Compositions and methods for the treatment of cancer

Abstract

The disclosure provides polypeptides and conjugates thereof that include an Fc domain monomer, or Fc domain that binds to or inhibits PD-1 that is further covalently linked to a moiety that binds to or inhibits CD73. The disclosure also provides pharmaceutical compositions including such polypeptides or conjugates thereof and uses of such polypeptides or conjugates thereof in the treatment of cancers that overexpress CD73, PD-L1, or PD-1.

Description

[0001] COMPOSITIONS AND METHODS FOR THE TREATMENT OF CANCER

[0002] Background

[0003] Cluster of differentiation 73 (CD73) is a glycosyl phosphatidyl inositol-linked membrane protein found in most tissues that catalyzes the conversion of extracellular adenosine monophosphate (AMP) to adenosine. It functions as a homodimer and can be shed and is active as a soluble protein in circulation. In addition to its enzymatic function, CD73 is also a cellular adhesion molecule and plays a role in regulation of leukocyte trafficking.

[0004] In cancer, CD73 is expressed by many subsets of cells populating the tumor lesion, including tumor cells, stromal cells, and endothelial cells, as well as infiltrating immune cells. CD73 levels are known to be upregulated due to tissue injury or hypoxic conditions, and a number of solid tumors have elevated CD73 levels. Upregulation of CD73 within the tumor contributes to the adenosine-rich tumor microenvironment, which has numerous pro-tumor and immuno-suppressive effects. High CD73 tumor expression has been associated with shorter overall survival and poor prognosis in certain cancers. CD73 in cancer patients has also been associated with resistance to antitumor therapies.

[0005] Programmed cell death 1 (PD-1) has been implicated in cancer as it is an immune checkpoint protein that is up-regulated post T cell activation in order to prevent autoimmunity. However, immune checkpoint proteins are also up-regulated in tumor-infiltrating lymphocytes, and immune checkpoint ligands are overexpressed on tumor cells, contributing to immune escape by tumor cells. Despite the promise of checkpoint blockade therapies, many patients still fail to achieve sufficient response to checkpoint blockade alone.

[0006] There is a need for novel treatments for disorders associated with CD73 and PD-1 . In view of the role played by CD73 and PD-1 in cancer, as well as a diverse array of other diseases, disorders and conditions, and the current lack of CD73 inhibitors available to medical practitioners, new CD73 inhibitors, and compositions and methods associated therewith, are needed. Further, there is a need to identify therapeutic modalities to stack with checkpoint blockade that could increase patient response rate. Thus, dual inhibitors of CD73 and PD-1 are needed.

[0007] Summary

[0008] This disclosure relates to polypeptides that include an anti-PD-1 ScFv polypeptide and an Fc domain monomer, and conjugates thereof. In particular, such conjugates contain monomers or dimers of a moiety that binds to or inhibits CD73 conjugated to an Fc monomer or Fc domain. This disclosure also provides pharmaceutical compositions including such polypeptides and conjugates thereof and uses of such polypeptides and conjugates thereof in the treatment of cancer.

[0009] In an aspect, the disclosure features a conjugate, or a pharmaceutically acceptable salt thereof, described by formula (D-l) or (M-l): wherein each of A1and A2, independently, has the structure of formula (A): , m is 0, 1, 2, 3, 4, 5, or 6; s is 0 or 1; each of X1, X2, X3, X4, X5, and X6is, independently, N, CR4, or C-Y-R5, wherein at least one of X1, X2, X3, X4, X5, and X6is C-Y-R5and R5is a bond to L; R1is Z is O, S, or sulfonyl; each of R2aand R2bis, independently, H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; each R3is, independently, OH, SH, halogen, optionally substituted amino, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; R4is H, halogen, OH, SH, optionally substituted amino, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; each of R6aand R6bis, independently, H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; Y is a first linker; L is a second linker; n is 1 or 2; each E is a polypeptide containing an anti-PD-1 scFv- Fc domain monomer; T is an integer from 1 to 20; and the squiggly line indicates that L is covalently attached to E. In some embodiments, the conjugate is described by formula (D-I): In some embodiments, the conjugate is described by formula (M-I): In some embodiments, A1and A2have the structure of formula (A-I): In some embodiments, A1and A2each have the structure of formula (A-Ia): In some embodiments, A1and A2each have the structure of formula (A-Ib): In some embodiments, A1and A2each have the structure of formula (A-Ib-1): In some embodiments, A1and A2each have the structure of formula (A-Ib-2): In some embodiments, A1and A2each have the structure of formula (A-II): In some embodiments, A1and A2each have the structure of formula (A-IIa): In some embodiments, A1and A2each have the structure of formula (A-IIb): In some embodiments, A1and A2each have the structure of formula (A-IIb-1): In some embodiments, A1and A2each have the structure of formula (A-IIb-2): In some embodiments, s is 0. In some embodiments, s is 1. In some embodiments, each of R2aand R2bis, independently, H, optionally substituted C1-C20alkyl, or optionally substituted C1-C20heteroalkyl. In some embodiments, each of R2aand R2bis H. In some embodiments, R4is H, halogen, OH, SH, optionally substituted amino, optionally substituted C1-C20alkyl, or optionally substituted C1-C20heteroalkyl. In some embodiments, R4is halogen. In some embodiments, R4is Cl. In some embodiments, R1is In some embodiments, R1is In some embodiments, each of R6aand R6bis, independently, H, optionally substituted C1-C20alkyl, or optionally substituted C1-C20heteroalkyl. In some embodiments, each of R6aand R6bis, independently, H, -CH3, -CH2CH3, -CH2OH, -CH2OCH3-CH2CH2OH, or -CH2CH2OCH3. In some embodiments, each of R6aand R6bis H.

[0010] In some embodiments Y is: each of p1, p2, p3, and p4 is, independently, 0, 1, 2, 3, or 4; q is 0, 1, 2, 3, or 4; each X7is, independently, N or CH; each X8is, independently, O, NH, CH2, or C(=O); RN1is H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, optionally substituted C2-C19heteroaryl, optionally substituted C1-C20alkaryl, or optionally substituted C1-C20alkylcycloalkyl; each R7is, independently, , optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, or optionally substituted C2-C20heterocycloalkenyl; each of R7aand R7bis, independently, H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; and each R8is, independently, halogen, OH, SH, optionally substituted amino, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl. In some embodiments, Y is . In some embodiments, q is 1 and Y is . In some embodiments, R7is and Y is In some embodiments, Y is In some embodiments, q is 0 and Y is In some embodiments, RN1is H, In some embodiments, Y is In some embodiments, L includes one or more optionally substituted C1-C40alkylene, optionally substituted C1-C40heteroalkylene, optionally substituted C1-C40alkoxylene, optionally substituted C2-C20alkenylene, optionally substituted C2-C20heteroalkenylene, optionally substituted C2-C20alkynylene, optionally substituted C2-C20heteroalkynylene, optionally substituted C3-C20cycloalkylene, optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20cycloalkenylene, optionally substituted C4-C20heterocycloalkenylene, optionally substituted C8-C20cycloalkynylene, optionally substituted C8-C20heterocycloalkynylene, optionally substituted C5-C15arylene, optionally substituted C2- C15heteroarylene, O, S, NRi, P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, or imino, wherein Riis H, optionally substituted C1-C20alkyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2- C20alkynyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20cycloalkenyl, optionally substituted C4- C20 heterocycloalkenyl, optionally substituted C8-C20cycloalkynyl, optionally substituted C8-C20heterocycloalkynyl, optionally substituted C5-C15aryl, or optionally substituted C2-C15heteroaryl. In some embodiments, L is oxo substituted. In some embodiments, L includes between 1 and 250 atoms. In some embodiments, L is capable of forming an amide, a carbamate, a sulfonyl, or a urea linkage. In some embodiments, L is described by the formula: J1-(Q1)g-(T1)h-(Q2)i-(T2)j-(Q3)k-(T3)l-(Q4)m-(T4)n-(Q5)o-J2wherein J1is a bond attached to A1; J2is a bond attached to E or is a functional group capable of reacting with a functional group conjugated to E; each of Q1, Q2, Q3, Q4, and Q5is, independently, optionally substituted C1-C40 alkylene, optionally substituted C1-C40 heteroalkylene, optionally substituted C1-C40 alkoxylene, optionally substituted C2-C20 alkenylene, optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene, optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene, or optionally substituted C2-C15 heteroarylene; each of T1, T2, T3, T4is, independently, O, S, NRi, P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, imino, or oximo; Riis H, optionally substituted C1-C20 alkyl, optionally substituted C1-C20 heteroalkyl, optionally substituted C2-C20 alkenyl, optionally substituted C2-C20 heteroalkenyl, optionally substituted C2-C20 alkynyl, optionally substituted C2-C20 heteroalkynyl, optionally substituted C3-C20 cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20 cycloalkenyl, optionally substituted C4- C20 heterocycloalkenyl, optionally substituted C8-C20 cycloalkynyl, optionally substituted C8-C20 heterocycloalkynyl, optionally substituted C5-C15 aryl, or optionally substituted C2-C15 heteroaryl; and each of g, h, i, j, k, l, m, n, and o is, independently, 0, 1, or 2. In some embodiments, Q1is , , , In some embodiments, Q2is optionally substituted C1-C40alkylene, optionally substituted C1-C40heteroalkylene, optionally substituted C1-C40alkoxylene, or optionally substituted C2-C15heteroarylene. In some embodiments, Q3is optionally substituted C2-C15heteroarylene. In some embodiments, Q4is optionally substituted C1-C40alkylene, optionally substituted C1-C40heteroalkylene, or optionally substituted C1-C40alkoxylene. In some embodiments, J2is The disclosure features an intermediate (Int) of Table 1. These intermediates include one or more inhibitors of CD73 and a linker and may be used in the synthesis of a conjugate described herein. Intermediates of Table 1 may be conjugated to, for example, a polypeptide containing an anti-PD-1 scFv- and an Fc domain monomer. In preferred embodiments, one or more nitrogen atoms of one or more surface exposed lysine residues of E or one or more sulfur atoms of one or more surface exposed cysteines in E is covalently conjugated to a linker (e.g., a PEG2-PEG20linker). The linker conjugated to E may be functionalized such that it may react to form a covalent bond with any of the Ints described herein (e.g., an Int of Table 1). In preferred embodiments, E is conjugated to a linker functionalized with an azido group and the Int (e.g., an Int of Table 1) is functionalized with an alkyne group. Conjugation (e.g., by click chemistry) of the linker-azido of E and linker-alkyne of the Int forms a conjugate of the disclosure. In yet other embodiments, E is conjugated to a linker functionalized with an alkyne group and the Int (e.g., an Int of Table 1) is functionalized with an azido group. Conjugation (e.g., by click chemistry) of the linker- alkyne of E and the linker-azido of the Int forms a conjugate of the disclosure. In yet other embodiments, the Int (e.g., an Int of Table 2) is functionalized with a phenyl ester group (e.g., a trifluorophenyl ester group or a tetrafluorophenyl ester group). Conjugation (e.g., by acylation) of E and the linker-phenyl ester (e.g., trifluorophenyl ester or tetrafluorophenyl ester) of the Int forms a conjugate of the invention. Conjugation (e.g., by acylation) of E and the linker-phenyl ester (e.g., trifluorophenyl ester or tetrafluorophenyl ester) of the Int is conducted by methods described herein or known in the art. The disclosure further features a composition (e.g., a pre-conjugation intermediate) having the structure of an Int of Table 1. Table 1. Intermediates

