Bioengineered asparaginase fusion proteins

Abstract

Provided are novel recombinant fusion proteins comprising asparaginase portion fused with an albumin-binding portion. The long-acting recombinant fusion proteins are able to deplete both asparagine and glutamine upon administration to a subject in need thereof, enabling these proteins to be used in the treatment of disease treatable by asparagine and / or glutamine depletion, such as gastric cancer, and food treatment.

Description

Bioengineered Asparaginase Fusion ProteinsFIELD OF THE DISCLOSUREThe present disclosure relates to novel recombinant fusion proteins, and more specifically, to fusion proteins comprising asparaginase portion fused with an albumin-binding portion.BACKGROUND OF THE DISCLOSUREAsparaginase is the first amino acid-depleting enzyme to be recognized as a therapeutic drug due to its anti-leukemia effect. It predominantly hydrolyses asparagine with minor coactivity on glutamine. Earlier studies have proven that most leukemia cells are auxotrophic to extracellular asparagine due to the lack of or low expression of asparagine synthase (ASNS) and hence inability produce asparagine on their own. The continuous depletion of asparagine can starve leukemia cells and disrupt their normal cellular functions, leading to cell death.To date, native E. coli asparaginase (EcWT) and Erwinia chrysanthemi asparaginase (ErWT) have been approved by the US Food and Drug Administration (FDA) as the first-line treatment for acute lymphoblastic leukemia (ALL) since 1978 and as the second-line treatment for those who have developed hypersensitivity towards EcWT since 2011, respectively.However, due to the extremely short half-life of asparaginase (ahalf-life of ～1.28 days for EcWT and a half-life of ～0.65 days for ErWT) (Asselin BL, Whitin JC, Coppola DJ, Rupp IP, Sallan SE, Cohen HJ. Comparative pharmacokinetic studies of three asparaginase preparations. J Clin Oncol. Sep 1993; 11 (9) : 1780-1786) , their efficacy in treating ALL is significantly hampered, leading to an increase in their doses or administration frequencies, which in turn increases the development of the anti-drug antibody and the chance of treatment failure.Various techniques, such as PEGylation, are known to extend the half-life of therapeutics. However, a method using PEG has drawbacks in that PEGylation reduces activity of peptide drugs and often produces a low yield due to poor reactivity to peptides with an increasing molecular weight of PEG. For example, reduced specific activity was observed in randomly PEGylated E. coli asparaginase, PEGylated arginine deiminase and PEGylated human arginases (Meneguetti GP, et al. PLoS One. 2019; 14 (2) : e0211951; Ensor CM, et al. Cancer Res. Oct 1 2002; 62 (19) : 5443-5450; Tsui SM, et al. Cancer Cell Int. Apr 17 2009; 9: 9) .Two PEGylated EcWT have been approved by the US FDA and they are available as Oncaspar (PEG-SS-Asp) and CALASP (PEG-SC-Asp) as the first-line treatment of ALL. These products demonstrated prolonged elimination half-lives for asparagine depletion (PEG-SS-Asp: ～5.3 days; PEG-SC-Asp: ～13.4 days) (Angiolillo AL, et al. J Clin Oncol. Dec 1 2014; 32 (34) : 3874-3882; Dinndorf PA, et al. Oncologist. Aug 2007; 12 (8) : 991-998; Li RJ, et al. Clin Cancer Res. Jan 15 2020; 26 (2) : 328-331) . It is noted that this use is limited to the treatment of ALL.Previous studies were carried out to investigate the anti-glioblastoma effect of ErWT in vivo (Chen Q, et al. Oncotarget. Oct 31 2017; 8 (53) : 91052-91066.37) and the anticancer effects of PEG-SS-Asp on advanced solid tumors in clinical trials (Taylor CW, et al. Cancer Chemother Pharmacol. 2001; 47 (1) : 83-88. ) , yet the results showed that they could not inhibit tumor growth satisfactorily in a clinical setting.Gastric cancer (GC) is one of the leading cancers worldwide with high mortality rates. There are only limited curative therapeutic options to treat GC, with surgery and chemotherapy being the most promising treatments. However, these traditional treatments have various adverse side effects and the five-year overall survival rates of patients are extremely low. To improve therapeutic outcomes, targeted therapy and immunotherapy have been launched to specifically interfere with the signaling pathways of gastric cancer cells to stop them from growing and dividing. The most common targeted pathways in GC are human epidermal growth factor receptor 2, programmed cell death protein and vascular endothelial growth factor. Although the Food and Drug Administration (FDA) has approved different therapeutic antibodies, such as trastuzumab, ramucirumab and pembrolizumab, as first-and second-line treatments for GC their efficacies are poor on gastric cancer since only a small portion of patients are HER2 (～ 20%) , VEGF and PD-1 / PD-L1 positive. Therefore, an alternative way to treat GC is urgently needed.There remains to be an unmet need for a long-acting asparaginase with an increased range of applications, as well as an unmet medical need for the treatment of gastric cancer.It is an object of the present disclosure to address or at least partially ameliorate some of the above problems of the current approaches.SUMMARY OF THE DISCLOSUREFeatures and advantages of the disclosure will be set forth in the description which follows, and in part will be obvious from the description, or can be learned by practice of the herein disclosed principles. The features and advantages of the disclosure can be realized and obtained by means of the instruments and combinations particularly pointed out in the appended claims.In accordance with a first aspect of the present disclosure, a fusion protein is provided, comprising at least one asparaginase portion or a functional variant thereof; and an albumin binding domain (ABD) ; in which the at least one asparaginase portion or the functional variant thereof is optionally linked to the albumin binding domain via a linker.In one exemplary embodiment, the asparaginase portion can be derived from Escherichia coli or Erwinia chrysanthemi. Preferably, the asparaginase portion can be derived from Erwinia chrysanthemi.Optionally, the at least one asparaginase can be linked to the albumin domain via a linker.In one exemplary embodiment, the linker is a peptide comprising an amino acid sequence selected from: SGG, GGS, SGGS, SSGGS, GGGGGG, SGGGG, GGGGS, SGGGGS, GGGGGS, SGGGGGS, SGGGGG, GSGGGGS, GGGGGS, SGGGGGGGGGGG, SGGGGGGGS, or SGGGGSGGGGS.In one exemplary embodiment, the linker may be a peptide comprising the sequence (GGGGS) n, wherein n is an integer between and including 1-10. For example, the linker may be a peptide comprising the sequence (GGGGS) 5.In one exemplary embodiment, albumin-binding domain (ABD) present in the fusion protein can be a functional variant.In accordance with a second aspect of the present disclosure, a composition comprising a therapeutically effective amount of the fusion protein of the present disclosure is provided. The composition may further comprise one or more pharmaceutically acceptable carriers.In accordance with a third aspect of the present disclosure, a method for preventing and treating a disease treatable by asparagine and / or glutamine depletion in a subject is provided; the method comprising administering the fusion protein of the present disclosure to the subject. In one exemplary embodiment, the disease that can be treated or prevented by the disclosed fusion protein is cancer. For example, the cancer can be an asparagine-dependent cancer, a glutamine-dependent cancer, or both arginine and glutamine-dependent cancer. For instance, the cancer can be acute lymphoblastic leukemia, a solid tumor, or gastric cancer.In one exemplary embodiment, the disclosed fusion protein can be administered to a subject in need thereof via oral administration, intravenous administration, topical administration, parenteral administration, intraperitoneal administration, intramuscular administration, intrathecal administration, intralesional administration, intracranial administration, intranasal administration, intraocular administration, intracardiac administration, intravitreal administration, intraosseous administration, intracerebral administration, intraarterial administration, intraarticular administration, intradermal administration, transdermal administration, transmucosal administration, sublingual administration, enteral administration, suppository administration, inhaled administration, or subcutaneous administration.Preferably, the disclosed fusion protein can be administered via intravenous administration, oral administration, subcutaneous administration, or intramuscular administration.In one exemplary embodiment, the disclosed fusion protein can be administered in a form selected from the group consisting of pills, capsules, tablets, granules, powders, salts, crystals, liquids, serums, syrups, suspensions, gels, creams, pastes, films, patches, and vapors.In one exemplary embodiment, the disclosed fusion protein can be administered at a dosage of between 0.01 mg / kg and 50 mg / kg to the subject. In one preferred embodiment, the fusion protein can be administered at a dosage of between 0.1 mg / kg and 30 mg / kg to the subject; and in yet another preferred embodiment, the fusion protein can be administered at a dosage of between 1.5 mg / kg and 3.5 mg / kg to the subject.In one exemplary embodiment, the disclosed fusion protein can be administered between 1 and 4 times a month; and in yet another preferred embodiment, the disclosed fusion protein can be administered once every two weeks.In accordance with a four aspect of the present disclosure, a pharmaceutical composition comprising the fusion protein of the present disclosure for preventing or treating a disease treatable by asparagine and / or glutamine depletion in a subject is provided.In one exemplary embodiment, the disease that can be treated or prevented by the disclosed fusion protein is cancer. For example, the cancer can be an asparagine-dependent cancer, a glutamine-dependent cancer, or both arginine and glutamine-dependent cancer. For instance, the cancer can be acute lymphoblastic leukemia, a solid tumor, or gastric cancer.In one exemplary embodiment, the pharmaceutical composition can be formulated for administration via oral administration, intravenous administration, topical administration, parenteral administration, intraperitoneal administration, intramuscular administration, intrathecal administration, intralesional administration, intracranial administration, intranasal administration, intraocular administration, intracardiac administration, intravitreal administration, intraosseous administration, intracerebral administration, intraarterial administration, intraarticular administration, intradermal administration, transdermal administration, transmucosal administration, sublingual administration, enteral administration, suppository administration, inhaled administration, or subcutaneous administration.Preferably, the pharmaceutical composition can be formulated intravenous administration, oral administration, subcutaneous administration, or intramuscular administration.In one exemplary embodiment, the pharmaceutical composition may be provided in a form selected from the group consisting of pills, capsules, tablets, granules, powders, salts, crystals, liquids, serums, syrups, suspensions, gels, creams, pastes, films, patches, and vapors.In one exemplary embodiment, the pharmaceutical composition can be formulated to administer the fusion protein at a dosage of between 0.01 mg / kg and 50 mg / kg to the subject. In one preferred embodiment, the pharmaceutical composition can be formulated to administer the fusion protein at a dosage of between 0.1 mg / kg and 30 mg / kg to the subject; and in yet another preferred embodiment, the pharmaceutical composition can be formulated to administer the fusion protein at a dosage of between 1.5 mg / kg and 3.5 mg / kg to the subject.In accordance with a fifth aspect of the present disclosure, a method for reducing acrylamide formulation in food product is provided; the method comprises treating the food product with the fusion protein of the present disclosure.BRIEF DESCRIPTION OF THE DRAWINGSIn order to describe the manner in which the above-recited and other advantages and features of the disclosure can be obtained, a more particular description of the principles briefly described above will be rendered by reference to specific embodiments thereof which are illustrated in the appended Figures. Understanding that these Figures depict only exemplary embodiments of the disclosure and are not therefore to be considered to be limiting of its scope, the principles herein are described and explained with additional specificity and detail through the use of the accompanying Figures.Preferred embodiments of the present disclosure will be explained in further detail below by way of examples and with reference to the accompanying Figures, in which: -Fig. 1A-1 H depict the protein characterizations of EcWT (green) , ErWT (black) and ABD-ErS5 with (blue) or without (red) binding HSA. Fig. 1A depicts the SDS-PAGE of ABD-ErS5. Fig. 1 B depicts LC / MS spectrum of ABD-ErS5. Fig. 1 C depicts CD spectra of asparaginases. Fig. 1 D depicts the activities of asparaginases on asparagine and glutamine at different pH. Fig. 1 E depicts the enzyme kinetics of asparaginases. Fig. 1 F depicts In vitro serum stability of asparaginases in 60 days. Fig. 1 G depicts the protein expression levels of ASNS on the BGC-823 and MKN-45 cell lines. Fig. 1 H depicts the cell proliferation assays of asparaginases on the BGC-823 and MKN-45 cell lines. Results