain the cell pellet. Adjust the cell density to 4×10⁶ cells / ml using complete culture medium. 5 The antibody was diluted to 200 nM with complete culture medium, followed by 10-fold serial dilutions. Simultaneously, recombinant human BCMA (hBCMA; stock solution 0.5 mg / mL, prepared with PBS) was diluted to 800 ng / mL using complete culture medium to obtain the sBCMA solution. 50 μL of tumor cells (H929), 50 μL of serially diluted antibody, 50 μL of PBMC cells, and 50 μL of sBCMA solution were added to a 96-well cell culture plate (U-shaped, Costa). The co-incubation system contained 200 ng / mL of sBCMA. The plate was incubated at 37°C with CO2 for 16 h. After co-incubation, the cell culture plate was centrifuged at 400 g for 5 min, and 50 μL of supernatant was transferred from each well to a new 96-well flat-bottom plate (Beyotime, Cat. FPT019) for LDH detection. The percentage of CD69-positive T cells was determined by flow cytometry (BD). Cell information is described in Example 5.
[0862] LDH assay for tumor cell death: Add 50 μL of cell supernatant to each well of a 96-well white-background plate, followed by 50 μL of assay solution. Incubate at room temperature in the dark for 10-30 minutes (depending on cell type and reaction color), then add 50 μL of stop solution. Read the absorbance at 492 / 650 nm on a multi-functional microplate reader (SPARK) within 1 hour after adding the stop solution. Wells with 0 concentration antibody and tumor cells and immune cells serve as background; wells with only tumor cells are used as the minimum value; and wells with tumor cells treated with lysis buffer are used as the maximum value. The killing effect is calculated as (sample value - background value) / (maximum value - minimum value).
[0863] Flow cytometry detection of CD8 and CD4 T cell activation: Add 200 μL of FACS buffer (1XPBS, 2% FBS, 2mM EDTA) to each well of the cell culture plate, wash once, centrifuge, discard the liquid, add 45 μL of staining solution (prepared with FACS buffer) to each well, incubate at 4°C in the dark for 20 min, wash once with 200 μL of FACS buffer, drain, resuspend in 150 μL of FACS buffer, and then analyze. Calculate the percentage of CD69-positive cells in CD8 and CD4 T cells.
[0864] Reagents and materials:
[0865] The experimental results are shown in Figures 4A, 4B, and 4C, and Tables 25 and 26. These results indicate that sBCMA has a relatively small impact on T cell activation mediated by the trispecific antibody and its killing effect on H929 cells.
[0866] Table 25 illustrates antibody-mediated T cell activation in PBMCs (w / o: without, w: with).
[0867] Table 26 illustrates antibody-mediated T cell activation in PBMCs (w / o: without, w: with).
[0868] Example 7. Antitumor efficacy of trispecific antibodies in tumor-bearing humanized mouse models
[0869] Female NOG mice (35-48 days old) were purchased from Beijing Virton Laboratories. They were SPF grade mice. After arrival, the mice underwent acclimatization and quarantine for 5-7 days before the start of the study.
[0870] Tumor cells were passaged using standard methods for subsequent in vivo experiments. Cells were collected by centrifugation and dispersed in PBS. PBMC cells were intravenously injected into NOG mice at a density of 4 x 102. 6200 μL / mouse. On day 3 post-PBMC cell inoculation, mice were shaved on the right dorsal and ventral side and subcutaneously inoculated with tumor cells at a volume of 200 μL / mouse (inoculation density: H929 ko BCMA: 4 x 10⁻⁶). 6 Item / each, H929 ko GPRC5D:4x10 6 3 x 101 cells / animal, MM.1S (MM cells, Nanjing Kebai, CBP60239): 6 Individual / piece, L363: 1x10 6 Each mouse was inoculated with tumor cells. On day 7 post-inoculation, mice were grouped according to tumor volume (6-7 mice per group) and administered the drug intraperitoneally (dosage frequency and dosage details are shown in Figure 5 and accompanying illustrations). Tumor volume and body weight were monitored twice weekly. Tumor volume was measured using calipers to determine the maximum long axis (L) and maximum wide axis (W) of the tumor. The tumor volume was calculated using the following formula: V = L × W² / 2. Body weight was measured using an electronic balance. Throughout the study period, mice were euthanized when the tumor reached its endpoint or when they experienced a >20% weight loss. Tumor size was recorded.