[0011] The disclosure also features a conjugate of Table 2. Each conjugate of Table 2 corresponds to a conjugate of formula (D-I) or (M-I). Conjugates of Table 2 include conjugates formed by the covalent reaction of an Int of Table 1 with E. Conjugates of table 2 further include conjugates formed by the covalent reaction of an Int of Table 1 with a linker which is in turn conjugated to E. In some embodiments, the reactive moiety of the Int (e.g., the alkyne or azido group) reacts with a corresponding reactive group (e.g., an alkyne or azido group) of a linker covalently attached to E, such that an Int of Table 1 is covalently attached to E. In some embodiments, the reactive moiety of the Int (e.g., the phenyl ester group, e.g., tetrafluorophenyl ester or trifluorophenyl ester group) reacts with a corresponding reactive group (e.g., nitrogen or sulfur atom) of an amino acid side chain of E, such that an Int of Table 1 is covalently attached to E. In some embodiments in any conjugate of Table 2, n is 1 or 2. When n is 1, E is a polypeptide containing an anti-PD-1 ScFv-Fc polypeptide (e.g., an scFv having the sequence of any one of SEQ ID NOs: 205-272 and 284). When n is 2, each E is a polypeptide containing an anti-PD-1 scFv-Fc polypeptide (e.g., an scFv having the sequence of any one of SEQ ID NOs: 205-272 and 284). In some embodiments in any conjugate of Table 2, T is an integer from 1 to 20 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20). The disclosure also provides a population of any of the conjugates of Table 2 wherein the average value of T is 1 to 20 (e.g., the average value of T is 1 to 2, 1 to 3, 1 to 4, 1 to 5, 5 to 10, 10 to 15, or 15 to 20). In some embodiments, the average value of T is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. The squiggly line in the conjugates of Table 2 indicates that each Int is covalently attached to an amino acid side chain in E (e.g., the nitrogen atom of a surface exposed lysine or the sulfur atom of a surface exposed cysteine in E), or a pharmaceutically acceptable salt thereof. The disclosure also provides a conjugate of Table 2, wherein the conjugate is produced by conjugation (e.g., via a linker) of an Int of Table 1 to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide monomer. Table 2. Conjugates corresponding to selected intermediates of Table 1