are shown as mean ± SD of at least three independent experiments and analysed by Student’s t-test (n = 3, *p < 0.05, **p < 0.01, ***p<0.001) .Fig. 2A-C depict the binding ability of ABD-ErS5 with HSA. Fig. 2A shows the native-gel analysis of the binding of ABD-ErS5 with different mole ratios of HSA. Fig. 2B shows the Size-exclusion chromatogram of ABD-ErS5 (red) , HSA (orange) and their mixtures (blue) . Fig. 2C shows Dynamic light scattering analysis on the diameter of HSA (orange) , EcWT (green) , ErWT (black) , ABD-ErS5 with (blue) or without (red) HSA. Results are shown as mean ± SD.Fig. 3A-3L depict the apoptosis induction in MKN-45 cells by ABD-ErS5 in dose-and time-dependent manners. Apoptotic cell death induced by different doses of ABD-ErS5 after 72 h of incubation (Fig. 3A) , 0.22 μg / ml of ABD-ErS5 at different time points (Fig. 3E) and 0.22 μg / ml of ABD-ErS5 with or without z-VAD-FMK (20 mM) after 72 h of incubation (Fig. 3I) , together with their corresponding percentages of total apoptotic cells (Fig. 3B, 3F and 3J) . The protein expression levels of PARP, cPARP and cleaved caspase-3 (Fig. 3C, 3G and 3K) and relative protein expression levels of cPARP / PARP and cleaved caspase-3 shown in bar charts (Fig. 3D, 3H and 3L) . Results are shown as mean ± SD of at least three independent experiments and analysed by Student’s t-test (n = 3, *p < 0.05, **p < 0.01, ***p<0.001) .Fig. 4A-4G depict the S-phase cell cycle arrest and autophagy induced by ABD-ErS5 in MKN-45 cells. Cell cycle arrest induced by different doses of ABD-ErS5 after 72 h of incubation (Fig. 4A) and 0.11 μg / ml of ABD-ErS5 at different time points (Fig. 4B) . Fig. 4C shows the autophagosome formation (green dots) in cells treated with 0.11 μg / ml of ABD-ErS5 and 500 nM rapamycin (positive control) at different time points. The protein expression levels of LC3 I and LC3 II in cells treated with different doses of ABD-ErS5 after 72 h of incubation (Fig. 4D) and 0.11 μg / ml of ABD-ErS5 at different time points (Fig. 4F) , together with their corresponding relative protein expression levels of the ratio of LC3 II / LC3 I presented in bar charts (Fig. 4E and 4G) . Results are shown as mean ± SD of at least three independent experiments and analysed by Student’s t-test (n = 3, *p < 0.05, **p < 0.01, ***p<0.001) .Fig. 5A-5D depict the pharmacodynamics and pharmacokinetics studies of EcWT (green) , ErWT (black) and ABD-ErS5 (red) . BALB / c mice (n = 6) received single intraperitoneal injection of EcWT (30 mg / kg) , ErWT (30 mg / kg) , ABD-ErS5 (1.5 and 3.5 mg / kg) at Day 0. The concentrations of asparagine and aspartic acid (Fig. 5A) , and glutamine and glutamic acid (Fig. 5B) in plasma. Fig. 5C shows the asparagine and glutamine activities of ABD-ErS5 in plasma. Fig. 5D shows the percentage of body weight. Results are shown as mean ± SEM.Fig. 6A-6D depict the anti-tumor effect of ABD-ErS5 in MKN-45 human gastric cancer xenografts in nude mice (n = 6) . Fig. 6A shows the tumor volumes of the control group (biweekly injection of PBS, black) and the treatment group (biweekly injection of ABD-ErS5 with 1.5 mg / kg, red) for 6 weeks. Arrows indicate the time of injection. Data were analysed using Two-way ANOVA with Bonferroni correction. Fig. 6B shows the final tumor weight of the control and the treatment group. Data were analysed using One-way ANOVA. Fig. 6C shows the percentage of body weight. Fig. 6D shows the macroscopic appearance of tumors from the mice. Results are shown as mean ± SEM, *p < 0.05, **p < 0.01, ***p<0.001.Fig. 7A-D depict the multiple administrations of ABD-ErS5 in normal mice. A Biweekly intraperitoneal injection of ABD-ErS5 with 1.5 mg / kg in BALB / c mice (n = 6) for 6 weeks. Arrows indicate the time of injection. Fig. 7A-B show the concentrations of asparagine and glutamine in plasma at different time points respectively. Fig. 7C shows the percentage of body weight. Fig. 7C shows the cumulative incidence of anti-ABD-ErS5 antibodies. All results are shown as mean ± SEM.Fig. 8 depicts the multiple administrations of EcWT and ErWT in normal mice. BALB / c mice were intraperitoneally injected with PBS (control, n = 6) , EcWT (30 mg / kg, n = 4) and ErWT (30 mg / kg, n = 4) twice per week. Arrows indicate the time of injection. The concentrations of asparagine (Fig. 8A) and glutamine (Fig. 8B) in plasma of the control group. The concentrations of glutamine in plasma after the injection of EcWT (30 mg / kg) (Fig. 8C) and ErWT (30 mg / kg) (Fig. 8D) . The concentrations of asparagine in plasma after the injection of EcWT (30 mg / kg) (Fig. 8E) and ErWT (30 mg / kg) (Fig. 8F) . Fig. 8G shows the percentage of body weight. Results are shown as mean ± SEM.Fig. 9 depicts the representative images of H&E stained organs harvested from the control (left) and treatment groups after multiple administrations of ABD-ErS5 with 1.5 mg / kg (right) . Scale bar = 50 μm.DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTSThe present disclosure relates to a derivative of asparaginase enzyme, and more specifically, to a bioengineered fusion proteins comprising an asparaginase enzymic portion and an albumin-binding domain (ABD) , which are optionally fused together via a flexible linker. The present disclosure provides compositions, methods, and uses of these fusion proteins, for example, in the depletion of asparaginase and glutamine amino acids in the subject.Unlike conventional amino acid depletion therapies that focus on single amino acid depletion, the fusion proteins of the present disclosure are able to achieve long-lasting double amino acid depletions due to its extended half-life. The fusion proteins of the present disclosure may be used in the prevention and / or treatment of asparagine-dependent, glutamine-dependent, as well as both arginine and glutamine-dependent disorders, e.g. cancers, without causing undesirable toxicity.As further discussed herein, the fusion proteins of the present disclosure are able to induce MKN-45 gastric cancer cell death through multiple pathways, including apoptosis, autophagy and the dominant anti-cancer effect of S-phase cell cycle arrest (Figs. 3 and 4) . The in vivo anti-tumor effect of the fusion proteins of the present disclosure are further confirmed in MKN-45 xenograft mice model.Therefore, in additional to the treatment of ALL, it is expected that the fusion proteins of the present disclosure are useful for treating solid tumors, e.g., gastric cancer, which is a malignant tumor with limited treatment options and represent an unmet medical need in the current medical field.In another aspect, the fusion proteins of the present disclosure may also be used in the treatment of food products, by preventing the formation of unwanted acrylamide in a safe and effective manner.As described herein, the present disclosure addresses the need in the art for a long-acting asparaginase with a wider range of applications, as well as the need for treatment options for solid tumor, including gastric cancer.Various embodiments of the disclosure are discussed in detail below. While specific implementations are discussed, it should be understood that this is done for illustration purposes only. A person skilled in the relevant art will recognize that other components and configurations may be used without departing from the spirit and scope of the disclosure.DefinitionsIn order for the present invention to be more readily understood, certain terms and phrases are defined below and throughout the specification. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.Unless specifically stated or obvious from context, as used herein, the term "about" is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. "About" can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01 %of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term "about. "The transitional term "comprising, " which is synonymous with "including, " , "containing, " or "characterized by, " is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase "consisting of” excludes any element or step not specified in the claim. The transitional phrase "consisting essentially of” limits the scope of a claim to the specified materials or steps "and those that do not materially affect the basic and novel characteristic (s) " of the claimed invention.By "protein" or "polypeptide" or "peptide" is meant any chain of more than two natural or unnatural amino acids, regardless of post-translational modification (e.g., glycosylation or phosphorylation) , constituting all or part of a naturally-occurring or non-naturally occurring polypeptide or peptide, as is described herein. A "purified" or "biologically pure" nucleic acid or protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.The term “protein” may be used interchangeably with “polypeptide” to refer to a polymer of amino acid residues linked by peptide bonds. Typically, a protein or polypeptide has a minimum length of at least 25 amino acids. The term “polypeptide” and “protein” can encompass a multimeric protein, e.g., a protein containing more than one domain or subunit. The term “peptide” as used herein typically refers to a peptide bond-linked amino acid polymer containing less than 25 amino acids, e.g., between about 4 amino acids and about 25 amino acids in length.Proteins and peptides can be composed of linearly arranged amino acids linked by peptide bonds, whether produced biologically, recombinantly, or synthetically and whether composed of naturally occurring or non-naturally occurring amino acids, are included within this definition. Both full-length proteins and fragments thereof greater than 25 amino acids are encompassed by the definition of protein. The terms also include polypeptides that have co-translational (e.g., signal peptide cleavage) and post-translational modifications of the polypeptide, such as, for example, disulfide-bond formation, glycosylation, acetylation, phosphorylation, lipidation, proteolytic cleavage (e.g., cleavage by metalloproteases) , and the like. Furthermore, as used herein, a “polypeptide” refers to a protein that includes modifications, such as deletions, additions, and substitutions (generally conservative in nature as would be known to a person in the art) to the native sequence, as long as the protein maintains the desired activity. These modifications can be deliberate, as through site-directed mutagenesis, or can be accidental, such as through mutations of hosts that produce the proteins, or errors due to PCR amplification or other recombinant DNA methods. Polypeptides or proteins are composed of linearly arranged amino acids linked by peptide bonds, but in contrast to peptides, has a well-defined conformation. Proteins, as opposed to peptides, generally consist of chains of 25 or more amino acids. For the purposes of the present invention, the term “peptide” as used herein typically refers to a sequence of amino acids of made up of a single chain of D-or L-amino acids or a mixture of D-and L-amino acids joined by peptide bonds. Generally, peptides contain at least two amino acid residues and are less than about 25 amino acids in length.It will be appreciated that proteins, polypeptides, or peptides often contain amino acids other than the 20 amino acids commonly referred to as the 20 naturally occurring amino acids (e.g., synthetic non-native amino acids) , and that many amino acids, including the terminal amino acids, can be modified in a given polypeptide, either by natural processes such as glycosylation and other post-translational modifications, or by chemical modification techniques which are well known in the art. Known modifications which can be present in polypeptides of the present invention include, but are not limited to, acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a polynucleotide or polynucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cystine, formation of pyroglutamate, formulation, gamma-carboxylation, glycation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.The term “variant” or “mutant” refers to a polypeptide or nucleic acid that differs from the naturally occurring polypeptide or nucleic acid by one or more amino acid or nucleic acid deletions, additions, substitutions or side-chain modifications, yet retains one or more specific functions or biological activities of the naturally occurring molecule Amino acid substitutions include alterations in which an amino acid is replaced with a different naturally-occurring or a non-conventional amino acid residue. Such substitutions may be classified as “conservative, ” in which case an amino acid residue contained in a polypeptide is replaced with another naturally occurring amino acid of similar character either in relation to polarity, side chain functionality or size. Substitutions encompassed by variants and mutants as described herein may also be “non-conservative, ” in which an amino acid residue which is present in a peptide is substituted with an amino acid having different properties (e.g., substituting a charged or hydrophobic amino acid with alanine) , or alternatively, in which a naturally-occurring amino acid is substituted with a non-conventional amino acid. Also encompassed within the term “variant” or “mutants” when used with reference to a polynucleotide or polypeptide, are variations in primary, secondary, or tertiary structure, as compared to a reference polynucleotide or polypeptide, respectively (e.g., as compared to a wild-type polynucleotide or polypeptide) .Variants or mutants can include conservative or non-conservative amino acid changes, as described below. Polynucleotide changes can result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence. Variants