[0871] Experimental results:
[0872] H929 ko GPRC5D tumor (Fig. 5A): B3(24) molecule can effectively inhibit the growth of H929 ko GPRC5D cells, and its anti-tumor ability is consistent with that of the JNJ-BCMA / CD3 control molecule. Compared with B3(87) molecule, REGN-BCMA / CD3 molecule and F2(87) molecule are stronger.
[0873] H929 ko BCMA tumor (Fig. 5B): B3(24) molecules can effectively inhibit the growth of H929 ko BCMA cells, and its anti-tumor ability is consistent with that of the JNJ-GPRC5D / CD3 control molecule; its anti-tumor ability is stronger than that of all BCMA / CD3 and (JNJ-GPRC5D / CD3+JNJ-BCMA / CD3) combination; and it is slightly weaker than that of Roche-GPRC5D / CD3 and (Roche-BCMA / CD3+Roche-GPRC5D / CD3) combination.
[0874] MM1S tumor (Figure 5C): Both the example antibody and the control molecule showed good anti-tumor effects.
[0875] L363 tumor (Fig. 5D): B3(24) molecules can effectively inhibit the growth of L363 cells. Its anti-tumor ability is stronger than that of JNJ-GPRC5D / CD3, JNJ-BCMA / CD3 and (JNJ-BCMA / CD3+JNJ-GPRC5D / CD3) combination; and it is closer to that of Roche-GPRC5D / CD3, Roche-BCMA / CD3 and (Roche-GPRC5D / CD3+Roche-GPRC5D / CD3) combination.
[0876] [Revised according to Rule 26 05.11.2025] The B3(24) molecule did not show a difference in effect on mouse body weight compared to other control molecules in all models.
[0877] 2. Antibody sequence originating from the antigen-binding region
[0878] 3. Other sequences
[0879] 4. Specific sequence information
Claims
A trispecific antibody that specifically binds to BCMA, comprising a first antigen-binding region that specifically binds to BCMA, and second and third antigen-binding regions that specifically bind to other antigens. The trispecific antibody of claim 1, wherein the second antigen-binding region specifically binds to CD3, and / or the third antigen-binding region specifically binds to GPRC5D. The trispecific antibody of claim 1 or 2, wherein the first antigen-binding region, the second antigen-binding region, and the third antigen-binding region are respectively the first Fab, the second Fab, and the third Fab. The trispecific antibody of claim 3, wherein (1) The first Fab fuses at the C end of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C end of CH1 of the Fab heavy chain to the CH2 or hinge region of another Fc region of the Fc heterodimer; and the third Fab fuses at the C end of CH1 of the Fab heavy chain to the N end of the VH of the Fab heavy chain of the second Fab fragment. or The third Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of the other Fc region of the Fc heterodimer, and the first Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the N-terminus of the VH of the Fab heavy chain of the second Fab fragment. or (2) The first Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 of the Fab heavy chain to the CH2 or hinge region of the other Fc region of the Fc heterodimer; and the third Fab fuses at the N-terminus of VH of the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab; or The third Fab fuses at the C-terminus of CH1 in the Fab heavy chain to the CH2 or hinge region of one of the Fc regions of the Fc heterodimer; the second Fab fuses at the C-terminus of CH1 in the Fab heavy chain to the CH2 or hinge region of another Fc region of the Fc heterodimer, and the first Fab fuses at the N-terminus of VH in the Fab heavy chain to the C-terminus of the Fc region fused with the second Fab. The trispecific antibody of claim 4, wherein fusion includes direct fusion or fusion via a linker. The trispecific antibody of claim 5, wherein the linker is (GGGGS)n, where n = 1, 2, 3 or 4. The trispecific antibody of any one of claims 3-6, wherein the second Fab contains a charge mutation, and the first or third Fab fused to the second Fab or fused to the second Fab via the Fc region contains a charge mutation and a disulfide bond remodeling mutation. The trispecific antibody of claim 7, wherein the charge mutation is a mutation to D or K at position 39 of VH in Fab and a mutation to K or D at position 38 of VL in Fab, for example The second Fab comprises VH and VL, wherein VH comprises 39D and VL comprises 38K, and The first or third Fab fused with the second Fab via the Fc region comprises VH and VL, wherein the VH comprises 39K and the VL comprises 38D; or The second Fab comprises VH and VL, wherein VH comprises 39K and VL comprises 38D, and The first or third Fab fused with the second Fab via the Fc region includes VH and VL, wherein the VH includes 39D and the VL includes 38K. The trispecific antibody of claim 7 or 8, wherein the disulfide bond remodeling mutation comprises F126C in CH1 of Fab and Q124C in CL of Fab. The trispecific antibody of claim 9, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1, wherein CH1 (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:85, and contains F126C; or (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:
85. The trispecific antibody of claim 9 or 10, wherein the Fab containing the disulfide bond remodeling mutation comprises CL, wherein the CL (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:97, and contains Q124C; or (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:
97. The trispecific antibody of claim 9, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1 and CL, wherein CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:85, and CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:
97. The trispecific antibody of claim 7 or 8, wherein the disulfide bond remodeling mutation comprises F126C and C220S in CH1 of Fab and Q124C and C214S in CL of Fab. The trispecific antibody of claim 13, wherein the Fab containing the disulfide bond remodeling mutation comprises CH1, wherein CH1 (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:86, and includes F126C and C220S; or (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:
86. The trispecific antibody of claim 13 or 14, wherein the Fab containing the disulfide bond remodeling mutation comprises CL, wherein the CL (i) Contains an amino acid sequence having at least 90% identity with the amino acid sequence shown in SEQ ID NO:98, and contains Q124C and C214S; or (ii) Contains or consists of the amino acid sequence shown in SEQ ID NO:
98. The trispecific antibody of claim 13, wherein the Fab containing the disulfide remodeling mutation comprises CH1 and CL, wherein CH1 comprises or is composed of the amino acid sequence shown in SEQ ID NO:86, and CL comprises or is composed of the amino acid sequence shown in SEQ ID NO:
98. The trispecific antibody of any one of claims 1-16, wherein the trispecific antibody comprises a first Fc region and a second Fc region, wherein the first Fc region and the second Fc region are the same or different. The trispecific antibody of claim 17, wherein the first Fc region and the second Fc region are human IgG Fc, for example, human IgG1 Fc, human IgG2 Fc, human IgG3 Fc, or human IgG4 Fc, for example, comprising or consisting of an amino acid sequence SEQ ID NO: 87 or 88 or an amino acid sequence having at least 90% identity with it, for example 95%, 96%, 97%, 99% or higher. The trispecific antibody of claim 18, wherein the first and / or second Fc region contains the L234A / L235A mutation. The trispecific antibody of claim 19, wherein the first and / or second Fc region comprises the amino acid sequence SEQ ID NO:89 or 90; or comprises the amino acid sequence shown in SEQ ID NO:89 or 90 having at least 90% identity, such as 95%, 96%, 97%, 99% or higher identity and comprising amino acid substitutions L234A / L235A. The trispecific antibody of any one of claims 17-20, wherein one of the first and second Fc regions contains a Knob mutation and the other contains a Hole mutation. The trispecific antibody of claim 21, wherein one Fc region comprises amino acid substitution T366W, and the other Fc region comprises amino acid substitutions T366S, L368A, and Y407V (numbered according to EU index). The trispecific antibody of claim 22, wherein one Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:
92. The trispecific antibody of claim 23, wherein one Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:91, and the other Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:
92. The trispecific antibody of claim 17, wherein one Fc region comprises amino acid substitutions L234A / L235A and T366W, and the other Fc region comprises amino acid substitutions L234A / L235A and T366S, L368A and Y407V (numbered according to EU index). The trispecific antibody of claim 25, wherein one Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:94, and the other Fc region polypeptide comprises an amino acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, and 99% identity with the amino acid sequence shown in SEQ ID NO:
93. The trispecific antibody of claim 26, wherein one Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:94, and the other Fc region polypeptide comprises or is composed of the amino acid sequence shown in SEQ ID NO:
93. The trispecific antibody of any one of claims 1-27, wherein the first antigen-binding region specifically binding to BCMA comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3, wherein... HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:57; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:58; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:59; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:61; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:62; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:
63. The trispecific antibody of claim 28, wherein the VH of the first antigen-binding region that specifically binds to BCMA contains the amino acid sequence shown in SEQ ID NO:56 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence. The trispecific antibody of claim 28 or 29, wherein the VL that specifically binds to the first antigen-binding region of BCMA contains the amino acid sequence shown in SEQ ID NO:60 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence. The trispecific antibody of claim 30, wherein the first antigen-binding region specifically binding to BCMA comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:56, and the VL of the first antigen-binding region specifically binding to BCMA consists of the amino acid sequence shown in SEQ ID NO:
60. The trispecific antibody of claim 28, wherein the first antigen-binding region specifically binding to BCMA comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K. For example, VH of the first antigen-binding region (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:76, or (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:76, and contains a Q39K mutation; and / or the VL of the first antigen-binding region (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:75, or (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:75, and contains a Q38D mutation. The trispecific antibody of any one of claims 1-32, wherein the third antigen-binding region specifically binds to GPRC5D and comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3, wherein... HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:41; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:42; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:43; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:45; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:46; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:47; or HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:49; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:50; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:51; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:53; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:54; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:
55. The trispecific antibody of claim 33, wherein it specifically binds to the third antigen-binding region of GPRC5D. VH contains (i) The amino acid sequence shown in SEQ ID NO:40 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or composed of said amino acid sequence; or (ii) The amino acid sequence shown in SEQ ID NO:48 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with it, or composed of said amino acid sequence. The trispecific antibody of claim 33 or 34, wherein the VL that specifically binds to the third antigen-binding region of GPRC5D contains (i) The amino acid sequence shown in SEQ ID NO:44 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or composed of said amino acid sequence; or (ii) The amino acid sequence shown in SEQ ID NO:52 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with it, or composed of said amino acid sequence. The trispecific antibody of claim 35, wherein the third antigen-binding region specifically binding to GPRC5D comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:48 and VL consists of the amino acid sequence shown in SEQ ID NO:52; or VH consists of the amino acid sequence shown in SEQ ID NO:40 and VL consists of the amino acid sequence shown in SEQ ID NO:
44. The trispecific antibody of any one of claims 33-36, wherein the third antigen-binding region specifically binding to GPRC5D comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K, for example... The VH that specifically binds to the third antigen-binding region of GPRC5D (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:80, or (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:80, and contains a Q39K mutation; Furthermore, the VL that specifically binds to the third antigen-binding region of GPRC5D (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:79, or (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:79, and contains a Q38D mutation. The trispecific antibody of any one of claims 1-37, wherein the second antigen-binding region specifically binds to CD3 and comprises a heavy chain variable region VH and a light chain variable region VL, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3, and the light chain variable region comprises LCDR1, LCDR2, and LCDR3, wherein... HCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:65; HCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:66; HCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:67 or 73; LCDR1 contains or is composed of the amino acid sequence of SEQ ID NO:69; LCDR2 contains or is composed of the amino acid sequence of SEQ ID NO:70; and LCDR3 contains or is composed of the amino acid sequence of SEQ ID NO:
71. The trispecific antibody of claim 38, wherein the VH of the second antigen-binding region that specifically binds to CD3 contains the amino acid sequence shown in SEQ ID NO: 64 or 72 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence. The trispecific antibody of claim 38 or 39, wherein the VL of the second antigen-binding region that specifically binds to CD3 contains the amino acid sequence shown in SEQ ID NO:68 or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with it, or is composed of said amino acid sequence. The trispecific antibody of claim 40, wherein the second antigen-binding region specifically binding to CD3 comprises VH and VL, wherein VH consists of the amino acid sequence shown in SEQ ID NO:64 or 72, and the VL of the second antigen-binding region consists of the amino acid sequence shown in SEQ ID NO:
68. The trispecific antibody of any one of claims 38-41, wherein the second antigen-binding region that specifically binds to CD3 comprises VH and VL, and the VH comprises 39K and the VL comprises 38D; or the VH comprises 39D and the VL comprises 38K. The trispecific antibody of claim 42, wherein the VH region specifically binds to the second antigen-binding region of CD3. (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:77 or 78, or (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO: 77 or 78, and contains a Q39D mutation; And the VL that specifically binds to the second antigen-binding region of CD3 (i) Contains or is composed of the amino acid sequence shown in SEQ ID NO:74, or (ii) Contains an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with the amino acid sequence shown in SEQ ID NO:74, and contains a Q38K mutation. The trispecific antibody of any one of claims 3-43 is a left-right asymmetric IgG-like pentamer composed of five polypeptide chains, which is composed of the following polypeptide chains: A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain. A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D. A peptide chain #3 consisting of a Fab heavy chain that specifically binds to BCMA, a Fab heavy chain that specifically binds to CD3, and an Fc domain. A peptide chain #4 containing a Fab light chain that specifically binds to BCMA, and A peptide chain #5 containing a Fab light chain that specifically binds to CD3. The Fab heavy chain of peptide chain 1# and the Fab light chain of peptide chain 2# pair to form the third Fab. The two Fab heavy chains of peptide chain 3# pair with the Fab light chains of peptide chain 4# and peptide chain 5# respectively to form the first and second Fabs. The trispecific antibody of claim 44, wherein Peptide chain 1# contains the amino acid sequence shown in SEQ ID NO:5, or contains amino acids having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:
5. The amino acid sequence, or a sequence composed of said amino acids; Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence; Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence; Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence. The trispecific antibody of claim 44, wherein Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:15, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:15, or is composed of said amino acid sequence; Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:14, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:14, or is composed of said amino acid sequence; Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:3 or 6, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:3 or 6, or is composed of said amino acid sequence; Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence; and / or Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence. The trispecific antibody of any one of claims 1-43 is a left-right asymmetric IgG-like pentamer composed of five polypeptide chains, which is composed of the following polypeptide chains: A peptide chain #1 consisting of a Fab heavy chain that specifically binds to BCMA and an Fc domain. A peptide chain #2 containing a Fab light chain that specifically binds to BCMA. A peptide chain #3 consisting of a Fab heavy chain that specifically binds to GPRC5D, a Fab heavy chain that specifically binds to CD3, and an Fc domain. A peptide chain #4 containing a Fab light chain that specifically binds to GPRC5D, and A peptide chain #5 containing a Fab light chain that specifically binds to CD3. The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the first Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the third and second Fabs. The trispecific antibody of claim 47, wherein Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:11, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:11, or is composed of said amino acid sequence; Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:10, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:10, or