[0012] The disclosure further features a method of making an Fc conjugate by conjugating (e.g., via a linker) an Int of Table 1 to a polypeptide that contains an anti-PD-1 ScFv-Fc polypeptide. In some embodiments, the disclosure provides a conjugate, wherein the conjugate includes a small molecule targeting agent, wherein the targeting agent is described by an Int of Table 1, which is conjugated to an Fc (e.g., via a linker). In some embodiments, the squiggly line connected to E indicates that the L of each A1-L or each A1-L-A2is covalently attached to a nitrogen atom of a solvent-exposed lysine of E. In some embodiments, the squiggly line connected to E indicates that the L of each A1-L or each A1-L-A2is covalently attached to the sulfur atom of a solvent-exposed cysteine of E. In some embodiments, n is 2, and each E dimerizes to form an Fc domain. In some embodiments, each E is a human IgG1 Fc domain monomer. In some embodiments, each E includes a substitution mutation at N297 selected from N297A, N297G, or N297Q, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, each E includes a C220S substitution mutation, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, each E includes a M252Y, a S254T, and a T256E substitution mutation, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283. In some embodiments, each E includes the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 17, or SEQ ID NO: 18. In some embodiments, each E includes the amino acid sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 17, or SEQ ID NO: 18. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 13. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 14. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 17. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 18. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of any one of SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, or SEQ ID NO: 83. In some embodiments, each E includes the amino acid sequence of any one of SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, or SEQ ID NO: 83. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 80. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 81. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 82. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 83. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 113. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 113. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 114. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 114. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 115. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 115. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 116 In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 116. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 117. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 117. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 118. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 118. In some embodiments, each E includes an amino acid sequence having at least 85%, 90%, 95%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 283. In some embodiments, each E includes the amino acid sequence of SEQ ID NO: 283. In some embodiments, the polypeptide of each E includes the structure, from N-terminal to C- terminal: VL-K1-VH-K2-G or VH-K1-VL-K2-G wherein VLis an anti-PD-1 light chain variable region; VHis an anti-PD-1 heavy chain variable region; G is an Fc domain monomer; and K1and K2are each, independently, a linker. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 121, 124, and 125; and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 126, 129, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 138, 139, and 140 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 141, 142, and 143. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 144, and 145 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 146, 147, and 148. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 149, 150, and 151 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 152, 153, and 154. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 155, 156, and 157 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 158, 159, and 160. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 161, 162, and 163 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 164, 165, and 166. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 167 and VHincludes a sequence set forth in SEQ ID NO: 176. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 168 and VHincludes a sequence set forth in SEQ ID NO: 177. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 168 and VHincludes a sequence set forth in SEQ ID NO: 178. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 168 and VHincludes a sequence set forth in SEQ ID NO: 179. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 170 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 171 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 172 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 173 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 181. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 170 and VHincludes a sequence set forth in SEQ ID NO: 181. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 182. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 183. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 184. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 185. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 186. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 187. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 188. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 189. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 174 and VHincludes a sequence set forth in SEQ ID NO: 190. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 191. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 192. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 193. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 194. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 195. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 196. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 197. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 198. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 199. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 200. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 201. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 175 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 202. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 203. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 204. In some embodiments, K1and K2are each, independently, a peptide linker including between 1 and 200 amino acids or a bond. In some embodiments, K1and K2are each, independently, a peptide linker including between 5 and 25 amino acids. In some embodiments, K1and K2are each an independently selected peptide linker including the amino acid sequence of any one of (GS)x, (GGS)x, (GGGGS)x, (GGSG)x, (SGGG)x, or (GGGGS)xGGG, wherein x is an integer from 1 to 10. In some embodiments, the Fc domain monomer is an IgG1 Fc domain monomer. In some embodiments, the Fc domain monomer features a substitution mutation at N297 selected from N297A, N297G, or N297Q, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, the Fc domain monomer features a C220S substitution mutation, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, the Fc domain monomer features a M252Y, a S254T, and a T256E substitution mutation, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, the Fc domain monomer features the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283. In some embodiments, the Fc domain monomer features the amino acid sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 17, or SEQ ID NO: 18. In some embodiments, the Fc domain monomer features the amino acid sequence of any one of SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 118, or SEQ ID NO: 283. In some embodiments, the polypeptide includes the amino acid sequence of any one of SEQ ID Nos: 205-272 and 284. In some embodiments, the Fc domain monomer includes the amino acid sequence of any one of SEQ ID NO: 271 or SEQ ID NO: 284. In some embodiments, the disclosure provides a dimer including: a first polypeptide described by a foregoing aspect or a second polypeptide described by a foregoing aspect, wherein the Fc domain monomer of the first polypeptide and the Fc domain monomer of the second polypeptide dimerize to form an Fc domain. In some embodiments, the first polypeptide and the second polypeptide have the same amino acid sequence and the dimer is a homodimer. In some embodiments, the polypeptide described by a foregoing aspect or the dimer described by a foregoing aspect and a pharmaceutically acceptable carrier. In some embodiments, the conjugate or a pharmaceutically acceptable salt thereof, wherein T is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n is 1 and T represents the number of A1-L or A1-L-A2moieties bound to each E. In some embodiments, n is 2 and the two Es dimerize to form a Fc domain and T represents the number of A1-L or A1-L-A2moieties bound to the Fc domain. In some embodiments, T is an integer from 1 to 20 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20). The disclosure also provides a population of conjugates described herein wherein the average value of T is 1 to 20 (e.g., the average value of T is 1 to 2, 1 to 3, 1 to 4, 1 to 5, 5 to 10, 10 to 15, or 15 to 20). In some embodiments, the average value of T is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In an aspect, the disclosure provides a population of conjugates or a pharmaceutically acceptable salt thereof, wherein the average value of T is 1 to 10. In an aspect, the disclosure provides a population of conjugates or a pharmaceutically acceptable salt thereof, wherein the average value of T is 1 to 5. In an aspect, the disclosure provides a pharmaceutical composition features a conjugate or a population of conjugates or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient. In an aspect, the disclosure provides a method of treating a cancer in a subject, the method includes administering to the subject a conjugate, population of conjugates, or pharmaceutical composition. In some embodiments, the cancer is selected from lung cancer, optionally non-small cell lung cancer or small-cell lung cancer; head and neck cancer, optionally squamous cell carcinoma; renal cell carcinoma; breast cancer; ovarian cancer; pancreatic cancer; colorectal cancer; urothelial cancer; bile duct cancer; endometrial cancer; melanoma; or esophageal cancer. In some embodiments, the breast cancer is triple negative breast cancer. In some embodiments, the cancer is PD-L1 positive. In some embodiments, the triple negative breast cancer is PD-L1 positive. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer overexpresses or is known to overexpress CD73 relative to a non-cancerous cell of the same tissue type. In some embodiments, the method further includes administering to the subject an antibody drug conjugate. In some embodiments, the antibody drug conjugate is the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004. In some embodiments, the disclosure provides a method of treating a PD-L1 positive cancer subject, the method including administering to the subject a conjugate of the disclosure, population of conjugates of the disclosure, or a pharmaceutical composition of the disclosure, and an antibody drug conjugate. In some embodiments, the PD-L1 positive cancer is triple negative breast cancer. In some embodiments, the antibody drug conjugate is the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004. In some embodiments of any of the methods of treatment described herein, the conjugate, population of conjugates, or pharmaceutical composition is administered intramuscularly, intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, locally, by inhalation, by injection, or by infusion. In another aspect, the disclosure features a polypeptide including the structure, from N-terminal to C-terminal: VL-L1-VH-L2-B or VH-L1-VL-L2-B wherein VLis an anti-PD-1 light chain variable region; VHis an anti-PD-1 heavy chain variable region; B is an Fc domain monomer; and L1and L2, are each, independently, a peptide linker. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 121, 124, and 125; and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 126, 129, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 127, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 130, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 131, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 132, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 133, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 134, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 135, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 128, 136, and 137. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 138, 139, and 140 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 141, 142, and 143. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 122, 144, and 145 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 146, 147, and 148. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 149, 150, and 151 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 152, 153, and 154. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 155, 156, and 157 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 158, 159, and 160. In some embodiments, VLincludes an LCDR1, LCDR2, and LCDR3 with the sequences set forth in SEQ ID NOs: 161, 162, and 163 and VHincludes an HCDR1, HCDR2, and HCDR3 with the sequences set forth in SEQ ID NOs: 164, 165, and 166. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 167 and VHincludes a sequence set forth in SEQ ID NO: 176. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 168 and VHincludes a sequence set forth in SEQ ID NO: 177. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 168 and VHincludes a sequence set forth in SEQ ID NO: 178. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 168 and VHincludes a sequence set forth in SEQ ID NO: 179. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 170 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 171 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 172 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 173 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 181. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 170 and VHincludes a sequence set forth in SEQ ID NO: 181. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 182. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 183. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 184. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 185. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 186. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 187. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 188. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 189. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 174 and VHincludes a sequence set forth in SEQ ID NO: 190. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 191. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 192. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 193. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 194. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 195. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 196. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 197. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 198. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 199. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 200. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 201. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 175 and VHincludes a sequence set forth in SEQ ID NO: 180. In some embodiments, VLincludes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 202. In some embodiments, VL includes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 203. In some embodiments, VL includes a sequence set forth in SEQ ID NO: 169 and VHincludes a sequence set forth in SEQ ID NO: 204. In some embodiments, L1and L2are each, independently, a peptide linker including between 1 and 200 amino acids or a bond. In some embodiments, L1and L2are each, independently, a peptide linker including between 5 and 25 amino acids. In some embodiments, the L1and L2are each an independently selected peptide linker including the amino acid sequence of any one of (GS)x, (GGS)x, (GGGGS)x, (GGSG)x, (SGGG)x, or (GGGGS)xGGG, wherein x is an integer from 1 to 10. In some embodiments, the Fc domain monomer is an IgG1 Fc domain monomer. In some embodiments, the Fc domain monomer has a substitution at N297 selected from N297A, N297G, or N297Q, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, the Fc domain monomer has a C220S substitution, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, the Fc domain monomer has a M252Y, a S254T, and a T256E substitution, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index. In some embodiments, the Fc domain monomer has the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283. In some embodiments, the Fc domain monomer has the amino acid sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 17, or SEQ ID NO: 18. In some embodiments, the Fc domain monomer features the amino acid sequence of any one of SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 118, or SEQ ID NO: 283. In some embodiments, the polypeptide includes the amino acid sequence of any one of SEQ ID NOs: 205-272 and 284. In an aspect, a dimer including: a first polypeptide described in a foregoing aspect and a second polypeptide described in a foregoing aspect wherein the Fc domain monomer of the first polypeptide and the Fc domain monomer of the second polypeptide dimerize to form an Fc domain. In some embodiments, the first polypeptide and the second polypeptide have the same amino acid sequence and the dimer is a homodimer. In an aspect, a pharmaceutical composition featuring the polypeptide described in a foregoing aspect or the dimer described in a foregoing aspect and a pharmaceutically acceptable carrier. In an aspect, a method of treating a cancer in a subject, the method including administering to the subject an effective amount of a polypeptide described in a foregoing aspect, the dimer described in a foregoing aspect, or a pharmaceutical composition described in a foregoing aspect. In some embodiments, the cancer is selected from lung cancer, optionally non-small cell lung cancer or small-cell lung cancer; head and neck cancer, optionally squamous cell carcinoma; renal cell carcinoma; breast cancer; ovarian cancer; pancreatic cancer; colorectal cancer; urothelial cancer; bile duct cancer; endometrial cancer; melanoma; prostate cancer; glioma cancer; or esophageal cancer. In some embodiments, the cancer is PD-L1 positive. In some embodiments, the breast cancer is triple negative breast cancer. In some embodiments, the triple negative breast cancer is PD-L1 positive. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer overexpresses or is known to overexpress PD-1 relative to a non-cancerous cell of the same tissue type. In some embodiments, the method further includes administering to the subject an antibody drug conjugate. In some embodiments, the antibody drug conjugate is the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004. In some embodiments, the disclosure provides a method of treating a PD-L1 positive cancer subject, the method including administering to the subject a polypeptide described in a foregoing aspect, the dimer described in a foregoing aspect, or a pharmaceutical composition described in a foregoing aspect, and an antibody drug conjugate. In some embodiments, the PD-L1 positive cancer is triple negative breast cancer. In some embodiments, the antibody drug conjugate is the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004. In some embodiments, the polypeptide, dimer, or pharmaceutical composition is administered intramuscularly, intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, locally, by inhalation, by injection, or by infusion. Definitions To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as "a", "an," and "the" are not intended to refer to only a singular entity but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims. As used herein, the term “Fc domain monomer” refers to a polypeptide chain that includes at least a hinge domain and second and third antibody constant domains (CH2 and CH3) or functional fragments thereof (e.g., fragments that that capable of (i) dimerizing with another Fc domain monomer to form an Fc domain, and (ii) binding to an Fc receptor. The Fc domain monomer can be any immunoglobulin antibody isotype, including IgG, IgE, IgM, IgA, or IgD (e.g., IgG). Additionally, the Fc domain monomer can be an IgG subtype (e.g., IgG1, IgG2a, IgG2b, IgG3, or IgG4) (e.g., IgG1). In some embodiments, an Fc domain monomer does not include any portion of an immunoglobulin that is capable of acting as an antigen-recognition region, e.g., a variable domain or a complementarity determining region (CDR). Fc domain monomers in the compositions as described herein can contain one or more changes from a wild-type Fc domain monomer sequence (e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions, or deletions) that alter the interaction between an Fc domain and an Fc receptor. Examples of suitable changes are known in the art. In certain embodiments, a human Fc domain monomer (e.g., an IgG heavy chain, such as IgG1) includes a region that extends from any of Asn208, Glu216, Asp221, Lys222, or Cys226 to the carboxyl-terminus of the heavy chain at Lys447. C-terminal Lys447 of the Fc region may or may not be present, without affecting the structure or stability of the Fc region. C-terminal Lys 447 may be proteolytically cleaved upon expression of the polypeptide. In some embodiments of any of the Fc domain monomers described herein, C-terminal Lys 447 is optionally present or absent. The N-terminal N (e.g., Asn 201) of the Fc region may or may not be present, without affecting the structure of stability of the Fc region. N-terminal Asn may be deamidated upon expression of the polypeptide. In some embodiments of any of the Fc domain monomers described herein, N-terminal Asn is optionally present or absent. Unless otherwise specified herein, numbering of amino acid residues in the IgG or Fc domain monomer is according to the EU numbering system for antibodies, also called the Kabat EU index, as described, for example, in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991. As used herein, the term “Fc domain” refers to a dimer of two Fc domain monomers that is capable of binding an Fc receptor. In the wild-type Fc domain, the two Fc domain monomers dimerize by the interaction between the two CH3 antibody constant domains, in some embodiments, one or more disulfide bonds form between the hinge domains of the two dimerizing Fc domain monomers. The terms “Fab” or “fragment antigen-binding,” as used interchangeably herein, refer to a region on an antibody that binds to an antigen. Fab is a term of art and its meaning is known to those of skill in the art. A Fab region is composed of one constant and one variable domain of each of the heavy and light chains. Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH). The heavy chain constant region may be comprised of three domains, CH1, CH2, and / or CH3. Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The VH and VL regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” (CDRs), interspersed with regions that are more conserved, termed “framework regions” (FRs). In antibodies, the heavy chain (e.g., the VH and CH region) is linked to the Fc domain monomer by way of a hinge. The Fc domain monomers described herein may include between 10 and / or 20 residues (e.g., 11, 12, 13, 14, 15, 16, 17, 18, or 19 residues) of the Fab domain and hinge region. In certain embodiments, the N-terminus of the Fc domain monomer is any one of amino acid residues 198-205 (corresponding to a residue of the Fab domain). In some embodiments, the N- terminus of the Fc domain monomer is amino acid residue 201 (e.g., Asn 201). In certain embodiments, the N-terminus of the Fc domain monomer is amino acid residue 202 (e.g., Val 202). As used herein, the terms “single-chain variable fragment” and “ScFv” refer to a polypeptide that includes variable regions of the heavy (VH) and light chains (VL) of immunoglobulins. The VH and VLregions are connected by a peptide linker. The term “covalently attached” refers to two parts of a conjugate that are linked to each other by a covalent bond formed between two atoms in the two parts of the conjugate. As used-herein, a “surface exposed amino acid” or “solvent-exposed amino acid,” such as a surface exposed cysteine or a surface exposed lysine refers to an amino acid that is accessible to the solvent surrounding the protein. A surface exposed amino acid may be a naturally occurring or an engineered variant (e.g., a substitution or insertion) of the protein. In some embodiments, a surface exposed amino acid is an amino acid that when substituted does not substantially change the three- dimensional structure of the protein. The term “linker” as used herein, refer to a covalent linkage or connection between two or more components in a polypeptide or a conjugate thereof (e.g., between a peptide and an Fc domain monomer in a polypeptide described herein, between two CD73 inhibitors in a conjugate described herein, between a CD73 inhibitor and a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide in a conjugate described herein, and between a dimer of two CD73 inhibitors and a polypeptide that contains an anti- PD-1 scFv-Fc polypeptide in a conjugate described herein). In some embodiments, a conjugate described herein may contain a linker that has a bivalent structure (e.g., a bivalent linker). A bivalent linker has two arms, in which each arm is covalently linked to a component of the conjugate (e.g., a first arm conjugated to a CD73 inhibitor and a second arm conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide). In some embodiments, a conjugate described herein may contain a linker that has a trivalent structure (e.g., a trivalent linker). A trivalent linker has three arms, in which each arm is covalently linked to a component of the conjugate (e.g., a first arm conjugated to a CD73 inhibitor, a second arm conjugated to a second CD73 inhibitor, and a third arm conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide). Linkers of the disclosure may be linear or branched. In some embodiments, molecules that may be used as linkers include at least two functional groups, which may be the same or different, e.g., two carboxylic acid groups, two amine groups, two sulfonic acid groups, a carboxylic acid group and a maleimide group, a carboxylic acid group and an alkyne group, a carboxylic acid group and an amine group, a carboxylic acid group and a sulfonic acid group, an amine group and a maleimide group, an amine group and an alkyne group, or an amine group and a sulfonic acid group. The first functional group may form a covalent linkage with a first component in the conjugate and the second functional group may form a covalent linkage with the second component in the conjugate. In some embodiments of a trivalent linker, two arms of a linker may contain two dicarboxylic acids, in which the first carboxylic acid may form a covalent linkage with the first CD73 inhibitor in the conjugate and the second carboxylic acid may form a covalent linkage with the second CD73 inhibitor in the conjugate, and the third arm of the linker may for a covalent linkage with a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide in the conjugate. Examples of dicarboxylic acids are described further herein. In some embodiments, a molecule containing one or more maleimide groups may be used as a linker, in which the maleimide group may form a carbon-sulfur linkage with a cysteine in a component (e.g., a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide) in the conjugate. In some embodiments, a molecule containing one or more alkyne groups may be used as a linker, in which the alkyne group may form a 1,2,3-triazole linkage with an azide in a component (e.g., a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide) in the conjugate. In some embodiments, a molecule containing one or more azide groups may be used as a linker, in which the azide group may form a 1,2,3-triazole linkage with an alkyne in a component (e.g., a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide) in the conjugate. In some embodiments, a molecule containing one or more bis- sulfone groups may be used as a linker, in which the bis-sulfone group may form a linkage with an amine group a