can also include insertions, deletions or substitutions of amino acids, including insertions and substitutions of amino acids and other molecules) that do not normally occur in the peptide sequence that is the basis of the variant, for example but not limited to insertion of ornithine which do not normally occur in human proteins. “Conservative amino acid substitutions” result from replacing one amino acid with another that has similar structural and / or chemical properties. Conservative substitution tables providing functionally similar amino acids are well known in the art. For example, the following six groups each contain amino acids that are conservative substitutions for one another: (1) Alanine (A) , Serine (S) , Threonine (T) ; (2) Aspartic acid (D) , Glutamic acid (E) ; (3) Asparagine (N) , Glutamine (Q) ; (4) Arginine (R) , Lysine (K); (5) Isoleucine (I) , Leucine (L) , Methionine (M) , Valine (V) ; and (6) Phenylalanine (F) , Tyrosine (Y) , Tryptophan (W) . See, e.g., Creighton, PROTEINS (W. H. Freeman &Co., 1984) . The choice of conservative amino acids may be selected based on the location of the amino acid to be substituted in the peptide, for example if the amino acid is on the exterior of the peptide and exposed to solvents, or on the interior and not exposed to solvents. In some embodiments, polypeptides including non-conservative amino acid substitutions are also encompassed within the term “variants. ” As used herein, the term “non-conservative” substitution refers to substituting an amino acid residue for a different amino acid residue that has different chemical properties. Non-limiting examples of non-conservative substitutions include aspartic acid (D) being replaced with glycine (G) ; asparagine (N) being replaced with lysine (K) ; and alanine (A) being replaced with arginine (R) . Selection of such conservative and non-conservative amino acid substitutions is within the skill of one of ordinary skill in the art.The term “derivative” refers to proteins or peptides which have been chemically modified, for example by ubiquitination, labeling, pegylation (derivatization with polyethylene glycol) or addition of other molecules. A molecule is also a “derivative” of another molecule when it contains additional chemical moieties not normally a part of the molecule. Such moieties can improve the molecule's solubility, absorption, biological half-life, etc. The moieties can alternatively decrease the toxicity of the molecule, or eliminate or attenuate an undesirable side effect of the molecule, etc. Moieties capable of mediating such effects are disclosed in REMINGTON'S PHARMACEUTICAL SCIENCES (21st ed., Tory, ed., Lippincott Williams &Wilkins, Baltimore, Md., 2006) .The term “functional” when used in conjunction with “derivative” or “variant” refers to a protein molecule which possesses a biological activity that is substantially similar to a biological activity of the entity or molecule of which it is a derivative or variant.The term “functional portion” or “functional fragment” refers to a portion of the native molecule (e.g., the native protein or receptor binding moiety of a chemical entity) that mediates the same effect as the full-length molecule, e.g., stimulates a cell response such as growth or affects a signal or signal cascade related to a desired physiological effect.The terms “homologous” or “homologues” are used interchangeably, and when used to describe a polynucleotide or polypeptide, indicate that two polynucleotides or polypeptides, or designated sequences thereof, when optimally aligned and compared, for example using BLAST, version 2.2.14 with default parameters for an alignment are identical, with appropriate nucleotide insertions or deletions or amino-acid insertions or deletions, typically in at least 70%of the nucleotides of the nucleotides for high homology. For a polypeptide, there should be at least 30%of amino acid identity in the polypeptide, or at least 50%for higher homology. The term “homolog” or “homologous” as used herein also refers to homology with respect to structure. Determination of homologs of genes or polypeptides can be easily ascertained by the skilled artisan. When in the context with a defined percentage, the defined percentage homology means at least that percentage of amino acid similarity. For example, 85%homology refers to at least 85%of amino acid similarity.As used herein, the term “fused” means that at least one protein or peptide is physically associated with a second protein or peptide. In some embodiments, fusion is typically a covalent linkage, however, other types of linkages are encompassed in the term “fused” include, for example, linkage via an electrostatic interaction, or a hydrophobic interaction and the like. Covalent linkage can encompass linkage as a fusion protein or chemically coupled linkage, for example via a disulfide bound formed between two cysteine residues.As used herein, the term “fusion polypeptide” or “fusion protein” means a protein created by joining two or more polypeptide sequences together. The fusion polypeptides encompassed in this invention include translation products of a chimeric gene construct that joins the DNA sequences encoding the Erwinia chrysanthemi Asparaginase (ErWT) or mutants thereof, with the DNA sequence encoding an albumin-binding domain to form a single open-reading frame. In other words, a “fusion polypeptide” or “fusion protein” is a recombinant protein of two or more proteins which are joined by a peptide bond or via several peptides. The fusion protein may also comprise a peptide linker between the ErWT peptide and albumin binding domain (ABD) .The term “linker” refers to any means, entity or moiety used to join two or more entities. A linker can be a covalent linker or a non-covalent linker. Examples of covalent linkers include covalent bonds or a linker moiety covalently attached to one or more of the proteins to be linked. The linker can also be a non-covalent bond, e.g. an organometallic bond through a metal center such as platinum atom. For covalent linkages, various functionalities can be used, such as amide groups, including carbonic acid derivatives, ethers, esters, including organic and inorganic esters, amino, urethane, urea and the like. To provide for linking, the effector molecule and / or the probe can be modified by oxidation, hydroxylation, substitution, reduction etc. to provide a site for coupling. Linkers can be acid cleavable, photocleavable and heat sensitive linkers. Methods for conjugation are well known by persons skilled in the art and are encompassed for use in the present invention.The term “recombinant” when used to describe a nucleic acid molecule, means a polynucleotide of genomic, cDNA, viral, semisynthetic, and / or synthetic origin, which, by virtue of its origin or manipulation, is not associated with all or a portion of the polynucleotide sequences with which it is associated in nature. The term recombinant as used with respect to a peptide, polypeptide, protein, or recombinant fusion protein, means a polypeptide produced by expression from a recombinant polynucleotide. The term recombinant as used with respect to a host cell means a host cell into which a recombinant polynucleotide has been introduced. Recombinant is also used herein to refer to, with reference to material (e.g., a cell, a nucleic acid, a protein, or a vector) that the material has been modified by the introduction of a heterologous material (e.g., a cell, a nucleic acid, a protein, or a vector) .The term “vectors” refers to a nucleic acid molecule capable of transporting or mediating expression of a heterologous nucleic acid to which it has been linked to a host cell; a plasmid is a species of the genus encompassed by the term “vector. ” The term “vector” typically refers to a nucleic acid sequence containing an origin of replication and other entities necessary for replication and / or maintenance in a host cell. Vectors capable of directing the expression of genes and / or nucleic acid sequence to which they are operatively linked are referred to herein as “expression vectors” . In general, expression vectors of utility are often in the form of “plasmids” which refer to circular double stranded DNA molecules which, in their vector form are not bound to the chromosome, and typically comprise entities for stable or transient expression or the encoded DNA. Other expression vectors that can be used in the methods as disclosed herein include, but are not limited to plasmids, episomes, bacterial artificial chromosomes, yeast artificial chromosomes, bacteriophages or viral vectors, and such vectors can integrate into the host's genome or replicate autonomously in the particular cell. A vector can be a DNA or RNA vector. Other forms of expression vectors known by those skilled in the art which serve the equivalent functions can also be used, for example self-replicating extrachromosomal vectors or vectors which integrates into a host genome. Preferred vectors are those capable of autonomous replication and / or expression of nucleic acids to which they are linked.In some embodiments, fusion proteins can be produced, for example, by a nucleic acid sequence encoding one protein is joined to the nucleic acid encoding another protein such that they constitute a single open-reading frame that can be translated in the cells into a single polypeptide harboring all the intended proteins. The order of arrangement of the proteins can vary.By "substantially identical" is meant a polypeptide or nucleic acid molecule exhibiting at least 50%identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein) . Preferably, such a sequence is at least 60%, more preferably 80%or 85%, and more preferably 90%, 95%or even 99%identical at the amino acid level or nucleic acid to the sequence used for comparison.The term "subject" or “individual” as used herein includes all members of the animal kingdom prone to suffering from the indicated disorder. In some aspects, the subject is a mammal, and in some aspects, the subject is a human. The methods are also applicable to companion animals such as dogs and cats as well as livestock such as cows, horses, sheep, goats, pigs, and other domesticated and wild animals.A subject "suffering from or suspected of suffering from" a specific disease, condition, or syndrome has a sufficient number of risk factors or presents with a sufficient number or combination of signs or symptoms of the disease, condition, or syndrome such that a competent individual would diagnose or suspect that the subject was suffering from the disease, condition, or syndrome. Methods for identification of subjects suffering from or suspected of suffering from conditions associated with heart disease, neurodegenerative disorders, and the like is within the ability of those in the art. Subjects suffering from, and suspected of suffering from, a specific disease, condition, or syndrome are not necessarily two distinct groups.As used herein, "susceptible to" or "prone to" or "predisposed to" or "at risk of developing" a specific disease or condition refers to an individual who based on genetic, environmental, health, and / or other risk factors is more likely to develop a disease or condition than the general population. An increase in likelihood of developing a disease may be an increase of about 10%, 20%, 50%, 100%, 150%, 200%, or more.The terms "treat, " treating, " "treatment, " and the like as used herein refer to the administration of an agent or formulation to a clinically symptomatic individual afflicted with an adverse condition, disorder, or disease, so as to effect a reduction in severity and / or frequency of symptoms, eliminate the symptoms and / or their underlying cause, and / or facilitate improvement or remediation of damage. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.The terms " prevent" , "preventing" , "prevention" , "prophylactic treatment" and the like refer to the administration of an agent or composition to a clinically asymptomatic individual who is at risk of developing, susceptible, or predisposed to a particular adverse condition, disorder, or disease, and thus relates to the prevention of the occurrence of symptoms and / or their underlying cause.Unless specifically stated or obvious from context, as used herein, the term "or" is understood to be inclusive. Unless specifically stated or obvious from context, as used herein, the terms "a" , "an" , and "the" are understood to be singular or plural.As used herein in the specification and in the claims, the phrase “at least one, ” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified.It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.Other features and advantages of the invention will be apparent from the following description of the preferred embodiments thereof, and from the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All other published references, documents, manuscripts and scientific literature cited herein are incorporated herein by reference. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.One aspect of the present disclosure relates to a derivative of asparaginase enzyme, structurally modified to achieve a prolonged elimination half-life upon administration to a subject in need thereof. The significant prolonged elimination half-live of the fusion protein enables the fusion protein to exert its dual enzymatic activities on asparagine and glutamine, expanding the therapeutic applications of the asparaginase enzyme in an unexpected manner.In an embodiment, a bioengineered fusion protein comprising an asparaginase (ASNase) portion and an albumin-binding domain (ABD) is provided. The asparaginase and the albumin-binding domain are fused together to form an artificial construct. The two elements may be optionally linked via a flexible linker.The asparaginase portion may be a non-modified, native enzyme (e.g., L-asparaginases; L-ASNase) or a functional variant thereof. The asparaginase portion can be synthetically made or derived from various sources, such as, human, guinea pig, Saccharomyces cerevisiae, Escherichia coli or Erwinia chrysanthemi. In an embodiment, the asparaginase portion comprises the amino acid sequence of L-asparaginase derived from human (hASNase1) (UNIPROT entry Q86U10) , guinea pig (gpASNase1) (UNIPROT entry H0W0T5) , S. cerevisiae (ScASNase1) (Uniprot number P38986) , E. coli (EcASNase2) (Uniprot number P00805) , or E. chrysanthemi (EwASNase2) (Uniprot number P06608) , such as the sequences as shown below:The L-asparaginase may be Type I L-asparaginase or Type II L-asparaginase. L-ASNase from E. coli exist in two types: Type I &II enzymes. Type I is cytoplasmic and has a higher KM for asparagine, type II is periplasmic and has a lower KM. In an embodiment, L-ASNase type II from Escherichia coli (EcASNase2) and Erwinia chrysanthemi (EwASNase2) can be used in forming the fusion protein of the present disclosure. It is known that the yeast Saccharomyces cerevisiae has the ASP1 gene responsible for encoding L-asparaginase 1 (ScASNase1) , an enzyme predicted as type II, like bacterial therapeutic isoforms.Guinea pig L-asparaginase (gpASNase1) and human L-asparaginase 1 (hASNase1) share ～70%amino-acid identity. The KM for asparagine of this human L-asparaginase is in the millimolar range, similar to that of the E. coli type I, and as such human L-asparaginase 1 (hASNase1) is used in forming the disclosed fusion protein according to a preferred embodiment of the present disclosure.In an embodiment, the asparaginase (ASNase) portion is derived from Erwinia chrysanthemi, and is described as ErWT herein (also known as ErAII, crisantaspase) .The albumin-binding domain is a protein domain with three helix structures found in various surface proteins expressed by Gram positive bacteria. The albumin binding protein derived from Streptococcal protein G has 214 amino acids and contains three albumin binding domains (ABD1-3) , which are used to bind to human serum albumin and evade the immune system of a host. In one embodiment, the albumin-binding domain is ABD3, which corresponds to a 46 amino acid sequence, which has been demonstrated to bind to human serum albumin and has been the subject of a number of studies and affinity maturation for human serum albumin to develop. The amino acid sequence of ABD3 and ABD094 are set forth below:LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID No. 1)LAEAKEAANAELDSYGVSDFYKRLIDKAKTVEGVEALKDAILAALP (SEQ ID No. 2)Other artificial or native ABD polypeptides with differing properties, such as binding affinity and binding selectivity are known from previous studies, and may also be adopted in the present disclosure.Albumin binding proteins may also be found in other bacteria. For example, naturally occurring albumin binding proteins include certain surface proteins from Gram positive bacteria, such as Streptococcal M proteins (e.g. M1 / Emml, M3 Emm3, M12 / Emm12, EmmL55 / Emm55, Emm49 / EmmL49 and Protein H) , streptococcal proteins G, MAG and ZAG, and PPL and PAB from certain strains of Finegoldia magna. As would be appreciated by those skilled in the art, variants of ABD may also be adopted in the fusion protein of the present disclosure.In an embodiment, the asparaginase portion is linked to the albumin domain via one or more linkers, such as a flexible linker. Exemplary peptide linkers include linkers containing poly-glycine, (GS) n, and (GGS) n, wherein n is 1-30 Additional exemplary peptide linkers include flexible linkers (e.g., (G4S) n, wherein n=1-4) , or rigid linkers (e.g., the alpha-helical linker [A (EAAAK) nA] x, wherein n=2-4 and x=1 or 2; and XPn, wherein X is either A, K or E and n=1-10) . In certain embodiments, the peptide linker is (A (EAAAK) 4ALEA- (EAAAK) 4A) , G4SG4SG3SG, GS(N) nGSG, where n=1-10, and GS (Q) nGSG, where n=1-10, and the like. As would be appreciated by those skilled in the art, one advantage of such as flexible linker is that flexibility may be required to obtain proper orientation of the bioactive portion of the molecule with respect to its cognate receptor. However, flexible linkers provide limited amount of space between the fusion partner and the bioactive protein.In another embodiment, the linker can be a peptide comprising an amino acid sequence selected from: SGG, GGS, SGGS, SSGGS, GGGGGG, SGGGG, GGGGS, SGGGGS, GGGGGS, SGGGGGS, SGGGGG, GSGGGGS, GGGGGS, SGGGGGGGGGGG, SGGGGGGGS, or SGGGGSGGGGS. In yet another embodiment, the linker is a peptide comprising the sequence GGGGS, and in a preferred embodiment, the linker is represented by (GGGGS) n, wherein n is an integer of 1-10. In yet another preferred embodiment, the linker is (GGGGS) 5.In one embodiment, the albumin-binding domain (ABD) and the linker (if present) are fused to either the C-or N-terminus of asparaginase. In a preferred embodiment, the albumin-binding domain (ABD) and the linker (if present) are fused to the N-terminal of asparaginase. For example, the fusion protein may be represented by the formula of [ABD –linker –asparaginase] , [asparaginase –linker –ABD] , or [ABD –linker –asparaginase –linker –ABD] . In an exemplary embodiment, the fusion protein may be represented by the formula of [ABD –linker –asparaginase] .In one embodiment, the fusion protein comprises an asparaginase (ASNase) derived from Erwinia chrysanthemi and an albumin-binding domain, fused together via the linker of (GGGGS) 5. This novel recombinant fusion protein is described herein as ABD-ErS5, which comprises the amino acid sequence as set forth below (with ABD underlined) :ABD-ErS5 can also be provided without the His tag, with the amino acid sequence as set forth below:In one embodiment, there is provided a composition comprising the disclosed fusion protein, which may further comprise one or more pharmaceutically acceptable carrier or excipient. In another embodiment, there is provided a vector comprising a nucleic acid encoding at least one asparaginase (ASNase) portion and an albumin-binding domain (ABD) . Preferably, the vector further comprises at least one nucleic acid sequence encoding at least one linker, present in between the ASNase portion and the ABD. In an embodiment, the linker comprises the sequences as described above. In a preferred embodiment, the linker is (GGGGS) 5.The fusion proteins of the present disclosure are produced as a homogenous product through the E. coli expression system. As illustrated in Fig. 1 and 2 and Tables 1-3, the fusion proteins of the present disclosure are able to retain the physical and biological functions of native asparaginases, displaying similar secondary structures and melting temperatures.In an embodiment, the present disclosure provides a long-acting bioengineered fusion protein that is able to provide a long-lasting therapeutic effect. As illustrated in Table 4, in the presence of albumin binding domain (ABD) , the drug elimination half-life of the disclosed fusion protein is found to be ～18-fold longer compared to native Escherichia coli asparaginase (ErWT) , and the increase is found to be dose-dependent.As described in the Examples and illustrated in Fig. 2, the albumin-binding domain of the disclosed fusion protein is able to bind to serum albumin to form a large complex (HSA -fusion protein complex) , which can bind to FcRn for recycling. In an exemplary embodiment, HSA-ABD-ErS5 exhibits a diameter of 16.9 nm based on the analysis of dynamic light scattering. The increased size enables the complex to avoid renal clearance and escapes from the attack of antibodies, resulting in a remarkably prolonged elimination half-life of disclosed fusion proteins. Due to its prolonged elimination half-life, the administration frequency of the long-acting fusion protein can be potentially reduced to 1-4 times a month, which in turn is expected to increase patient compliance.Based on apoptosis assay, it is found that the disclosed fusion proteins induce MKN-45 gastric cancer cell death through multiple pathways, including apoptosis, autophagy and the dominant anti-cancer effect of S-phase cell cycle arrest.As further described in Example 6, comparative studies were carried out to compare the pharmacodynamics and pharmacokinetics of the disclosed fusion protein and the native asparaginases, by comparing the levels of asparagine, glutamine, aspartic acid and glutamic acid in mice treated with single intraperitoneal (i. p. ) injection of different doses of asparaginases. Unlike the injection of native EcWT and ErWT (30 mg / kg) which could only maintain low levels of asparagine for 2 days and glutamine for < 1 day, a fusion protein of the present disclosure is able to deplete both asparagine and glutamine %to extremely low levels at concentration of both 10 mg / kg and 30 mg / kg (results not shown) .Following this surprising discovery, fusion protein was tested at even lower concentrations of 1.5 mg / kg and 3.5 mg / kg so as to minimize any associated adverse effect. As illustrated in Example 6, injections of 1.5 mg / kg and 3.5 mg / kg of the disclosed fusion protein could simultaneously achieve a low level of asparagine for ～15 and ～23 days, and a low level of glutamine for ～11 and ～19 days, respectively. The long-lasting double amino acid depletion effect is particularly unexpected given the known challenges in constructing a fusion protein with double amino acid depletion effect without interrupt its co-activities.Furthermore, it was surprisingly found that a dosage of as low as 1.5 mg / kg of the fusion protein is able to provide a desired efficacy without significantly affecting the body weight. This dose was not only ～20-fold lower than ErWT but also increased the duration of depleting asparagine and glutamine in the bloodstream to ～14 days (i.e., 2 weeks) . As would be appreciated by those skilled in the art, the reduced dose of fusion protein is associated with fewer side effects and reduces the chance of the development of anti-drug antibodies.Accordingly, the elimination half-life on asparagine of the disclosed fusion protein is found to be as good as those of PEG-SS-Asp (～5.73 days) (Angiolillo AL et al. J Clin Oncol. Dec 1 2014; 32 (34) : 3874-3882) . More importantly, unlike PEG-SS-Asp which is unable to achieve glutamine depletion (Asselin BL, J Clin Oncol. Sep 1993; 11 (9) : 1780-1786) , the disclosed fusion protein is able to deplete glutamine at low concentrations.As demonstrated in Example 7, a bi-weekly administration of the disclosed fusion protein significantly suppressed the tumor growth in an MKN-45 human gastric cancer xenograft model, demonstrating a novel approach for treating a solid tumor by the depletion of asparagine and glutamine.Further studies were carried out to access the immunogenicity of the disclosed fusion protein as immunogenicity and acute toxicity are the major drawbacks of therapeutics. As detailed in Example 8, fusion protein of the present disclosure was applied to normal mice based on the same dose and injection frequency as Example 7. It was found that 66.7%of mice could maintain double amino acid depletions yet 83.3 %of mice developed anti-ABD-ErS5 antibodies at the end of the experiment (Figs. 7A, 7B and 7D) . As compared with the results as shown in Fig. 8E and 8F, this outcome was much better than the multiple administrations of EcWT and ErWT, which were inactive at an early stage. It is therefore believed that the ABD part of fusion protein is able to bind to serum albumin, and therefore, played a protective role against the attack of anti-ABD-ErS5 antibodies and remained active for a longer time in the bloodstream.Furthermore, it is observed that body weight loss associated with injection can be safely reversed (Fig. 7C) , and organs harvested from treated mice displayed normal wet weight values. Microscopic investigations revealed no noticeable histopathological abnormalities on key organs in mice following multiple administrations of the disclosed fusion protein, suggesting the absence of acute toxicity to the mice. These results confirm that the fusion protein as disclosed herein are able to achieve long-lasting simultaneous double amino acid depletions in a safe manner with minimal toxicity; and as such, the disclosed fusion proteins demonstrated great potential for the treatment of a wide range of cancers, such as, gastric cancer.Although previous studies have demonstrated the potential of albumin binding to achieve longer half-lives of therapeutic proteins, the design of an effective fusion proteins with a desired efficacy is often challenging. Fusion of the ABD polypeptide to the protein therapeutic has the potential to affect both the efficacy of the protein therapeutic, the binding affinity of the ABD polypeptide, and the solubility of the resulting fusion protein. Accordingly, the selection of the ABD polypeptide, the site of attachment, and the construction of any necessary linkers is a complex process and the presently reported long-lasting double amino acid depletion effect the disclosed fusion protein is therefore unexpected.Similarly, it is well known that the selection of linkers (such as the linker type, length, flexibility, and fusion of the bioactive peptide or protein to the C or N terminus of the half-life-extension module) can have profound effects on the activity of a fusion protein. In some embodiments of the present disclosure, asparaginases were fused to ABD