is composed of said amino acid sequence; Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:9, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:9, or is composed of said amino acid sequence; Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:8, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:8, or is composed of said amino acid sequence; and / or Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence. The trispecific antibody of any one of claims 1-43 is a left-right asymmetric IgG-like pentamer composed of five polypeptide chains, which is composed of the following polypeptide chains: A peptide chain #1 consisting of a Fab heavy chain that specifically binds to GPRC5D and an Fc domain. A peptide chain #2 containing a Fab light chain that specifically binds to GPRC5D. A peptide chain #3 consisting of a Fab heavy chain that specifically binds to CD3, an Fc domain, and an antigen-binding region of a Fab heavy chain that specifically binds to BCMA. A peptide chain 4# containing a Fab light chain that specifically binds to CD3, and A peptide chain #5 containing a Fab light chain that specifically binds to an antigen-binding region of BCMA. The Fab heavy chain of peptide chain #1 and the Fab light chain of peptide chain #2 pair to form the third Fab. The two Fab heavy chains of peptide chain #3 pair with the Fab light chains of peptide chain #4 and peptide chain #5, respectively, to form the second and first Fabs. The trispecific antibody of claim 49, wherein Peptide chain 1# comprises the amino acid sequence shown in SEQ ID NO:5, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:5, or is composed of said amino acid sequence; Peptide chain 2# comprises the amino acid sequence shown in SEQ ID NO:4, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:4, or is composed of said amino acid sequence; Peptide chain 3# comprises the amino acid sequence shown in SEQ ID NO:7, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:7, or is composed of said amino acid sequence; Peptide chain 4# comprises the amino acid sequence shown in SEQ ID NO:1, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:1, or is composed of said amino acid sequence; and / or Peptide chain 5# comprises the amino acid sequence shown in SEQ ID NO:2, or comprises an amino acid sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the amino acid sequence shown in SEQ ID NO:2, or is composed of said amino acid sequence. A nucleic acid molecule that encodes any one chain of the trispecific antibody of any one of claims 1-50, or that consists of the nucleic acid sequence. An expression vector comprising the nucleic acid molecule of claim 51, such as a pCNDA vector, for example, a pCDNA3.1 expression vector. A host cell comprising the nucleic acid molecule of claim 51 or the expression vector of claim 52, preferably, the host cell is prokaryotic or eukaryotic, such as 293 cells or CHO cells, such as HEK293 cells. A method for preparing a trispecific antibody according to any one of claims 1-50, the method comprising culturing a host cell containing a nucleic acid molecule according to claim 51 or an expression vector according to claim 52 under conditions suitable for chain expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium). An immunoconjugate comprising a trispecific antibody according to any one of claims 1-50. A pharmaceutical composition, drug, or formulation comprising a trispecific antibody of any one of claims 1-50, or an immunoconjugate of claim 55, and optionally a pharmaceutical excipient. A drug combination comprising a trispecific antibody of any one of claims 1-50, or an immunoconjugate of claim 55, and one or more other therapeutic agents, such as chemotherapeutic agents. Methods for preventing or treating cancer in subjects include administering to the subject an effective amount of any of the trispecific antibodies of claims 1-50, or the immunoconjugate of claim 55, or the pharmaceutical composition or formulation of claim 56; or the pharmaceutical combination of claim 57. The method of claim 58, wherein the cancer is a GPRC5D single-positive cancer, a BCMA single-positive cancer, a GPRC5D and BCMA double-positive cancer, or a cancer with low expression of both BCMA and GPCR5D, such as a cancer with low expression of GRPC5D and / or low expression of BCMA (e.g., cancer that recurs after anti-BCMA treatment or anti-GPRC5D treatment). The method of claim 58 or 59, wherein the cancer is a solid tumor or a hematologic malignancy, such as multiple myeloma. The method of any one of claims 58-60, wherein the method further comprises administration in combination with other therapies such as treatment modalities (e.g., surgery or radiotherapy) and / or other therapeutic agents (e.g., chemotherapy agents).