component (e.g., a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide) in the conjugate. In some embodiments, a molecule containing one or more sulfonic acid groups may be used as a linker, in which the sulfonic acid group may form a sulfonamide linkage with a component in the conjugate. In some embodiments, a molecule containing one or more isocyanate groups may be used as a linker, in which the isocyanate group may form a urea linkage with a component in the conjugate. In some embodiments, a molecule containing one or more haloalkyl groups may be used as a linker, in which the haloalkyl group may form a covalent linkage, e.g., C-N and C-O linkages, with a component in the conjugate. In some embodiments, a molecule containing one or more phenyl ester groups (e.g., trifluorophenyl ester groups or tetrafluorophenyl ester groups) may be used as a linker, in which the phenyl ester group (e.g., trifluorophenyl ester group or tetrafluorophenyl ester group) may form an amide with an amine in a component (e.g., a polypeptide) in the conjugate. In some embodiments, a linker provides space, rigidity, and / or flexibility between the two or more components. In some embodiments, a linker may be a bond, e.g., a covalent bond. The term “bond” refers to a chemical bond, e.g., an amide bond, a disulfide bond, a C-O bond, a C-N bond, a N-N bond, a C-S bond, or any kind of bond created from a chemical reaction, e.g., chemical conjugation. In some embodiments, a linker includes no more than 250 atoms. In some embodiments, a linker includes no more than 250 non-hydrogen atoms. In some embodiments, the backbone of a linker includes no more than 250 atoms. The “backbone” of a linker refers to the atoms in the linker that together form the shortest path from one part of a conjugate to another part of the conjugate (e.g., the shortest path linking a first CD73 inhibitor and a second CD73 inhibitor). The atoms in the backbone of the linker are directly involved in linking one part of a conjugate to another part of the conjugate (e.g., linking a first CD73 inhibitor and a second CD73 inhibitor). For example, hydrogen atoms attached to carbons in the backbone of the linker are not considered as directly involved in linking one part of the conjugate to another part of the conjugate. In some embodiments, a linker may include a synthetic group derived from, e.g., a synthetic polymer (e.g., a polyethylene glycol (PEG) polymer). In some embodiments, a linker may include one or more amino acid residues, such as D- or L-amino acid residues. In some embodiments, a linker may be a residue of an amino acid sequence (e.g., a 1-25 amino acid, 1-10 amino acid, 1-9 amino acid, 1-8 amino acid, 1-7 amino acid, 1-6 amino acid, 1-5 amino acid, 1-4 amino acid, 1-3 amino acid, 1-2 amino acid, or 1 amino acid sequence). In some embodiments, a linker may include one or more, e.g., 1-100, 1-50, 1- 25, 1-10, 1-5, or 1-3, optionally substituted alkylene, optionally substituted heteroalkylene (e.g., a PEG unit), optionally substituted alkenylene, optionally substituted heteroalkenylene, optionally substituted alkynylene, optionally substituted heteroalkynylene, optionally substituted cycloalkylene, optionally substituted heterocycloalkylene, optionally substituted cycloalkenylene, optionally substituted heterocycloalkenylene, optionally substituted cycloalkynylene, optionally substituted heterocycloalkynylene, optionally substituted arylene, optionally substituted heteroarylene (e.g., pyridine), O, S, NRi(Riis H, optionally substituted alkyl, optionally substituted heteroalkyl, optionally substituted alkenyl, optionally substituted heteroalkenyl, optionally substituted alkynyl, optionally substituted heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted cycloalkenyl, optionally substituted heterocycloalkenyl, optionally substituted cycloalkynyl, optionally substituted heterocycloalkynyl, optionally substituted aryl, or optionally substituted heteroaryl), P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, or imino. For example, a linker may include one or more optionally substituted C1-C20 alkylene, optionally substituted C1-C20 heteroalkylene (e.g., a PEG unit), optionally substituted C2-C20 alkenylene (e.g., C2 alkenylene), optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene (e.g., cyclopropylene, cyclobutylene), optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene (e.g., C6 arylene), optionally substituted C2-C15 heteroarylene (e.g., imidazole, pyridine), O, S, NRi(Riis H, optionally substituted C1-C20 alkyl, optionally substituted C1-C20 heteroalkyl, optionally substituted C2- C20 alkenyl, optionally substituted C2-C20 heteroalkenyl, optionally substituted C2-C20 alkynyl, optionally substituted C2-C20 heteroalkynyl, optionally substituted C3-C20 cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20 cycloalkenyl, optionally substituted C4- C20 heterocycloalkenyl, optionally substituted C8-C20 cycloalkynyl, optionally substituted C8-C20 heterocycloalkynyl, optionally substituted C5-C15 aryl, or optionally substituted C2-C15 heteroaryl), P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, or imino. The terms “alkyl,” “alkenyl,” and “alkynyl,” as used herein, include straight-chain and branched- chain monovalent substituents, as well as combinations of these, containing only C and H when unsubstituted. When the alkyl group includes at least one carbon-carbon double bond or carbon-carbon triple bond, the alkyl group can be referred to as an “alkenyl” or “alkynyl” group respectively. The monovalency of an alkyl, alkenyl, or alkynyl group does not include the optional substituents on the alkyl, alkenyl, or alkynyl group. For example, if an alkyl, alkenyl, or alkynyl group is attached to a compound, monovalency of the alkyl, alkenyl, or alkynyl group refers to its attachment to the compound and does not include any additional substituents that may be present on the alkyl, alkenyl, or alkynyl group. In some embodiments, the alkyl or heteroalkyl group may contain, e.g., 1-20.1-18, 1-16, 1-14, 1-12, 1-10, 1-8, 1- 6, 1-4, or 1-2 carbon atoms (e.g., C1-C20, C1-C18, C1-C16, C1-C14, C1-C12, C1-C10, C1-C8, C1-C6, C1-C4, or C1-C2). In some embodiments, the alkenyl, heteroalkenyl, alkynyl, or heteroalkynyl group may contain, e.g., 2-20, 2-18, 2-16, 2-14, 2-12, 2-10, 2-8, 2-6, or 2-4 carbon atoms (e.g., C2-C20, C2-C18, C2-C16, C2-C14, C2-C12, C2-C10, C2-C8, C2-C6, or C2-C4). Examples include, but are not limited to, methyl, ethyl, isobutyl, sec-butyl, tert-butyl, 2-propenyl, and 3-butynyl. A heterocycloalkyl, heterocycloalkenyl, or heterocycloalkynyl group refers to a cycloalkyl, cycloalkenyl, or cycloalkynyl group that has one or more heteroatoms independently selected from, e.g., N, O, and S. Exemplary heterocycloalkyl groups include pyrrolidine, thiophene, thiolane, tetrahydrofuran, piperidine, and tetrahydropyran. The term “cycloalkyl,” as used herein, represents a monovalent saturated or unsaturated non- aromatic cyclic alkyl group. A cycloalkyl may have, e.g., three to twenty carbons (e.g., a C3-C7, C3-C8, C3-C9, C3-C10, C3-C11, C3-C12, C3-C14, C3-C16, C3-C18, or C3-C20 cycloalkyl). Examples of cycloalkyls include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cycloheptyl. When the cycloalkyl group includes at least one carbon-carbon double bond, the cycloalkyl group can be referred to as a “cycloalkenyl” group. A cycloalkenyl may have, e.g., four to twenty carbons (e.g., a C4- C7, C4-C8, C4-C9, C4-C10, C4-C11, C4-C12, C4-C14, C4-C16, C4-C18, or C4-C20 cycloalkenyl). Exemplary cycloalkenyl groups include, but are not limited to, cyclopentenyl, cyclohexenyl, and cycloheptenyl. When the cycloalkyl group includes at least one carbon-carbon triple bond, the cycloalkyl group can be referred to as a “cycloalkynyl” group. A cycloalkynyl may have, e.g., eight to twenty carbons (e.g., a C8-C9, C8-C10, C8-C11, C8-C12, C8-C14, C8-C16, C8-C18, or C8-C20 cycloalkynyl). The term “cycloalkyl” also includes a cyclic compound having a bridged multicyclic structure in which one or more carbons bridges two non-adjacent members of a monocyclic ring, e.g., bicyclo[2.2.1.]heptyl and adamantane. The term “cycloalkyl” also includes bicyclic, tricyclic, and tetracyclic fused ring structures, e.g., decalin and spiro cyclic compounds. The term “aryl,” as used herein, refers to any monocyclic or fused ring bicyclic or tricyclic system which has the characteristics of aromaticity in terms of electron distribution throughout the ring system, e.g., phenyl, naphthyl, or phenanthrene. In some embodiments, a ring system contains 5-15 ring member atoms or 5-10 ring member atoms. An aryl group may have, e.g., five to fifteen carbons (e.g., a C5-C6, C5-C7, C5-C8, C5-C9, C5-C10, C5-C11, C5-C12, C5-C13, C5-C14, or C5-C15 aryl). The term “heteroaryl” also refers to such monocyclic or fused bicyclic ring systems containing one or more, e.g., 1- 4, 1-3, 1, 2, 3, or 4, heteroatoms selected from O, S and N. A heteroaryl group may have, e.g., two to fifteen carbons (e.g., a C2-C3, C2-C4, C2-C5, C2-C6, C2-C7, C2-C8, C2-C9. C2-C10, C2-C11, C2-C12, C2-C13, C2-C14, or C2-C15 heteroaryl). The inclusion of a heteroatom permits inclusion of 5-membered rings to be considered aromatic as well as 6-membered rings. Thus, typical heteroaryl systems include, e.g., pyridyl, pyrimidyl, indolyl, benzimidazolyl, benzotriazolyl, isoquinolyl, quinolyl, benzothiazolyl, benzofuranyl, thienyl, furyl, pyrrolyl, thiazolyl, oxazolyl, isoxazolyl, benzoxazolyl, benzoisoxazolyl, and imidazolyl. Because tautomers are possible, a group such as phthalimido is also considered heteroaryl. In some embodiments, the aryl or heteroaryl group is a 5- or 6-membered aromatic rings system optionally containing 1-2 nitrogen atoms. In some embodiments, the aryl or heteroaryl group is an optionally substituted phenyl, pyridyl, indolyl, pyrimidyl, pyridazinyl, benzothiazolyl, benzimidazolyl, pyrazolyl, imidazolyl, isoxazolyl, thiazolyl, or imidazopyridinyl. In some embodiments, the aryl group is phenyl. In some embodiments, an aryl group may be optionally substituted with a substituent such an aryl substituent, e.g., biphenyl. The term “alkaryl,” refers to an aryl group that is connected to an alkylene, alkenylene, or alkynylene group. In general, if a compound is attached to an alkaryl group, the alkylene, alkenylene, or alkynylene portion of the alkaryl is attached to the compound. In some embodiments, an alkaryl is C6- C35 alkaryl (e.g., C6-C16, C6-C14, C6-C12, C6-C10, C6-C9, C6-C8, C7, or C6 alkaryl), in which the number of carbons indicates the total number of carbons in both the aryl portion and the alkylene, alkenylene, or alkynylene portion of the alkaryl. Examples of alkaryls include, but are not limited to, (C1- C8)alkylene(C6-C12)aryl, (C2-C8)alkenylene(C6-C12)aryl, or (C2-C8)alkynylene(C6-C12)aryl. In some embodiments, an alkaryl is benzyl or phenethyl. In a heteroalkaryl, one or more heteroatoms selected from N, O, and S may be present in the alkylene, alkenylene, or alkynylene portion of the alkaryl group and / or may be present in the aryl portion of the alkaryl group. In an optionally substituted alkaryl, the substituent may be present on the alkylene, alkenylene, or alkynylene portion of the alkaryl group and / or may be present on the aryl portion of the alkaryl group. The term “amino,” as used herein, represents –N(Rx)2or –N+(Rx)3, where each Rxis, independently, H, alkyl, alkenyl, alkynyl, aryl, alkaryl, cycloalkyl, or two Rxcombine to form a heterocycloalkyl. In some embodiment, the amino group is -NH2. The term “alkamino,” as used herein, refers to an amino group, described herein, that is attached to an alkylene (e.g., C1-C5 alkylene), alkenylene (e.g., C2-C5 alkenylene), or alkynylene group (e.g., C2- C5 alkenylene). In general, if a compound is attached to an alkamino group, the alkylene, alkenylene, or alkynylene portion of the alkamino is attached to the compound. The amino portion of an alkamino refers to –N(Rx)2or –N+(Rx)3, where each Rxis, independently, H, alkyl, alkenyl, alkynyl, aryl, alkaryl, cycloalkyl, or two Rxcombine to form a heterocycloalkyl. In some embodiment, the amino portion of an alkamino is -NH2. An example of an alkamino group is C1-C5 alkamino, e.g., C2 alkamino (e.g., CH2CH2NH2or CH2CH2N(CH3)2). In a heteroalkamino group, one or more, e.g., 1-4, 1-3, 1, 2, 3, or 4, heteroatoms selected from N, O, and S may be present in the alkylene, alkenylene, or alkynylene portion of the heteroalkamino group. In some embodiments, an alkamino group may be optionally substituted. In a substituted alkamino group, the substituent may be present on the alkylene, alkenylene, or alkynylene portion of the alkamino group and / or may be present on the amino portion of the alkamino group. The term “alkamide,” as used herein, refers to an amide group that is attached to an alkylene (e.g., C1-C5 alkylene), alkenylene (e.g., C2-C5 alkenylene), or alkynylene (e.g., C2-C5 alkenylene) group. In general, if a compound is attached to an alkamide group, the alkylene, alkenylene, or alkynylene portion of the alkamide is attached to the compound. The amide portion of an alkamide refers to –C(O)-N(Rx)2, where each Rxis, independently, H, alkyl, alkenyl, alkynyl, aryl, alkaryl, cycloalkyl, or two Rxcombine to form a heterocycloalkyl. In some embodiment, the amide portion of an alkamide is -C(O)NH2. An alkamide group may be -(CH2)2-C(O)NH2or -CH2-C(O)NH2. In a heteroalkamide group, one or more, e.g., 1-4, 1-3, 1, 2, 3, or 4, heteroatoms selected from N, O, and S may be present in the alkylene, alkenylene, or alkynylene portion of the heteroalkamide group. In some embodiments, an alkamide group may be optionally substituted. In a substituted alkamide group, the substituent may be present on the alkylene, alkenylene, or alkynylene portion of the alkamide group and / or may be present on the amide portion of the alkamide group. The terms “alkylene,” “alkenylene,” and “alkynylene,” as used herein, refer to divalent groups having a specified size. In some embodiments, an alkylene may contain, e.g., 1-20, 1-18, 1-16, 1-14, 1- 12, 1-10, 1-8, 1-6, 1-4, or 1-2 carbon atoms (e.g., C1-C20, C1-C18, C1-C16, C1-C14, C1-C12, C1-C10, C1-C8, C1-C6, C1-C4, or C1-C2). In some embodiments, an alkenylene or alkynylene may contain, e.g., 2-20, 2-18, 2-16, 2-14, 2-12, 2-10, 2-8, 2-6, or 2-4 carbon atoms (e.g., C2-C20, C2-C18, C2-C16, C2- C14, C2-C12, C2-C10, C2-C8, C2-C6, or C2-C4). Alkylene, alkenylene, and / or alkynylene