molecules via a suitable linker. As reported in the Examples, both the asparaginase enzymatic activity and the albumin binding ability of ABD are retained in these fusion proteins, whilst good stability and solubility were also observed.In view of the known challenges in obtaining a long-acting, stable and non-toxic enzyme, the presently reported results are remarkable and it is thought may be attributable to the particular selection of ABD and / or linker. Unlike the common HSA or Fc fusions, very little is known about the ABD fusions.The present disclosure provides non-limiting examples of the linker design that can be used to generate functional asparaginase-ABD fusions. The activity of the engineered asparaginase fusion proteins have been optimized in the present disclosure either through linker engineering or the position of the bioactive protein (asparaginase) with respect to the half-life-extension module (ABD) , or both.Another aspect of the present disclosure relates to compositions, methods, and uses of the disclosed fusion proteins, for example, for the treatment of a disease treatable by asparagine and / or glutamine depletion in a subject in need thereof. In an embodiment, the disclosed fusion proteins are useful for the depletion of asparaginase and / or glutamine amino acids in a subject in need thereof. For example, the fusion proteins or compositions comprising such fusion proteins can be used in the prevention or treatment of cancers, such as those that are asparagine-dependent, glutamine-dependent, or dependent on both arginine and glutamine.For instance, the fusion proteins and compositions comprising said fusion proteins are particularly useful in the treatment of acute lymphoblastic leukemia and solid tumors. Importantly, as demonstrated by the results in Example 7 described herein, the fusion protein of the present disclosure may be used in the prevention or treatment of gastric cancer.In an embodiment, the present disclosure provides a method of treating for preventing and treating a disease treatable by asparagine and / or glutamine depletion in a subject, the method comprising administering to said subject an effective amount of the fusion protein described herein, the fusion protein being prepared by the process described herein. In some embodiments, the diseases treatable by asparagine and / or glutamine depletion can be obesity, type II diabetes, fatty liver, an autoimmune disease, or a metabolic disease.In some embodiments, the disease treatable by asparagine and / or glutamine depletion is a cancer.In an embodiment, the cancer is a non-solid cancer, and the non-solid cancer is leukemia or non-Hodgkin's lymphoma. In yet another embodiment, said leukemia is lymphoblastic lymphoma (LBL) , acute lymphoblastic leukemia (ALL) or acute myeloid leukemia (AML) .In an embodiment, the cancer treatable by the disclosed fusion protein is a solid tumor and optionally may be associated with obesity or being overweight. The cancer may be selected from the group consisting of adenocarcinoma of the esophagus, breast cancer, gastric cancer, colon and rectum cancer, uterus cancer, gallbladder cancer, stomach cancer, kidney cancer, liver cancer, ovarian cancer, pancreatic cancer, thyroid cancer, meningioma (atype of brain cancer) , multiple myeloma.In a preferred embodiment, the cancer is a solid tumor selected from the group consisting of gastric cancer, endometrial cancer, esophageal adenocarcinoma, liver cancer, kidney cancer, multiple myeloma, meningioma, pancreatic cancer, colorectal cancer, gallbladder cancer, breast cancer, ovarian cancer, thyroid cancer, prostate cancer, melanoma, skin cancer, sarcoma, brain cancer, and lung cancer.Gastric cancer is a common malignant tumor with a high incidence in China and the second leading cause of cancer-related deaths worldwide. Due to a lack of treatment options, there is an unmet medical need in providing an effective treatment of gastric cancer. As such, it is envisaged that the present disclosed fusion protein can alleviate symptoms associated with gastric cancer and is invaluable in providing a treatment option for individual suffering from gastric cancer.The fusion protein of the present disclosure may be administrated after being formulated into various oral or non-oral administration forms as the following in case of clinical administration, but is not limited thereof.The fusion protein can be administered to humans and other animals for therapy by any suitable route of administration, including oral administration, intravenous administration, topical administration, parenteral administration, intraperitoneal administration, intramuscular administration, intrathecal administration, intralesional administration, intracranial administration, intranasal administration, intraocular administration, intracardiac administration, intravitreal administration, intraosseous administration, intracerebral administration, intraarterial administration, intraarticular administration, intradermal administration, transdermal administration, transmucosal administration, sublingual administration, enteral administration, suppository administration, inhaled administration, or subcutaneous administration.For example, compositions comprising the disclosed fusion protein can be formulated into various desirable forms, including pills, capsules, tablets, granules, powders, salts, crystals, liquids, serums, syrups, suspensions, gels, creams, pastes, films, patches, and vapors. These formulations may include diluents (example: lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and / or glycine) , slip modifiers (example: silica, talc, stearate and its magnesium or calcium salt and / or polyethylene glycol) in addition to the active ingredient. Tablets may also include binders such as magnesium aluminum silicate, starch paste, gelatin, methyl cellulose, sodium carboxymethyl cellulose and / or polyvinyl pyrrolidine, and may include disintegrating agents such as starch, agar, alginic acid or sodium salt thereof or boiling mixture and / or absorbents, coloring agents, flavoring agents and sweetening agents if needed.The composition is sterilized and / or may include adjuvants such as antiseptics, stabilizers, hydrators or emulsify stimulators, osmotic pressure controlling purposed salts and / or buffers, and other substances beneficial for treatments, and may be formulated according to traditional methods of mixture, granulation or coating.The compositions of the present disclosure can be contained in pharmaceutically acceptable formulations. Such a pharmaceutically acceptable formulation may include a pharmaceutically acceptable carrier (s) or excipient (s) , solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are physiologically compatible. For example, the carrier can be suitable for intra-articular injection. Excipients include pharmaceutically acceptable stabilizers. The present invention pertains to any pharmaceutically acceptable formulations, including synthetic or natural polymers in the form of macromolecular complexes, nanocapsules, microspheres, or beads, and lipid-based formulations including oil-in-water emulsions, micelles, mixed micelles, synthetic membrane vesicles, and gels such as hyaluronic gels.In some embodiments, compositions comprising the fusion protein of the present disclosure as disclosed herein can be formulated in any suitable means, e.g., as a sterile injectable solution, e.g., which can be prepared by incorporating the fusion protein the required amount of the appropriate solvent with various of the other ingredients, as desired. In some embodiments, a composition comprising the fusion protein disclosed herein can be formulated in a hydrogel.Compositions comprising the fusion protein as disclosed herein can be administered to the patient in an injectable formulation containing any compatible carrier, such as various vehicles, adjuvants, additives, and diluents; or the compounds utilized in the present invention can be administered parenterally to the patient in the form of slow-release subcutaneous implants or targeted delivery systems such as monoclonal antibodies, vectored delivery, iontophoretic, polymer matrices, liposomes, and microspheres.In one aspect, the compositions described herein, e.g., fusion protein of ABD-asparaginase are administered about 1-4 times a month. For example, the compositions are administered approximately once a week or twice a week. Alternatively, the compositions are administered approximately every two weeks (bi-weekly) . In other cases, the compositions are administered once a month. In other cases, the compositions are administered once every two months. In other aspects, the compositions are administered about 1-3 times every 6 months. Alternatively, the compositions of the invention are administered about 1-12 times a year, e.g., once a month, once every 2 months, once every 3 months, once every 4 months, once every 5 months, once every 6 months, once every 7 months, once every 8 months, once every 9 months, once every 10 months, once every 11 months, or once every 12 months.The human body dose of the pharmaceutical composition according to the present invention may vary depending on the age, body weight, gender, administration form, health status and level of disease of patients, and may be administrated via oral or non-oral route following decisions of doctors or pharmacists with preferably dose of 0.01 to 200 mg / kg / day.In an embodiment, the fusion protein is formulated for administration at a dosage of between 0.01 mg / kg and 50 mg / kg to the subject. More preferably, the fusion protein is formulated for administration at a dosage of between 0.1 mg / kg and 30 mg / kg to the subject. Most preferably, the fusion protein is formulated for administration at a dosage of between 1.5 mg / kg and 3.5 mg / kg to the subject. In one exemplary embodiment, the dosage is 1.5 mg / kg, administered biweekly.The present invention will be further understood by reference to the following non-limiting examples. This invention is further illustrated by the following examples which should not be construed as limiting. The contents of all references, patents, and published patent applications cited throughout this application, as well as the figures, are incorporated herein by reference.Using the materials and methods disclosed in the Examples below, those skilled in the art would be able to produce the disclosed fusion proteins and derivatives thereon in large amount with a high yield.Additionally, those skilled in the art would appreciate that the disclosed fusion protein can also be used in food industry, by preventing the formation of unwanted acrylamide.Reports of the presence of acrylamide in a range of fried and oven-cooked foods have caused worldwide concern because this compound has been classified as probably carcinogenic in humans. Acrylamide can be generated from food components during heat treatment as a result of the Maillard reaction between amino acids and reducing sugars. It has been found that asparagine, a major amino acid in potatoes and cereals, is a crucial participant in the production of acrylamide by this pathway.One of the measures applied by food business operators to reduce acrylamide in food is the use of the asparaginase enzyme as suggested by the European Commission Regulation in 2017. The fusion proteins disclosed herein and derivatives thereof are able to catalyse the conversion of the asparagine, which is the reaction substrate, to aspartic acid and ammonia, thereby preventing the formation of acrylamide.EXAMPLESExample 1: Expression and production of EcWT, ErWT and ABD-ErS5In order to prepare EcWT, ErWT and ABD-ErS5, the target genes encoding his-tagged wild-type Erwinia chrysanthemi asparaginase (ErWT) , his-tagged wild-type E. coli asparaginase (EcWT) and his-tagged albumin binding domain fusion with the N-terminus of wild-type Erwinia chrysanthemi asparaginase by a linker (GGGGS) 5 (ABD-ErS5) were inserted into pET30a expression vector. All plasmids were transformed into BL21 (DE3) for protein expression.A single colony was picked and grown overnight at 37℃ in a sterile LB medium that contained 100 μg / mL kanamycin. The seed culture was inoculated into 200 mL of sterile LB medium with 100 μg / mL kanamycin grown at 37 ℃. Upon the optical density of the culture (OD600) reached 0.6 –0.8, EcWT and ABD-ErS5 were expressed by 0.2 mM of IPTG under incubation at 16 ℃for 16 -18 hours while ErWT was expressed by 1 mM of IPTG under incubation at 30 ℃ for 5 hours. Each cell pellet was collected by centrifugation and lysed by an ultrasonic homogenizer (QSonica sonicators) in resuspension buffer (20 mM Tris buffer, 500 mM NaCl, pH 8.0) . The supernatant was collected under centrifugation at 13,000 rpm for 2 h at 4 ℃ and loaded onto a 5-ml HisTrap nickel affinity column (GE Healthcare, Uppsala, Sweden) . The target protein was eluted at different concentrations of elution buffer (20 mM Tris buffer, 500 mM NaCl, pH 8.0, 500 mM imidazole) and finally buffer-exchanged into phosphate-buffered saline (PBS) , pH 7.4 for storage at 4℃. The protein was then analysed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) .To further confirm the target protein, mass spectrometer analysis was carried out to determine their intact masses. The analysis was performed with an Agilent 1290 Infinity UHPLC / Agilent 6540 QTOF LC / MS (Agilent Technologies, Santa Clara, CA, USA. The chromatographic separation was performed using an ACQUITY BEH C4 column (Waters Corporation) with a linear gradient from 5%B to 95%solvent B, where solvents A and B were MilliQ Water / 0.1%formic acid and acetonitrile / 0.1%formic