includes straight-chain and branched-chain forms, as well as combinations of these. The divalency of an alkylene, alkenylene, or alkynylene group does not include the optional substituents on the alkylene, alkenylene, or alkynylene group. For example, two CD73 inhibitors may be attached to each other by way of a linker that includes alkylene, alkenylene, and / or alkynylene, or combinations thereof. Each of the alkylene, alkenylene, and / or alkynylene groups in the linker is considered divalent with respect to the two attachments on either end of alkylene, alkenylene, and / or alkynylene group. For example, if a linker includes -(optionally substituted alkylene)-(optionally substituted alkenylene)-(optionally substituted alkylene)-, the alkenylene is considered divalent with respect to its attachments to the two alkylenes at the ends of the linker. The optional substituents on the alkenylene are not included in the divalency of the alkenylene. The divalent nature of an alkylene, alkenylene, or alkynylene group (e.g., an alkylene, alkenylene, or alkynylene group in a linker) refers to both of the ends of the group and does not include optional substituents that may be present in an alkylene, alkenylene, or alkynylene group. Because they are divalent, they can link together multiple (e.g., two) parts of a conjugate, e.g., a first CD73 inhibitor and a second CD73 inhibitor. Alkylene, alkenylene, and / or alkynylene groups can be substituted by the groups typically suitable as substituents for alkyl, alkenyl and alkynyl groups as set forth herein. For example, C=O is a C1 alkylene that is substituted by an oxo (=O). For example, -HCR-C≡C- may be considered as an optionally substituted alkynylene and is considered a divalent group even though it has an optional substituent, R. Heteroalkylene, heteroalkenylene, and / or heteroalkynylene groups refer to alkylene, alkenylene, and / or alkynylene groups including one or more, e.g., 1-4, 1-3, 1, 2, 3, or 4, heteroatoms, e.g., N, O, and S. For example, a polyethylene glycol (PEG) polymer or a PEG unit -(CH2)2- O- in a PEG polymer is considered a heteroalkylene containing one or more oxygen atoms. The term “cycloalkylene,” as used herein, refers to a divalent cyclic group linking together two parts of a compound. For example, one carbon within the cycloalkylene group may be linked to one part of the compound, while another carbon within the cycloalkylene group may be linked to another part of the compound. A cycloalkylene group may include saturated or unsaturated non-aromatic cyclic groups. A cycloalkylene may have, e.g., three to twenty carbons in the cyclic portion of the cycloalkylene (e.g., a C3-C7, C3-C8, C3-C9, C3-C10, C3-C11, C3-C12, C3-C14, C3-C16, C3-C18, or C3-C20 cycloalkylene). When the cycloalkylene group includes at least one carbon-carbon double bond, the cycloalkylene group can be referred to as a “cycloalkenylene” group. A cycloalkenylene may have, e.g., four to twenty carbons in the cyclic portion of the cycloalkenylene (e.g., a C4-C7, C4-C8, C4-C9. C4-C10, C4-C11, C4-C12, C4- C14, C4-C16, C4-C18, or C4-C20 cycloalkenylene). When the cycloalkylene group includes at least one carbon-carbon triple bond, the cycloalkylene group can be referred to as a “cycloalkynylene” group. A cycloalkynylene may have, e.g., four to twenty carbons in the cyclic portion of the cycloalkynylene (e.g., a C4-C7, C4-C8, C4-C9. C4-C10, C4-C11, C4-C12, C4-C14, C4-C16, C4-C18, or C8-C20 cycloalkynylene). A cycloalkylene group can be substituted by the groups typically suitable as substituents for alkyl, alkenyl and alkynyl groups as set forth herein. Heterocycloalkylene refers to a cycloalkylene group including one or more, e.g., 1-4, 1-3, 1, 2, 3, or 4, heteroatoms, e.g., N, O, and S. Examples of cycloalkylenes include, but are not limited to, cyclopropylene and cyclobutylene. A tetrahydrofuran may be considered as a heterocycloalkylene. The term “arylene,” as used herein, refers to a multivalent (e.g., divalent or trivalent) aryl group linking together multiple (e.g., two or three) parts of a compound. For example, one carbon within the arylene group may be linked to one part of the compound, while another carbon within the arylene group may be linked to another part of the compound. An arylene may have, e.g., five to fifteen carbons in the aryl portion of the arylene (e.g., a C5-C6, C5-C7, C5-C8, C5-C9. C5-C10, C5-C11, C5-C12, C5-C13, C5- C14, or C5-C15 arylene). An arylene group can be substituted by the groups typically suitable as substituents for alkyl, alkenyl and alkynyl groups as set forth herein. Heteroarylene refers to an aromatic group including one or more, e.g., 1-4, 1-3, 1, 2, 3, or 4, heteroatoms, e.g., N, O, and S. A heteroarylene group may have, e.g., two to fifteen carbons (e.g., a C2-C3, C2-C4, C2-C5, C2-C6, C2-C7, C2-C8, C2- C9. C2-C10, C2-C11, C2-C12, C2-C13, C2-C14, or C2-C15 heteroarylene). The term “optionally substituted,” as used herein, refers to having 0, 1, or more substituents, such as 0-25, 0-20, 0-10 or 0-5 substituents. Alkyl, heteroalkyl, alkoxyl, cycloalkyl, heterocyclyl, aryl, and heteroaryl may be substituted with alkyl, halogen, alkenyl, alkynyl, aryl, alkaryl, acyl, heteroaryl, heteroalkyl, heteroalkenyl, heteroalkynyl, heteroalkaryl, halogen, oxo, cyano, nitro, amino, alkamino, hydroxy, alkoxy, alkanoyl, carbonyl, carbamoyl, guanidinyl, ureido, amidinyl, oximo, benzyl, OR, NR2, SR, SOR, SO2R, OCOR, NRCOR, NRCONR2, NRCOOR, OCONR2, RCO, COOR, alkyl-OOCR, SO3R, CONR2, SO2NR2, NRSO2NR2, CN, CF3, OCF3, SiR3, and NO2, wherein each R is, independently, H, alkyl, cycloalkyl, heterocyclyl, alkenyl, aryl, heteroalkyl, heteroalkenyl, or heteroaryl. In some embodiments, a substituent is further substituted as described herein. For example, a C1alkyl group, i.e., methyl, may be substituted with oxo to form a formyl group and further substituted with -OH or -NHR to form a carboxyl group or an amido group. An optionally substituted group or moiety refers to a group or moiety (e.g., any one of the groups or moieties described above) in which one of the atoms (e.g., a hydrogen atom) is optionally replaced with another substituent. For example, an optionally substituted alkyl may be an optionally substituted methyl, in which a hydrogen atom of the methyl group is replaced by, e.g., OH. As another example, a substituent on a heteroalkyl or its divalent counterpart, heteroalkylene, may replace a hydrogen on a carbon or a hydrogen on a heteroatom such as N. For example, the hydrogen atom in the group -R-NH-R- may be substituted with an alkamide substituent, e.g., -R-N[(CH2C(O)N(CH3)2]-R. Generally, an optional substituent is a noninterfering substituent. A “noninterfering substituent” refers to a substituent that leaves the ability of the conjugates described herein to either bind to CD73. Thus, in some embodiments, the substituent may alter the degree of such activity. However, as long as the conjugate retains the ability to bind to CD73 or to inhibit tumor growth, the substituent will be classified as “noninterfering.” For example, the noninterfering substituent would leave the ability of the compound to provide antiviral efficacy based on an IC50 value of 10 μM or less in a viral plaque reduction assay. Thus, the substituent may alter the degree of inhibition based on plaque reduction or CD73 inhibition. However, as long as the compounds herein retain the ability to inhibit CD73, the substituent will be classified as "noninterfering." A number of assays for determining viral plaque reduction or tumor growth suppression or the ability of any compound to inhibit CD73 are available in the art, and some are exemplified in the Examples below. The term “hetero,” when used to describe a chemical group or moiety, refers to having at least one heteroatom that is not a carbon or a hydrogen, e.g., N, O, and S. Any one of the groups or moieties described above may be referred to as hetero if it contains at least one heteroatom. For example, a heterocycloalkyl, heterocycloalkenyl, or heterocycloalkynyl group refers to a cycloalkyl, cycloalkenyl, or cycloalkynyl group that has one or more heteroatoms independently selected from, e.g., N, O, and S. An example of a heterocycloalkenyl group is a maleimido. For example, a heteroaryl group refers to an aromatic group that has one or more heteroatoms independently selected from, e.g., N, O, and S. One or more heteroatoms may also be included in a substituent that replaced a hydrogen atom in a group or moiety as described herein. For example, in an optionally substituted heteroaryl group, if one of the hydrogen atoms in the heteroaryl group is replaced with a substituent (e.g., methyl), the substituent may also contain one or more heteroatoms (e.g., methanol). The term “acyl,” as used herein, refers to a group having the structure: wherein Rzis an optionally substituted alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, cycloalkynyl, aryl, alkaryl, alkamino, heteroalkyl, heteroalkenyl, heteroalkynyl, heterocycloalkyl, heterocycloalkenyl, heterocycloalkynyl, heteroaryl, heteroalkaryl, or heteroalkamino. The term “halo” or “halogen,” as used herein, refers to any halogen atom, e.g., F, Cl, Br, or I. Any one of the groups or moieties described herein may be referred to as a “halo moiety” if it contains at least one halogen atom, such as haloalkyl. The term “haloalkyl,” as used herein, refers to an alkyl group substituted with one or more (e.g., one, two, three, four, five, six, or more) halo groups. Haloalkyl groups include, but are not limited to, fluoroalkyl (e.g., trifluoromethyl and pentafluoroethyl) and chloroalkyl. The term “hydroxyl,” as used herein, represents an -OH group. The term “oxo,” as used herein, refers to a substituent having the structure =O, where there is a double bond between an atom and an oxygen atom. The term “carbonyl,” as used herein, refers to a group having the structure: . The term “thiocarbonyl,” as used herein, refers to a group having the structure: The term “phosphate,” as used herein, represents the group having the structure: . The term “phosphoryl,” as used herein, represents the group having the structure: or . The term “sulfonyl,” as used herein, represents the group having the structure: . The term “imino,” as used herein, represents the group including C=N (e.g., including the structure: For example, an imino group may have any one of the following structures: , where each of Ri1and Ri2is H or any one of the substituents described herein (e.g., C1-C20alkyl); each of Ri3and Ri4is a methylene that is unsubstituted or substituted with one or more of the substituents described herein (e.g., C1-C20alkyl); and each of i1 and i2 is, independently, 0, 1, 2, or 3. The term “oxime,” as used herein, represents the group including C=N-O (e.g., including the structure The term “N-protecting group,” as used herein, represents those groups intended to protect an amino group against undesirable reactions during synthetic procedures. Commonly used N-protecting groups are disclosed in Greene, “Protective Groups in Organic Synthesis,” 5th Edition (John Wiley & Sons, New York, 2014), which is incorporated herein by reference. N-protecting groups include, e.g., acyl, aryloyl, and carbamyl groups such as formyl, acetyl, propionyl, pivaloyl, t-butylacetyl, 2-chloroacetyl, 2- bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, α-chlorobutyryl, benzoyl, carboxybenzyl (CBz), 4-chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl, and chiral auxiliaries such as protected or unprotected D, L or D, L-amino acid residues such as alanine, leucine, phenylalanine; sulfonyl-containing groups such as benzenesulfonyl and p-toluenesulfonyl; carbamate forming groups such as benzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl, p- nitrobenzyloxycarbonyl, 2-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl, 3,4- dimethoxybenzyloxycarbonyl, 3,5-dimethoxybenzyl oxycarbonyl, 2,4-dimethoxybenzyloxycarbonyl, 4-methoxybenzyloxycarbonyl, 2-nitro-4,5-dimethoxybenzyloxycarbonyl, 3,4,5-trimethoxybenzyloxycarbonyl, 1-(p-biphenylyl)-1-methylethoxycarbonyl, α,α-dimethyl- 3,5-dimethoxybenzyloxycarbonyl, benzhydryloxy carbonyl, t-butyloxycarbonyl (BOC), diisopropylmethoxycarbonyl, isopropyloxycarbonyl, ethoxycarbonyl, methoxycarbonyl, allyloxycarbonyl, 2,2,2,-trichloroethoxycarbonyl, phenoxycarbonyl, 4-nitrophenoxy carbonyl, fluorenyl-9-methoxycarbonyl (Fmoc), cyclopentyloxycarbonyl, adamantyloxycarbonyl, cyclohexyloxycarbonyl, and phenylthiocarbonyl; alkaryl groups such as benzyl, triphenylmethyl, and benzyloxymethyl; and silyl groups such as trimethylsilyl. The term “amino acid,” as used herein, means naturally occurring amino acids and non-naturally occurring amino acids. The term “naturally occurring amino acids,” as used herein, means amino acids including Ala, Arg, Asn, Asp, Cys, Gln, Glu, Gly, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val. The term “non-naturally occurring amino acid,” as used herein, means an alpha amino acid that is not naturally produced or found in a mammal. Examples of non-naturally occurring amino acids include D- amino acids; an amino acid having an acetylaminomethyl group attached to a sulfur atom of a cysteine; a pegylated amino acid; the omega amino acids of the formula NH2(CH2)nCOOH where n is 2-6, neutral nonpolar amino acids, such as sarcosine, t-butyl alanine, t-butyl glycine, N-methyl isoleucine, and norleucine; oxymethionine; phenylglycine; citrulline; methionine sulfoxide; cysteic acid; ornithine; diaminobutyric acid; 3-aminoalanine; 3-hydroxy-D-proline; 2,4-diaminobutyric acid; 2-aminopentanoic acid; 2-aminooctanoic acid, 2-carboxy piperazine; piperazine-2-carboxylic acid, 2-amino-4-phenylbutanoic acid; 3-(2-naphthyl)alanine, and hydroxyproline. Other amino acids are α-aminobutyric acid, α-amino-α- methylbutyrate, aminocyclopropane-carboxylate, aminoisobutyric acid, aminonorbornyl-carboxylate, L- cyclohexylalanine, cyclopentylalanine, L-N-methylleucine, L-N-methylmethionine, L-N-methylnorvaline, L- N-methylphenylalanine, L-N-methylproline, L-N-methylserine, L-N-methyltryptophan, D-ornithine, L-N- methylethylglycine, L-norleucine, α-methyl-aminoisobutyrate, α-methylcyclohexylalanine, D-α- methylalanine, D-α-methylarginine, D-α-methylasparagine, D-α-methylaspartate, D-α-methylcysteine, D- α-methylglutamine, D-α-methylhistidine, D-α-methylisoleucine, D-α-methylleucine, D-α-methyllysine, D-α- methylmethionine, D-α-methylornithine, D-α-methylphenylalanine, D-α-methylproline, D-α-methylserine, D-N-methylserine, D-α-methylthreonine, D-α-methyltryptophan, D-α-methyltyrosine, D-α-methylvaline, D- N-methylalanine, D-N-methylarginine, D-N-methylasparagine, D-N-methylaspartate, D-N-methylcysteine, D-N-methylglutamine, D-N-methylglutamate, D-N-methylhistidine, D-N-methylisoleucine, D-N- methylleucine, D-N-methyllysine, N-methylcyclohexylalanine, D-N-methylornithine, N-methylglycine, N- methylaminoisobutyrate, N-(1-methylpropyl)glycine, N-(2-methylpropyl)glycine, D-N-methyltryptophan, D- N-methyltyrosine, D-N-methylvaline, γ-aminobutyric acid, L-t-butylglycine, L-ethylglycine, L- homophenylalanine, L-α-methylarginine, L-α-methylaspartate, L-α-methylcysteine, L-α-methylglutamine, L-α-methylhistidine, L-α-methylisoleucine, L-α-methylleucine, L-α-methylmethionine, L-α-methylnorvaline, L-α-methylphenylalanine, L-α-methylserine, L-α-methyltryptophan, L-α-methylvaline, N-(N-(2,2- diphenylethyl) carbamylmethylglycine, 1-carboxy-1-(2,2-diphenyl-ethylamino) cyclopropane, 4- hydroxyproline, ornithine, 2-aminobenzoyl (anthraniloyl), D-cyclohexylalanine, 4-phenyl-phenylalanine, L- citrulline, α-cyclohexylglycine, L-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, L-thiazolidine-4- carboxylic acid, L-homotyrosine, L-2-furylalanine, L-histidine (3-methyl), N-(3-guanidinopropyl)glycine, O- methyl-L-tyrosine, O-glycan-serine, meta-tyrosine, nor-tyrosine, L-N,N′,N″-trimethyllysine, homolysine, norlysine, N-glycan asparagine, 7-hydroxy-1,2,3,4-tetrahydro-4-fluorophenylalanine, 4- methylphenylalanine, bis-(2-picolyl)amine, pentafluorophenylalanine, indoline-2-carboxylic acid, 2- aminobenzoic acid, 3-amino-2-naphthoic acid, asymmetric dimethylarginine, L-tetrahydroisoquinoline-1- carboxylic acid, D-tetrahydroisoquinoline-1-carboxylic acid, 1-amino-cyclohexane acetic acid, D / L- allylglycine, 4-aminobenzoic acid, 1-amino-cyclobutane carboxylic acid, 2 or 3 or 4-aminocyclohexane carboxylic acid, 1-amino-1-cyclopentane carboxylic acid, 1-aminoindane-1-carboxylic acid, 4-amino- pyrrolidine-2-carboxylic acid, 2-aminotetraline-2-carboxylic acid, azetidine-3-carboxylic acid, 4-benzyl- pyrolidine-2-carboxylic acid, tert-butylglycine, b-(benzothiazolyl-2-yl)-alanine, b-cyclopropyl alanine, 5,5- dimethyl-1,3-thiazolidine-4-carboxylic acid, (2R,4S)4-hydroxypiperidine-2-carboxylic acid, (2S,4S) and (2S,4R)-4-(2-naphthylmethoxy)-pyrolidine-2-carboxylic acid, (2S,4S) and (2S,4R)4-phenoxy-pyrrolidine-2- carboxylic acid, (2R,5S)and(2S,5R)-5-phenyl-pyrrolidine-2-carboxylic acid, (2S,4S)-4-amino-1-benzoyl- pyrrolidine-2-carboxylic acid, t-butylalanine, (2S,5R)-5-phenyl-pyrrolidine-2-carboxylic acid, 1- aminomethyl-cyclohexane-acetic acid, 3,5-bis-(2-amino)ethoxy-benzoic acid, 3,5-diamino-benzoic acid, 2- methylamino-benzoic acid, N-methylanthranylic acid, L-N-methylalanine, L-N-methylarginine, L-N- methylasparagine, L-N-methylaspartic acid, L-N-methylcysteine, L-N-methylglutamine, L-N- methylglutamic acid, L-N-methylhistidine, L-N-methylisoleucine, L-N-methyllysine, L-N-methylnorleucine, L-N-methylornithine, L-N-methylthreonine, L-N-methyltyrosine, L-N-methylvaline, L-N-methyl-t- butylglycine, L-norvaline, α-methyl-γ-aminobutyrate, 4,4′-biphenylalanine, α-methylcylcopentylalanine, α- methyl-α-napthylalanine, α-methylpenicillamine, N-(4-aminobutyl)glycine, N-(2-aminoethyl)glycine, N-(3- aminopropyl)glycine, N-amino-α-methylbutyrate, α-napthylalanine, N-benzylglycine, N-(2- carbamylethyl)glycine, N-(carbamylmethyl)glycine, N-(2-carboxyethyl)glycine, N-(carboxymethyl)glycine, N-cyclobutylglycine, N-cyclodecylglycine, N-cycloheptylglycine, N-cyclohexylglycine, N-cyclodecylglycine, N-cylcododecylglycine, N-cyclooctylglycine, N-cyclopropylglycine, N-cycloundecylglycine, N-(2,2- diphenylethyl)glycine, N-(3,3-diphenylpropyl)glycine, N-(3-guanidinopropyl)glycine, N-(1- hydroxyethyl)glycine, N-(hydroxyethyl))glycine, N-(imidazolylethyl))glycine, N-(3-indolylyethyl)glycine, N- methyl-γ-aminobutyrate, D-N-methylmethionine, N-methylcyclopentylalanine, D-N-methylphenylalanine, D-N-methylproline, D-N-methylthreonine, N-(1-methylethyl)glycine, N-methyl-napthylalanine, N- methylpenicillamine, N-(p-hydroxyphenyl)glycine, N-(thiomethyl)glycine, penicillamine, L-α-methylalanine, L-α-methylasparagine, L-α-methyl-t-butylglycine, L-methylethylglycine, L-α-methylglutamate, L-α- methylhomophenylalanine, N-(2-methylthioethyl)glycine, L-α-methyllysine, L-α-methylnorleucine, L-α- methylornithine, L-α-methylproline, L-α-methylthreonine, L-α-methyltyrosine, L-N-methyl- homophenylalanine, N-(N-(3,3-diphenylpropyl) carbamylmethylglycine, L-pyroglutamic acid, D- pyroglutamic acid, O-methyl-L-serine, O-methyl-L-homoserine, 5-hydroxylysine, α-carboxyglutamate, phenylglycine, L-pipecolic acid (homoproline), L-homoleucine, L-lysine (dimethyl), L-2-naphthylalanine, L- dimethyldopa or L-dimethoxy-phenylalanine, L-3-pyridylalanine, L-histidine (benzoyloxymethyl), N- cycloheptylglycine, L-diphenylalanine, O-methyl-L-homotyrosine, L-β-homolysine, O-glycan-threoine, Ortho-tyrosine, L-N,N′-dimethyllysine, L-homoarginine, neotryptophan, 3-benzothienylalanine, isoquinoline-3-carboxylic acid, diaminopropionic acid, homocysteine, 3,4-dimethoxyphenylalanine, 4- chlorophenylalanine, L-1,2,3,4-tetrahydronorharman-3-carboxylic acid, adamantylalanine, symmetrical dimethylarginine, 3-carboxythiomorpholine, D-1,2,3,4-tetrahydronorharman-3-carboxylic acid, 3- aminobenzoic acid, 3-amino-1-carboxymethyl-pyridin-2-one, 1-amino-1-cyclohexane carboxylic acid, 2- aminocyclopentane carboxylic acid, 1-amino-1-cyclopropane carboxylic acid, 2-aminoindane-2-carboxylic acid, 4-amino-tetrahydrothiopyran-4-carboxylic acid, azetidine-2-carboxylic acid, b-(benzothiazol-2-yl)- alanine, neopentylglycine, 2-carboxymethyl piperidine, b-cyclobutyl alanine, allylglycine, diaminopropionic acid, homo-cyclohexyl alanine, (2S,4R)- 4-hydroxypiperidine-2-carboxylic acid, octahydroindole-2- carboxylic acid, (2S,4R) and (2S,4R)-4-(2-naphthyl), pyrrolidine-2-carboxylic acid, nipecotic acid, (2S,4R)and (2S,4S)-4-(4-phenylbenzyl) pyrrolidine-2-carboxylic acid, (3S)-1-pyrrolidine-3-carboxylic acid, (2S,4S)-4-tritylmercapto-pyrrolidine-2-carboxylic acid, (2S,4S)-4-mercaptoproline, t-butylglycine, N,N- bis(3-aminopropyl)glycine, 1-amino-cyclohexane-1-carboxylic acid, N-mercaptoethylglycine, and selenocysteine. In some embodiments, amino acid residues may be charged or polar. Charged amino acids include alanine, lysine, aspartic acid, or glutamic acid, or non-naturally occurring analogs thereof. Polar amino acids include glutamine, asparagine, histidine, serine, threonine, tyrosine, methionine, or tryptophan, or non-naturally occurring analogs thereof. It is specifically contemplated that in some embodiments, a terminal amino group in the amino acid may be an amido group or a carbamate group. As used herein, the term “percent (%) identity” refers to the percentage of amino acid residues of a candidate sequence that are identical to the amino acid residues of a reference sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity (i.e., gaps can be introduced in one or both of the candidate and reference sequences for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). Alignment for purposes of determining percent identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. In some embodiments, the percent amino acid sequence identity of a given candidate sequence to, with, or against a given reference sequence (which can alternatively be phrased as a given candidate sequence that has or includes a certain percent amino acid sequence identity to, with, or against a given reference sequence) is calculated as follows: 100 x (fraction of A / B) where A is the number of amino acid residues scored as identical in the alignment of the candidate sequence and the reference sequence, and where B is the total number of amino acid residues in the reference sequence. In some embodiments where the length of the candidate sequence does not equal to the length of the reference sequence, the percent amino acid sequence identity of the candidate sequence to the reference sequence would not equal to the percent amino acid sequence identity of the reference sequence to the candidate sequence. Two polynucleotide or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence as described above. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity. A “comparison window” as used herein, refers to a segment of at least about 15 contiguous positions, about 20 contiguous positions, about 25 contiguous positions, or more (e.g., about 30 to about 75 contiguous positions, or about 40 to about 50 contiguous positions), in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. The term “treating” or “to treat,” as used herein, refers to a therapeutic treatment of a disease (e.g., cancer) in a subject. In some embodiments, a therapeutic treatment may slow the progression of the disease, improve the subject’s outcome, and / or eliminate tumors. In some embodiments, a therapeutic treatment of the disease in a subject may alleviate or ameliorate of one or more symptoms or conditions associated with the disease, diminish the extent of the symptoms, stabilize (i.e., not worsening) the state of the disease, prevent the spread of the disease, and / or delay or slow the progress of the disease, as compare the state and / or the condition of the disease in the absence of the therapeutic treatment. The term “average value of T,” as used herein, refers to the mean number of monomers or dimers of CD73 inhibitors conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide within a population of conjugates. In some embodiments, within a population of conjugates, the average number of monomers of CD73 inhibitor or dimers of CD73 inhibitors conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide may be from 1 to 20 (e.g., the average value of T is 1 to 2, 1 to 3, 1 to 4, 1 to 5, 5 to 10, 10 to 15, or 15 to 20). In some embodiments, the average value of T is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. The term “subject,” as used herein, can be a human or non-human primate. The term “therapeutically effective amount,” as used herein, refers to an amount, e.g., pharmaceutical dose, effective in inducing a desired effect in a subject or in treating a subject having a condition or disorder described herein. It is also to be understood herein that a “therapeutically effective amount” may be interpreted as an amount giving a desired therapeutic and / or preventative effect, taken in one or more doses or in any dosage or route, and / or taken alone or in combination with other therapeutic agents. For example, in the context of administering a polypeptide or conjugate thereof as described herein that is used for the treatment of a disease described herein, an effective amount of a polypeptide or conjugate thereof is, for example, an amount sufficient to prevent, slow down, or reverse the progression of the disease as compared to the response obtained without administration of the polypeptide or conjugate thereof. As used herein, the term “pharmaceutical composition” refers to a medicinal or pharmaceutical formulation that contains at least one active ingredient as well as one or more excipients and diluents to enable the active ingredient suitable for the method of administration. The pharmaceutical composition of the present disclosure includes pharmaceutically acceptable components that are compatible with a polypeptide or conjugate thereof as described herein. As used herein, the term “pharmaceutically acceptable carrier” refers to an excipient or diluent in a pharmaceutical composition. For example, a pharmaceutically acceptable carrier may be a vehicle capable of suspending or dissolving the active conjugate. The pharmaceutically acceptable carrier must be compatible with the other ingredients of the formulation and not deleterious to the recipient. In the present disclosure, the pharmaceutically acceptable carrier must provide adequate pharmaceutical stability to a polypeptide or conjugate thereof as described herein. The nature of the carrier differs with the mode of administration. For example, for oral administration, a solid carrier is preferred; for intravenous administration, an aqueous solution carrier (e.g., WFI, and / or a buffered solution) is generally used. The term “pharmaceutically acceptable salt,” as used herein, represents salts of the conjugates described herein that are, within the scope of sound medical judgment, suitable for use in methods described herein without undue toxicity, irritation, and / or allergic response. Pharmaceutically acceptable salts are well known in the art. For example, pharmaceutically acceptable salts are described in: Pharmaceutical Salts: Properties, Selection, and Use (Eds. P.H. Stahl and C.G. Wermuth), Wiley-VCH, 2008. The salts can be prepared in situ during the final isolation and purification of the conjugates described herein or separately by reacting the free base group with a suitable organic acid. The term “about,” as used herein, indicates a deviation of ±5%. For example, about 10% refers to from 9.5% to 10.5%. The term “triple negative breast cancer,” as used herein, refers to a breast cancer that is estrogen receptor-negative (ER-negative), progesterone receptor-negative (PR-negative), and human epidermal growth factor receptor-2-negative (HER2-negative). The term “combined positive score (CPS),” as used herein, refers to the number of PD-L1– staining cells divided by the total number of viable tumor cells, multiplied by 100. The term “PD-L1 positive,” as used herein, refers to a subject with cancer having PD-L1 staining defined as positive by any FDA approved PD-L1 complementary diagnostic immunohistochemistry assay. For triple negative breast cancer, a subject is PD-L1 positive if the subject has a CPS of 10 or more. Any values provided in a range of values include both the upper and lower bounds, and any values contained within the upper and lower bounds. Other features and advantages of the conjugates described herein will be apparent in the following Detailed Description and the claims. Description of the Drawings FIG.1 is a graph showing the reduction in tumor volume in transgenic mice by Conjugate 172e on Day 25. FIG.2 is a graph showing the effect of Conjugate 172e on survival of transgenic mice at study end. FIG.3 is a graph showing the tumor volume of hPD-1 / PD-L1 mice treated with various test articles over 21 days. FIG.4 is a graph showing the average tumor volume