acid, respectively. The mass spectrometer was operated in positive ion mode. MS data were acquired with an m / z range of 600-2000, from which multiply-charged mass spectra were obtained. The multiple-charged mass spectra were deconvoluted by the Agilent MassHunter BioConfirm software (Agilent Technologies) to obtain the molecular mass of the protein. Their molecular mass values detected by mass spectrometry were measured as 35546 Da in EcWT (calculated mass = 35547 Da) , 36009 Da in ErWT (calculated mass = 36008 Da) and 42678 in ABD-ErS5 (calculated mass = 42676 Da) (Fig. 1 B) . Example 2: Characterizations of EcWT, ErWT and ABD-ErS5EcWT, ErWT and ABD-ErS5 produced in Example 1 demonstrate different specific activities as shown in Table 1 and Fig. 1.Table 1. Specific activities of EcWT, ErWT, ABD-ErS5 and HSA-ABD-ErS5 complex on asparagine and glutamine. Results are shown as mean ± SD.Circular dichroism (CD) spectroscopic analysis was then carried out to determine secondary structures and melting temperatures of an individual protein. First, the purified protein was buffer exchanged into 10 mM potassium phosphate buffer, pH 7.4, at a concentration of 0.1 mg / mL and determined by JASCO J-1500 CD spectrometer (Great Dunmow, UK) . Protein was monitored in the far-UV region (190-260 nm) and CD spectra were collected in an average of three scans. For the determination of melting temperature, the protein was monitored at 222 nm with the increase of temperature from 25 to 95 ℃. The melting temperature was obtained from three measurements.Based on the circular dichroism (CD) measurement, no significant differences in the secondary structures and melting temperatures among the three different kinds of asparaginases were found (Fig. 1C and Table 2) .Table 2. Melting temperatures of different asparaginases. Results are shown as mean ± SD.The determinations of KM, kcat and specific activity of asparaginases were carried out by measuring the concentration of the liberated ammonium from asparagine and glutamine, respectively, by using Nessler’s reagent (Merck Millipore) .Briefly, 5 μL asparaginases were mixed with 200 μL of different concentrations of asparagine and glutamine (PBS, pH 7.4) at 37 ℃ for different reaction time durations separately. The reaction mixture was stopped by adding 15 μL of 80%trichloroacetic acid. After that, the reaction mixture was centrifugated at 10,000 rpm for 5 min at room temperature to remove the precipitates. Two hundred microliters of supernatant were mixed with 800 μL of diluted Nessler’s reagent and then incubated for 10 min at room temperature. The absorbance of the reaction mixture at 430 nm was determined using ultraviolet-visible spectroscopy (Spectronic 20 Genesys Spectrometer) and recorded. One international unit of asparaginase is defined as the amount of enzyme that can produce 1 μmol ammonia / min at 37 ℃, pH 7.4. For the determination of optimal pH for activity, measurement was done by the procedures above but in different pH values of asparagine and glutamine solutions.It was found that the optimal pH for their enzymatic activities on hydrolysing asparagine and glutamine was alkaline, pH 8-9 (Fig. 1 D) . The binding between ABD-ErS5 and human serum albumin (HSA) did not alter the optimal pH for activity (Fig. 1 D) . Besides, ErWT had a higher catalytic efficiency on hydrolysing asparagine and glutamine than EcWT (Fig. 1 E and Table 3) . Significant differences in kinetic parameters were not observed in ABD-ErS5 when compared with ErWT (Fig. 1 E and Table 3) .Table 3. Enzyme kinetic parameters for different asparaginases on hydrolysing asparagine and glutamine. Results are shown in mean ± SD.In order to determine the in vitro serum stability of the proteins, different quantities of asparaginases were mixed with fetal bovine serum (FCS) to reach different concentrations (EcWT and ErWT: 0.4 mg / mL; ABD-ErS5: 0.02 mg / mL) and incubated at 37 ℃. A portion of the mixture was collected on different days to measure the enzymatic activities of asparaginases on hydrolysing asparagine and glutamine based on the activity assay mentioned above.Based on the results, it was found that the enzymatic activity of EcWT on asparagine decreased to <20%with undetectable glutamine activity whilst that of ErWT on asparagine and glutamine remained at ～80%for two months (Fig. 1 F) . The in vitro serum stability of ABD-ErS5 with or without binding to HSA was comparable to that of ErWT (Fig. 1 F) .Example 3: Inhibition Activities of EcWT, ErWT and ABD-ErS5Human leukemia cell lines (Jurkat and HL-60) and human gastric cancer cell lines (BGC-823 and MKN-45) were maintained in Roswell Park Memorial Institute 1640 (RPMI1640) medium. All the culture media were supplemented with 10%FCS and 100 units / mL penicillin / streptomycin (PS) incubated at 37 ℃ in a humidified 5%CO2 incubator.The 50%growth inhibition (IC50) of BGC-823 and MKN-45 cells was determined by the [3- (4, 5-dimethylthiazol-2-yl) -2, 5-diphenyltetrazolium bromide] (MTT) method. A density of approximately 3 × 103 cells per well was seeded in 96-well micro-well plates and incubated overnight at 37 ℃in a humidified 5%CO2 incubator before the treatment of ABD-ErS5.After 72 h incubation with different concentrations of various asparaginases, ten microliters of 5 mg / mL of MTT reagent were added into each well, followed by incubation at 37 ℃ for 4 h. Then, the solution in each well was completely removed and 100 μL / well dimethyl sulfoxide (DMSO) was added. With complete solubilization of the formazan crystals, absorbance at 540 nm was detected byplate reader (BMG LABTECH, Weston, FL, USA) . The IC50 value was calculated using the Prism software (GraphPad Software Inc, La Jolla, CA, USA) with the non-linear regression sigmoidal dose-response curve model. Independent experiments were performed in at least triplicate.As shown in Figs. 1G and 1 H, EcWT, ErWT and ABD-ErS5 are able to inhibit the in vitro growth of asparagine synthetase (ASNS) positive BGC-823 and MKN-45 gastric cancer cell lines after 72 h incubation.As further demonstrated in Fig. 1 H, the IC50 values of EcWT, ErWT and ABD-ErS5 on the BGC-823 cell line were 4.53 ± 0.75, 0.03 ± 0.01 and 0.04 ± 0.01 μg / ml while those on the MKN-45 cell line were 4.77 ± 1.23, 0.04 ± 0.01 and 0.11 ± 0.02 μg / ml, respectively. Furthermore, the presence of ABD did not significantly weaken the cytotoxicity of ABD-ErS5 against gastric cancer cell lines.Example 4: Albumin binding assays of ABD-ErS5The binding between ABD-ErS5 and human serum albumin (HSA) was analysed. ABD-ErS5 and human serum albumin (HSA) in different molar ratios were incubated at 37 ℃ for 10 min and then analysed by native gel electrophoresis. Moreover, size-exclusion chromatography was also used to separate the complex of ABD-ErS5 and HSA and determine their molecular masses.Briefly, the column was equilibrated with ovalbumin (43,000 Da) , conalbumin (75,000 Da) , aldolase (15, 8 000 Da) thyroglobulin (66, 9 000 Da) and blue dextran (2,000,000 Da) under PBS (pH 7.4) . ABD-ErS5, HSA and their complex at a molar ratio of 1: 4 were then loaded into a SuperdexTM 200 increase 10 / 300 GL (GE Healthcare, Uppsala, Sweden) . The eluted major peak was then measured by dynamic light scattering (DLS, Wynatt, ) to determine the hydrodynamic diameter of individual protein and complex at 37℃. Data were collected from three measurements.As shown in the native gel analysis depicted in Fig. 2A, ABD-ErS5 is able to bind to HAS, forming an albumin-ABD-ErS5 complex. The band intensity of HSA alone could not be detected even though the mole ratio of ABD-ErS5: HSA had increased to 1: 0.75 and different bands larger than 480 kDa were present (Fig. 2A) . The HSA-ABD-ErS5 complex did not alter the specific activity of ABD-ErS5 on hydrolysing asparagine and glutamine (Table 1) .In addition, the retention time and molecular mass of the HSA-ABD-ErS5 complex, determined by the size exclusion column, were significantly shorter (10.85 vs 13.83 min) and larger (705 vs 151 kDa) than that of ABD-ErS5, respectively (Fig. 2B) . Additionally, from the analysis of dynamic light scattering, ABD-ErS5 and HSA had a diameter of 10.78 ± 0.17 and 5.14 ± 0.18 nm, respectively, while the HSA-ABD-ErS5 complex resulted in a dramatically increased diameter (16.90 ± 0.56 nm) (Fig. 2C) .As the albumin-ABD-ErS5 complex exhibits a much bigger size, it is able to avoid renal clearance and avoid neutralizing antibodies, resulting in a significantly prolonged elimination half-life of ABD-ErS5.Example 5: ABD-ErS5 induced caspase-dependent apoptosis, S-phase cell cycle arrest and autophagy in MKN-45 cellsApoptotic cells were determined in MKN-45 cells after the treatment with or without different concentrations of ABD-ErS5 at different times. Briefly, MKN-45 cells (0.4 x 106) were seeded into T25 flask and overnight incubated before the treatment of ABD-ErS5. Cells treated with or without ABD-ErS5 at various concentrations (0 –0.22 μg / mL) and time points (24 –72 h) were harvested, washed, and incubated in 1X assay buffer with Annexin V-FITC / propidium iodide (PI) according to the instructions of the Annexin V-FITC / PI Apoptosis Detection Kit (BD Biosciences, San Diego, CA, USA) . The stained cells were anaylsed by BD Accuri TM C6 Flow Cytometer.As shown in Figs. 3A and 3B, it was found that ABD-ErS5 induced apoptotic cell death in MKN-45 cells in a dose-and time-dependent manner. Of 72 h incubation, ABD-ErS5 was able to induce and increase total apoptotic cells from 12.97%by 0.11 μg / ml to 27.37%by 0.22 μg / ml. Furthermore, apoptotic cells were detected after as early as 48 h of incubation and increased with time under the treatment of ABD-ErS5 with 0.22 μg / ml from 24 h to 72 h (Figs. 3E and 3F) . These results were further confirmed by the Western blot analysis, in which in which MKN-45 cancer cells with or without ABD-ErS5 at different concentrations and incubation times were harvested, washed, and lysed with radioimmunoprecipitation assay (RIPA) lysis buffer (Thermo Fisher Scientific, Rockford, IL, USA) . The extracted protein was collected and determined by Bicinchoninic acid (BCA) method for protein concentration. The total protein was analysed by SDS-PAGE and transferred to polyvinylidene fluoride (PVDF) Immobilon-P membranes (Millipore, Bedford, MA, USA) . The membranes were blocked with 5%blotting-grade blocker (Bio-Rad Laboratories) in Tris-buffered saline (TBST, 0.1%Tween-20, 100 mM Tris-Cl, pH 7.5, 0.9%NaCl) at room temperature for 1 h, followed by overnight incubation with a specialized primary antibody at 4℃. After incubation, membranes were washed by TBST and incubated with a secondary antibody at room temperature for 1 h. The signal detection was performed by Immobilon Western Chemiluminescent HRP Substrate (Millipore Corporation, Billerica, MA, USA) and imaged by ChemiDocTM Imaging Systems (Bio-Rad Laboratories) . For the primary antibodies, rabbit anti-ASNS, rabbit anti-GAPDH, rabbit anti-PARP, rabbit anti-cleaved caspase 3, rabbit anti-LC3 and rabbit anti-β-actin were used. HRP-conjugated goat anti-rabbit secondary antibody was used to detect all primary antibodies. All primary antibodies were diluted at 1: 1000 while secondary antibody was diluted at 1: 10000 (Cell Signaling Technology, Danvers, MA, USA) . ImageJ software (National Institutes of Health) was adopted to determine the protein signal intensities. At least three independent experiments were performed.The results of the Western blot analysis shows that apoptotic markers of cleaved PARP and caspase-3 were noticeably observed after the treatment with different concentrations of ABD-ErS5 for 48 and 72 h (Figs. 3C, 3D, 3G and 3H) .To verify whether the apoptotic cell death was caspase-dependent, an irreversible pan-caspase inhibitor, carbobenzoxy-valyl-alanyl-aspartyl- [O-methyl] -fluoromethylketone (z-VAD-FMK) , was combined with ABD-ErS5 during the treatment. MKN-45 cells treated with ABD-ErS5 (0.22 μg / mL) in the absence or presence of z-VAD-FMK (20 mM) for 72 h were used for the apoptosis assay.In the presence of z-VAD-FMK, total apoptotic cells significantly decreased (18.4 %) compared to cells treated with ABD-ErS5 alone (28.53%) (Figs. 3I and 3J) , which was consistent with the reduced expression level of cleaved caspase-3 (Figs. 3K and 3L) . These results suggested that ABD-ErS5 induced caspase-dependent apoptosis in MKN-45 cells.To perform the cell cycle analysis, MKN-45 cells were seeded and treated with ABD-ErS5 as in the apoptosis assay. The harvested cells were fixed in 60%ethanol at 4 ℃ overnight, washed by PBS with 0.1%Triton X-100, and incubated with PI / RNase staining buffer (BD Pharmingen, San Jose, CA, USA) at room temperature for at least 1 h. Fluorescence activated cell sorting (FACS) analyses were then performed on the stained cells and data from each sample were collected from at least 10,000 cells using BD Accuri TM C6 Flow Cytometer. The cell cycle distribution analyses were performed using ModFit LT 3.1 (Verity Software House, Topsham, ME, USA) .As shown in Fig. 4A, ABD-ErS5 induced tremendous percentages of cells were arrested at the S-phase after the treatment with different concentrations of ABD-ErS5 for 72 h. Under the treatment of ABD-ErS5 with IC50 (0.11 μg / ml) at different time points, the percentage of S-phase arrest was observed as early as 48 h of incubation and progressively increased after 72 h of incubation (Fig. 4B) .Also, the occurrence of autophagy after the treatment of ABD-ErS5 with IC50 (0.11 μg / ml) at different time points was determined by confocal microscope. Autophagy in live MKN-45 cells induced by ABD-ErS5 was analysed according to the method of Chung, et al.

[0036] . MKN-45 cells were treated with or without 0.11 μg / mL of ABD-ErS5 at different times (0 –72 h) . Rapamycin (500 nM) was used as a positive control. Then, the cells were washed and stained with cyto-ID dye and Hoechst 33342 according to the instructions of Autophagy detection kit (Enzo Life Sciences, Farmingdale, NY, USA) . The live detection was done by using a Leica TCS SPE confocal microscope.Results displayed that the LC3 II puncta (green dots) were only detected at 24 h of incubation with rapamycin (positive control) while they were detected at 48 h and 72 h of incubation with 0.11 μg / ml of ABD-ErS5 (Fig. 4C) .These results were also further confirmed by Western blot analysis which showed that the increased ratio of LC3 II / LC3 I was observed after 48 and 72 h of incubations (Figs. 4D to 4G) . Example 6: Pharmacodynamics and Pharmacokinetics studies of EcWT, ErWT and ABD-ErS5To determine the pharmacodynamics of EcWT, ErWT and ABD-ErS5 in blood, plasma from mice before and after injection of asparaginases was collected to measure the concentrations of asparagine and glutamine, as well as aspartic acid and glutamic acid (which are the products of hydrolysis of asparagine and glutamine by asparaginase) .Briefly, a single i. p. injection of EcWT (30 mg / kg) , ErWT (30 mg / kg) and ABD-ErS5 (1.5 –30 mg / kg) were individually administrated into normal BALB / c mice (n = 6 in each group) on day 0. Blood samples were collected at different times from the lateral saphenous vein of the mice, followed by centrifugation to collect the plasma. Meanwhile, the body weight of the mice was measured.The concentrations of the amino acids in plasma were analysed by LC / MS / MS by the AccQ Tag derivatization approach with the Kairos Amino Acid Kit (Waters Corporation, Milford, MA, USA) based on the modified methods of Cadoni et al. (Dis Markers. 2020; 2020: 2291759) and Armenta et al. (Anal Chem. Jan 15 2010; 82 (2) : 548-558) . Briefly, five microliters of plasma were mixed with 5 μL of 10%sulfosalicylic acid containing a mixture of isotope-labeled amino acids. The mixture was centrifuged for 15 min and 5 μL of the supernatant was mixed with 35 μL of borate buffer. Ten microliters of AccQ Tag reagents were then added to the sample and incubated at 55 ℃ for 10 min for derivatization. The derivatized sample (2 μL) was then directly analysed with an Agilent 1290 Infinity UHPLC / Agilent 6460 QQQ LC / MS (Agilent Technologies, Santa Clara, CA, USA) .Chromatographic separation was performed using an ACQUITY CORTECS C18 column (Waters Corporation, 1.6 μm, 2.1 mm x150 mm) with an elution gradient of 0 –1.5 min: 2%B, 1.5 –4 min: 2 -9%B, 4 –5 min: 9%–11%B, 5 –18 min: 11%–13%B, 18 –18.5 min: 13%–95%B, 18.5 –20.5 min: 95%B, 20.5 –20.6 min: 95%-2%B, 20.6 –25 min: 2%B in a flow rate of 0.4 mL / min, where solvent A and B were MilliQ Water / 0.1%formic acid and acetonitrile / 0.1%formic acid, respectively. Data analysis was performed with the Agilent MassHunter Quantitative Analysis software (Agilent Technologies) .The levels of asparagine, glutamine, aspartic acid and glutamic acid in mice treated with single intraperitoneal (i. p. ) injection of different doses of asparaginases were monitored as shown in Fig. 5.The injections of EcWT and ErWT with 30 mg / kg could only maintain at low levels of asparagine for 2 days and glutamine for < 1 day (Figs. 5A and 5B) . No notable body weight loss was observed in these two treatment groups (Fig. 5D) . However, using ABD-ErS5 at the same concentration as in ErWT (30 mg / kg) and even lower (10 mg / kg) could deplete both asparagine and glutamine (results not shown) .To minimize the weight lost effect observed in the mice, ～9-fold and ～20-fold decreases in the concentrations of ABD-ErS5 were evaluated, and it was discovered that the duration of asparagine and glutamine depletion was dependent on the dose of ABD-ErS5. The injections of 1.5 mg / kg and 3.5 mg / kg of ABD-ErS5 could simultaneously achieve a low level of asparagine for ～15 and ～23 days, and a low level of glutamine for ～11 and ～19 days, respectively (Figs. 5A and 5B) .The decrease in the levels of asparagine and glutamine was well correlated with the elevated levels of aspartic and glutamic acids (Figs. 5A and 5B) . Meanwhile, the body weight loss also exhibited a dose-dependent response to the concentration of ABD-ErS5. A maximum of ～17%and ～25%body weight loss was respectively observed in the treatment groups of ABD-ErS5 with 1.5 mg / kg and 3.5 mg / kg but these effects could be recovered once the depletion ceased (Fig. 5D) .Additionally, the pharmacokinetic studies were performed by using the remaining plasma to measure the activity on hydrolysing asparagine and glutamine. Briefly, plasma was diluted and reacted with 200 μL of 10 mM asparagine and 3 mM glutamine in PBS at 37 ℃, respectively. The plasma drug activities were determined by using Nessler’s reagent as stated above for the determination of drug elimination half-life (t1 / 2) values by using PK Solutons 2.0.3 software (Ashland, OH44805, USA) .As shown in Fig. 5C, the results from pharmacokinetics studies were well correlated with pharmacodynamic profiles. The drug elimination half-life of ErWT for asparagine and glutamine was 0.40 ± 0.01 and 0.44 ± 0.01 days, respectively, while that of EcWT was 0.52 ± 0.09 for asparagine but the half-life could not be determined for glutamine (Fig. 5C and Table 4) .In the presence of albumin binding domain (ABD) , the drug elimination half-life of ABD-ErS5 with 1.5 mg / kg is unexpectedly extended to 6.83 ± 0.13 for asparagine and 8.19 ± 0.27 days for glutamine, respectively, which were ～18-fold longer than ErWT (Fig. 5C and Table 4) . In line with the pharmacodynamics results, a dose-dependent response was also observed in the elimination half-life of ABD-ErS5. As demonstrated in Fig. 5C and Table 4, increasing the dose of ABD-ErS5 to 3.5 mg / kg further extended the elimination half-life to 7.21 ± 0.15 days for asparagine and 8.56 ± 0.25 days for glutamine (Fig. 5C and Table 4) .Table 4. Elimination half-life (t1 / 2) of different asparaginases on asparagine and glutamine. Results are shown in mean ± SD.*u. d.: undetected due to the extremely low activityExample 7: In vivo nti-tumor efficacy of ABD-ErS5 in the MKN-45 xenograft mouse modelIn order to minimize the adverse effect of body weight loss, ABD-ErS5 with 1.5 mg / kg was chosen as the dose for anti-tumor efficacy evaluation. Based on the results of pharmacodynamics studies, this dose could achieve low levels of asparagine and glutamine for ～2 weeks, allowing a biweekly i. p. injection of ABD-ErS5 as a potential drug regimen.Fresh MKN-45 cells (1 × 106) with the supplement of Matrigel were injected into the flank of BALB / c nude mice subcutaneously to establish MKN-45 xenograft model. When the tumors reached the size of 1.5–2.0 cm in diameter, they were excised, cut into tumor fragments, and implanted into other nude mice twice. Once the tumor growth was stable at an average size of ～150 mm3, the mice were randomly divided into two groups (n = 6) . The control group (PBS) and treatment group (ABD-ErS5, 1.5 mg / kg) were biweekly intraperitoneally administered to nude mice bearing MKN-45 xenograft for 6 weeks. Tumor dimensions were determined in situ regularly throughout the treatment period using a digital caliper and the tumor volume was calculated by the formula of 0.5 × length x (width) 2. The body weight of the tumor-bearing mice was monitored accordingly throughout treatment. At the end of the treatment, mice were sacrificed, and the tumors were obtained for actual tumor weight measurement.As shown in Fig. 6A, the treatment on nude mice bearing the MKN-45 xenograft model demonstrated significant tumor suppression after 6 weeks. The average end-point tumor volumes in PBS (control group) and ABD-ErS5-treated mice (treatment group) were 1724.15 ±248.50 and 606.26 ± 58.23 mm3, respectively. On the other hand, the final average tumor sizes in control and treatment groups were 1.30 ± 0.16 and 0.50 ± 0.04 g, respectively (Fig. 6B) . Surprisingly, a ～65%suppression in tumor volume and ～61%suppression in tumor weight was observed in the treatment group.As shown in Fig. 6C, the body weight temporarily lost < 11%after each injection and the body weight could be recovered in each cycle. The macroscopic appearances of the PBS and ABD-ErS5 treated tumors dissected after the experiment were shown in Fig. 6D. It can be seen that the tumor sizes in the ABD-ErS5-treated mice are significantly smaller as compared to the control group, showing that a biweekly administration of ABD-ErS5 (1.5 mg / kg) significantly suppressed the tumor growth in an MKN-45 human gastric cancer xenograft model.Example 8: Functionality and immunogenicity of multiple administrations of asparaginases to normal miceTo evaluate the functionality and immunogenicity of ABD-ErS5 after multiple administrations, ABD-ErS5 (1.5 mg / kg) and PBS (control) were biweekly intraperitoneally administrated to BALB / c mice with a complete immune system, based on the same schedule as that of anti-tumor efficacy experiment (Figs. 7A, 7B) . For comparison, an evaluation of the functionalities of EcWT and ErWT for 6 weeks was also performed.Mice were randomly assigned into four groups. A biweekly i. p. injection of PBS (the control group, n = 6) or ABD-ErS5 with 1.5 mg / kg (the treatment group, n = 6) into normal mice was performed for 6 weeks. EcWT (30 mg / kg, n = 4) and ErWT (30 mg / kg, n = 4) were intraperitoneally injected twice per week. Blood samples were collected at different times from the lateral saphenous vein of the mice for LC / MS / MS analysis to determine the concentrations of asparagine and glutamine in plasma. Simultaneously, the body weight of mice was monitored.For the immunogenicity study, the plasma collected from the mice treated with ABD-ErS5 (1.5 mg / kg) was used to determine the anti-ABD-ErS5 antibody using the enzyme-linked immunosorbent assay (ELISA) . Briefly, ABD-ErS5 with 0.2 mg / mL in the coating buffer (0.05 M carbonate-bicarbonate buffer, pH 9.6) was coated onto a 96-well plate (Nunc MaxisorpTM) and incubated overnight at 4 ℃, followed by washing with washing buffer (PBS with 0.05%Tween-20) and blocking in blocking buffer (1%BSA in PBS) for 2 h.The diluted plasma was then added to each well and incubated at room temperature for 2 h. Each well was washed with washing buffer and incubated with anti-mouse IgG-HRP at a ratio of 1: 1000 at room temperature for 1 h, followed by washing and the addition of TMB substrate according to the instruction of BD OptEIATM ELISA set (BD Biosciences, San Diego, CA, USA) . Finally, sulfuric acid (1 M) was added to stop the reaction and the absorbance (A450 nm) was detected by using a plate reader (BMG LABTECH, Weston, FL, USA) to determine the antibody titer.The concentrations of asparagine and glutamine were monitored and anti-ABD-ErS5 antibodies in plasma were detected at different time points. As shown in Fig. 7A and 7B, with the injection of ABD-ErS5 (1.5 mg / kg) , asparagine and glutamine were both depleted to low levels after the first injection (Day 0) (Figs. 7A and 7B) . As shown in Fig. 7A, 7B and 7D, double amino acid depletions were observed in 66.7%of mice even though 83.3 %of mice developed anti-ABD-ErS5 antibodies at the end of the experiment (Figs. 7A, 7B and 7D) . Although body weight loss was observed after each injection, this effect could be safely reversed (Fig. 7C) . After three cycles of treatment, anti-ABD-ErS5 antibodies were detected in 5 out of 6 mice (83.3%) as shown in Fig. 7D.The outcome of ABD-ErS5 treatment was much better than the results obtained from multiple administrations of EcWT and ErWT, which were inactive at an early stage (Fig. 8E and 8F) . Specifically, since the depletion of glutamine by EcWT (30 mg / kg) and ErWT (30 mg / kg) could not last for one day (Figs. 8C and 8D) , the functionalities of EcWT and ErWT were indicated by the depletion of asparagine to a low level. It was found that they could not sustain a low asparagine level for more than one day after the fifth injection (Day 14) in all mice (Figs. 8E and 8F) . No notable body weight changes were observed in the EcWT (30 mg / kg) and ErWT (30 mg / kg) groups (Fig. 8G) .Based on the above results, it is believed that the ABD portion of ABD-ErS5 binds to serum albumin, and therefore, played a protective role against the attack of anti-ABD-ErS5 antibodies and remained active for a longer time in the bloodstream.Subsequently, histological processing and sectioning of key organs of the treated mice were performed. The five key organs, including the heart, kidney, liver, lung and spleen, were end-point harvested. The organs were weighted and overnight fixed with 4%paraformaldehyde before undergoing tissue processing through graded alcohols, xylene and wax using Excelsior AS automated tissue processor (Thermo Scientific, Waltham, MA, USA) . Paraffin sections of 5-μm thickness were prepared for routine haematoxylin and eosin (H&E) staining for the evaluation of the histology.As shown in Table 5, there were no differences in the wet organ weights between the control and ABD-ErS5 groups at the end of the experiment.Table 5. Organ weights of normal mice after the multiple administration of ABD-ErS5. The results are shown as mean ± SEM and were analysed by one-way ANOVA, *p < 0.05, **p < 0.01, ***p<0.001.Microscopic investigations revealed no noticeable histological abnormalities in the treatment group in comparison to the control group (Fig. 9) . Therefore, it can be concluded that multiple administrations of ABD-ErS5 imposed no noticeable histopathological abnormalities on key organs, suggesting the absence of acute toxicity to the mice.Overall, normal wet weight values and histology of organs in the treatment groups as compared to the control group (Fig. 9 and Table 5) indicate the safety of double amino acid depletions by ABD-ErS5. Overall, ABD-ErS5 achieved long-lasting double amino acid depletions and demonstrated great potential for the treatment of gastric cancer.The above embodiments are described by way of example only. Many variations are possible without departing from the scope of the disclosure as defined in the appended claims.Although a variety of examples and other information was used to explain aspects within the scope of the appended claims, no limitation of the claims should be implied based on particular features or arrangements in such examples, as one of ordinary skill would be able to use these examples to derive a wide variety of implementations. Further and although some subject matter may have been described in language specific to examples of structural features and / or method steps, it is to be understood that the subject matter defined in the appended claims is not necessarily limited to these described features or acts. For example, such functionality can be distributed differently or performed in components other than those identified herein. Rather, the described features and steps are disclosed as examples of components of systems and methods within the scope of the appended claims.

Claims

1.A fusion protein comprising:at least one asparaginase portion or a functional variant thereof; andan albumin binding domain (ABD) ;wherein the at least one asparaginase portion or the functional variant thereof is optionally linked to the albumin binding domain via a linker.2.The fusion protein according to claim 1, wherein the asparaginase portion is derived from Escherichia coli or Erwinia chrysanthemi.3.The fusion protein according to claim 1, wherein the asparaginase portion is derived from Erwinia chrysanthemi.4.The fusion protein according to claim 1, wherein the at least one asparaginase is linked to the albumin domain via a linker.5.The fusion protein according to claim 1, wherein the linker is a peptide comprising an amino acid sequence selected from: SGG, GGS, SGGS, SSGGS, GGGGGG, SGGGG, GGGGS, SGGGGS, GGGGGS, SGGGGGS, SGGGGG, GSGGGGS, GGGGGS, SGGGGGGGGGGG, SGGGGGGGS, or SGGGGSGGGGS.6.The fusion protein according to claim 1, wherein the linker is a peptide comprising the sequence (GGGGS) n, wherein n is an integer between and including 1-10.7.The fusion protein according to claim 1, wherein the linker is a peptide comprising the sequence (GGGGS) 5.8.The fusion protein according to claim 1, wherein albumin-binding domain (ABD) is a functional variant.9.A composition comprising a therapeutically effective amount of the fusion protein according to claim 1.10.The composition according to claim 9, further comprising one or more pharmaceutically acceptable carriers.11.A method for preventing and treating a disease treatable by asparagine and / or glutamine depletion in a subject comprising administering the fusion protein of claim 1 to the subject.12.The method according to claim 11, wherein the disease is cancer.13.The method according to claim 11, wherein the cancer is an asparagine-dependent cancer, a glutamine-dependent cancer, or both arginine and glutamine-dependent cancer.14.The method according to claim 11, wherein the cancer is acute lymphoblastic leukemia.15.The method according to claim 11, wherein the cancer is a solid tumor.16.The method according to claim 11, wherein the cancer is gastric cancer.17.The method according to any one of claims 11-16, wherein the fusion protein is administered via oral administration, intravenous administration, topical administration, parenteral administration, intraperitoneal administration, intramuscular administration, intrathecal administration, intralesional administration, intracranial administration, intranasal administration, intraocular administration, intracardiac administration, intravitreal administration, intraosseous administration, intracerebral administration, intraarterial administration, intraarticular administration, intradermal administration, transdermal administration, transmucosal administration, sublingual administration, enteral administration, suppository administration, inhaled administration, or subcutaneous administration.18.The method according to any one of claims 11-16, wherein the fusion protein is administered via intravenous administration.19.The method according to any one of claims 11-16, wherein the fusion protein is administered via oral administration.20.The method according to any one of claims 11-16, wherein the fusion protein is administered via subcutaneous administration.21.The method according to any one of claims 11-16, wherein the fusion protein is administered via intramuscular administration.22.The method according to any one of claims 11-16, wherein the fusion protein is administered in a form selected from the group consisting of pills, capsules, tablets, granules, powders, salts, crystals, liquids, serums, syrups, suspensions, gels, creams, pastes, films, patches, and vapors.23.The method according to any one of claims 11-22, wherein the fusion protein is administered at a dosage of between 0.01 mg / kg and 50 mg / kg to the subject.24.The method according to any one of claims 11-22, wherein the fusion protein is administered at a dosage of between 0.1 mg / kg and 30 mg / kg to the subject.25.The method according to any one of claims 11-22, wherein the fusion protein is administered at a dosage of between 1.5 mg / kg and 3.5 mg / kg to the subject.26.The method according to any one of claims 11-25, wherein the fusion protein is administered between 1 and 4 times a month.27.The method according to any one of claims 11-25, wherein the fusion protein is administered once every two weeks.28.A pharmaceutical composition comprising the fusion protein according to claim 1 for preventing or treating a disease treatable by asparagine and / or glutamine depletion in a subject.29.The pharmaceutical composition according to claim 28, wherein the disease is cancer.30.The pharmaceutical composition according to claim 29, wherein the cancer is an asparagine-dependent cancer, a glutamine-dependent cancer, or both arginine and glutamine-dependent cancer.31.The pharmaceutical composition according to claim 29, wherein the cancer is acute lymphoblastic leukemia.32.The pharmaceutical composition according to claim 29, wherein the cancer is a solid tumor.33.The pharmaceutical composition according to claim 29, wherein the cancer is gastric cancer.34.The pharmaceutical composition according to any one of claims 28-33, wherein the pharmaceutical composition is formulated for administration via oral administration, intravenous administration, topical administration, parenteral administration, intraperitoneal administration, intramuscular administration, intrathecal administration, intralesional administration, intracranial administration, intranasal administration, intraocular administration, intracardiac administration, intravitreal administration, intraosseous administration, intracerebral administration, intraarterial administration, intraarticular administration, intradermal administration, transdermal administration, transmucosal administration, sublingual administration, enteral administration, suppository administration, inhaled administration, or subcutaneous administration.35.The pharmaceutical composition according to any one of claims 28-33, wherein the pharmaceutical composition is formulated for intravenous administration.36.The pharmaceutical composition according to any one of claims 28-33, wherein the pharmaceutical composition is formulated for oral administration.37.The pharmaceutical composition according to any one of claims 28-33, wherein the pharmaceutical composition is formulated for subcutaneous administration.38.The pharmaceutical composition according to any one of claims 28-33, wherein the fusion protein is administered via intramuscular administration.39.The pharmaceutical composition according to any one of claims 28-38, wherein the pharmaceutical composition in a form selected from the group consisting of pills, capsules, tablets, granules, powders, salts, crystals, liquids, serums, syrups, suspensions, gels, creams, pastes, films, patches, and vapors.40.The pharmaceutical composition according to any one of claims 28-38, wherein the pharmaceutical composition is formulated to administer the fusion protein at a dosage of between 0.01 mg / kg and 50 mg / kg to the subject.41.The pharmaceutical composition according to any one of claims 8-38, wherein the pharmaceutical composition is formulated to administer the fusion protein at a dosage of between 0.1 mg / kg and 30 mg / kg to the subject.42.The pharmaceutical composition according to any one of claims 8-38, wherein the pharmaceutical composition is formulated to administer the fusion protein at a dosage of between 1.5 mg / kg and 3.5 mg / kg to the subject.43.A method for reducing acrylamide formulation in food product by treating the food product with the fusion protein according to claim 1.

Images