of all study groups on Day 21. FIGs.5A and 5B are graphs showing the binding affinities of various test articles to human PD-1 (FIG.5A) and to CD8+ T-cells (FIG.5B). FIG.6 is a graph showing tumor volume over time for transgenic mice treated with SEQ ID NO: 205 and vehicle only. FIG.7 is a graph showing tumor volume over time for transgenic mice treated with Conjugate 172e and vehicle only. FIG.8 is a graph showing the activity of Conjugate 172e and OP-5244 in a peripheral blood mononuclear cell (PBMC) re-activation assay using CD25+ as a read-out. FIG.9 is a box plot of mice tumor volumes on Day 28 after treatment with various test articles. FIG.10A is a survival curve of mice treated with either vehicle, 10 mg / kg SEQ ID NO: 205, or 10 mg / kg Conjugate 172e. FIG.10B is a survival curve of mice treated with either vehicle, 1 mg / kg SEQ ID NO: 205, or 1 mg / kg Conjugate 172e. FIG.11A is a graph showing plasma levels of SEQ ID NO: 205 in mice over time. FIG.11B is a graph showing plasma levels of Conjugate 172e in mice over time. FIG.12A-12C are bar charts summarizing data obtained from the one-way mixed lymphocyte reaction (MLR) assay. The response of each test article on the induction of three cytokines INF-γ (FIG. 12A), IL-2 (FIG.12B), and TNF-α (FIG.12C) was determined after 4 days of co-incubation of CD4+T cells with mature dendritic cells (mDCs). FIG.13A-13C are bar charts summarizing data obtained from the one-way MLR assay with AMP as second inhibitory signal. The response of test article in the presence of 30 µM AMP (FIG.13A), 100 µM AMP (FIG.13B), or 300 µM AMP (FIG.13C) on the induction of three cytokines INF-γ, IL-2 and TNF- α was determined after 4 days of co-incubation of CD4+T cells with mature dendritic cells (mDCs). FIGs.14A-14C are bar charts summarizing data obtained from the one-way MLR assay with AMP as second inhibitory signal. In this assay, the response of various test articles in the presence of 300 µM AMP on the induction of three cytokines: INF-γ (FIG.14A), TNF-α (FIG.14B), and IL-2 (FIG.14C) was determined after 4 days of co-incubation of CD4+ T cells with mDCs. Detailed Description This disclosure relates to conjugates including a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to a moiety that binds to or inhibits CD73. In particular, such conjugates contain monomers or dimers of a moiety that binds to or inhibits CD73 conjugated to an Fc monomer or Fc domain. The CD73 inhibitor (e.g., adenosine monophosphate, adenosine bisphosphate, or an analog thereof) in the conjugate targets CD73. The Fc monomers or Fc domains in the conjugates bind to FcγRs (e.g., FcRn, FcγRI, FcγRIIa, FcγRIIc, FcγRIIIa, and FcγRIIIb) on immune cells, e.g., neutrophils, to activate phagocytosis and effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC). The featured conjugates exhibit desirable tissue distribution (e.g., lung distribution). This disclosure also provides pharmaceutical compositions including such conjugates and uses of such conjugates in the treatment of cancer. I. Conjugates Provided herein are synthetic conjugates that include a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide conjugated to one or more CD73 inhibitors (e.g., a CD73 inhibitor of formula (A), (A- I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A-II), (A-IIa), (A-IIb), (A-IIb-1), or (A-IIb-2)) or one or more dimers of two CD73 inhibitors. The dimers of two CD73 inhibitors include a CD73 inhibitor (e.g., a first CD73 inhibitor of formula (A), (A-I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A-II), (A-IIa), (A-IIb), (A-IIb-1), or (A-IIb-2)) and a second CD73 inhibitor (e.g., a second CD73 inhibitor of formula (A), (A-I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A-II), (A-IIa), (A-IIb), (A-IIb-1), or (A-IIb-2)). In the context of dimers, e.g., of formula (D-I), the first and second CD73 inhibitors are linked to each other by way of a linker. Conjugates of the disclosure include CD73 inhibitor monomers and dimers conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. The Fc domain in the conjugates described herein binds to the FcγRs (e.g., FcRn, FcγRI, FcγRIIa, FcγRIIc, FcγRIIIa, and FcγRIIIb) on immune cells. The binding of the Fc domain in the conjugates described herein to the FcγRs on immune cells activates phagocytosis and effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC). Conjugates provided herein are described by any one of formulas (D-I) or (M-I). In some embodiments, the conjugates described herein include one or more monomers of CD73 inhibitors conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. In some embodiments, the conjugates described herein include one or more dimers of CD73 inhibitors conjugated to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. In some embodiments, when n is 2, E (an Fc domain monomer) dimerizes to form an Fc domain. Conjugates described herein may be synthesized using available chemical synthesis techniques in the art. In cases where a functional group is not available for conjugation, a molecule may be derivatized using conventional chemical synthesis techniques that are well known in the art. In some embodiments, the conjugates described herein contain one or more chiral centers. The conjugates include each of the isolated stereoisomeric forms as well as mixtures of stereoisomers in varying degrees of chiral purity, including racemic mixtures. It also encompasses the various diastereomers, enantiomers, and tautomers that can be formed. Conjugates of monomers of CD73 inhibitors linked to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide In some embodiments, the conjugates described herein include a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more monomers of CD73 inhibitors, e.g., a conjugate described by formula (M-I). Conjugates of a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide and one or more monomers of CD73 inhibitors may be formed by linking the scFv-Fc domain monomer polypeptide or the scFv-Fc domain polypeptide to each of the monomers of CD73 inhibitors through a linker, such as any of the linkers described herein. In the conjugates having a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more monomers of CD73 inhibitors described herein, the squiggly line connected to E indicates that one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) monomers of CD73 inhibitors may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. In some embodiments, when n is 1, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) monomers of CD73 inhibitors may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. In some embodiments, when n is 2, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) monomers of CD73 inhibitors may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. The squiggly line in the conjugates described herein is not to be construed as a single bond between one or more monomers of CD73 inhibitors and an atom in the Fc domain monomer or Fc domain. In some embodiments, when T is 1, one monomer of CD73 inhibitor may be attached to an atom in the Fc domain monomer or Fc domain. In some embodiments, when T is 2, two monomers of CD73 inhibitors may be attached to an atom in the Fc domain monomer or Fc domain. In some embodiments, when T is greater than 1 (e.g., T is 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20), each A1-L may be independently selected (e.g., independently selected from any of the A1-L structures described herein). In some embodiments, E may be conjugated to 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different A1-L moieties. In some embodiments, E is conjugated to a first A1-L moiety, and a second A1-L, moiety. In some embodiments, A1of each of the first A1-L moiety and the second A1-L moiety is independently selected from any one of formulas (A), (A-I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A- II), (A-IIa), (A-IIb), (A-IIb-1), and (A-IIb-2). In some embodiments, the first A1-L moiety is conjugated specifically to lysine residues of E (e.g., the nitrogen atoms of surface exposed lysine residues of E), and the second A1-L moiety is conjugated specifically to cysteine residues of E (e.g., the sulfur atoms of surface exposed cysteine residues of E). In some embodiments, the first A1-L moiety is conjugated specifically to cysteine residues of E (e.g., the sulfur atoms of surface exposed cysteine residues of E), and the second A1-L moiety is conjugated specifically to lysine residues of E (e.g., the nitrogen atoms of surface exposed lysine residues of E). As described further herein, a linker in a conjugate having a polypeptide that contains an anti-PD- 1 scFv-Fc polypeptide covalently linked to one or more monomers of the CD73 inhibitors described herein (e.g., L) may be a divalent structure having two arms. One arm in a divalent linker may be attached to the monomer of the CD73 inhibitor and the other arm may be attached to the Fc domain monomer or Fc domain. In conjugates having a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more monomers of CD73 inhibitors, as represented by the formulae above, when n is 2, two Fc domain monomers (each Fc domain monomer is represented by E) dimerize to form an Fc domain. Conjugates of dimers of CD73 inhibitors linked to a polypeptide that contains an anti-PD-1 scFv- Fc polypeptide The conjugates described herein include a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more dimers of CD73 inhibitors, e.g., a conjugate described by formula (D-I). The dimers of two CD73 inhibitors include a first CD73 inhibitor (e.g., a first CD73 inhibitor of formula (A), (A-I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A-II), (A-IIa), (A-IIb), (A-IIb-1), or (A-IIb-2)) and a second CD73 inhibitor (e.g., a second CD73 inhibitor of formula (A), (A-I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A-II), (A-IIa), (A-IIb), (A-IIb-1), or (A-IIb-2)). The first and second CD73 inhibitors are linked to each other by way of a linker, such as a linker described herein. In some embodiments of the dimers of CD73 inhibitors, the first and second CD73 inhibitors are the same. In some embodiments, the first and second CD73 inhibitors are different. In some embodiments, when T is greater than 1 (e.g., T is 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20), each A1-L-A2may be independently selected (e.g., independently selected from any of the A1-L-A2structures described herein). In some embodiments, E may be conjugated to 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different A1-L-A2moieties. In some embodiments, E is conjugated to a first A1-L-A2moiety, and a second A1-L-A2, moiety. In some embodiments, each of A1and A2of the first A1-L-A2moiety and of the second A1-L-A2moiety are independently selected from any one of formulas (A), (A-I), (A-Ia), (A-Ib), (A-Ib-1), (A-Ib-2), (A-II), (A-IIa), (A-Iib), (A-Iib-1), or (A-Iib-2). In some embodiments, the first A1-L-A2moiety is conjugated specifically to lysine residues of E (e.g., the nitrogen atoms of surface exposed lysine residues of E), and the second A1-L-A2moiety is conjugated specifically to cysteine residues of E (e.g., the sulfur atoms of surface exposed cysteine residues of E). In some embodiments, the first A1-L-A2moiety is conjugated specifically to cysteine residues of E (e.g., the sulfur atoms of surface exposed cysteine residues of E), and the second A1-L-A2moiety is conjugated specifically to lysine residues of E (e.g., the nitrogen atoms of surface exposed lysine residues of E). In the conjugates described herein, the squiggly line connected to E indicates that one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) dimers of CD73 inhibitors may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. In some embodiments, when n is 1, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) dimers of CD73 inhibitors may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. In some embodiments, when n is 2, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) dimers of CD73 inhibitors may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. The squiggly line in the conjugates described herein is not to be construed as a single bond between one or more dimers of CD73 inhibitors and an atom in the Fc domain monomer or Fc domain. In some embodiments, when T is 1, one dimer of CD73 inhibitors may be attached to an atom in the Fc domain monomer or Fc domain. In some embodiments, when T is 2, two dimers of CD73 inhibitors may be attached to an atom in the Fc domain monomer or Fc domain. As described further herein, a linker in a conjugate described herein may be a branched structure. As described further herein, a linker in a conjugate described herein may be a multivalent structure, e.g., a divalent or trivalent structure having two or three arms, respectively. In some embodiments when the linker has three arms, two of the arms may be attached to the first and second CD73 inhibitors and the third arm may be attached to the Fc domain monomer or Fc domain. In conjugates having a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more dimers of CD73 inhibitors, as represented by the formulae above, when n is 2, two Fc domain monomers (each Fc domain monomer is represented by E) dimerize to form an Fc domain. II. Fc domain monomers and Fc domains The disclosure features compositions (e.g., conjugates) which include one or more Fc domain monomers. When two compositions including an Fc domain monomer dimerize, the resulting conjugate includes an Fc domain. An Fc domain monomer includes a hinge domain, a CH2 antibody constant domain, and a CH3 antibody constant domain. The Fc domain monomer can be of immunoglobulin antibody isotype IgG, IgE, IgM, IgA, or IgD. The Fc domain monomer can also be of any immunoglobulin antibody isotype (e.g., IgG1, IgG2a, IgG2b, IgG3, or IgG4). The Fc domain monomer can be of any immunoglobulin antibody allotype (e.g., IGHG1*01 (i.e., G1m(za)), IGHG1*07 (i.e., G1m(zax)), IGHG1*04 (i.e., G1m(zav)), IGHG1*03 (G1m(f)), IGHG1*08 (i.e., G1m(fa)), IGHG2*01, IGHG2*06, IGHG2*02, IGHG3*01, IGHG3*05, IGHG3*10, IGHG3*04, IGHG3*09, IGHG3*11, IGHG3*12, IGHG3*06, IGHG3*07, IGHG3*08, IGHG3*13, IGHG3*03, IGHG3*14, IGHG3*15, IGHG3*16, IGHG3*17, IGHG3*18, IGHG3*19, IGHG2*04, IGHG4*01, IGHG4*03, or IGHG4*02) (as described in, for example, Vidarsson et al. IgG subclasses and allotypes: from structure to effector function (Frontiers in Immunology.5(520):1-17 (2014)). The Fc domain monomer can also be of any species, e.g., human, murine, or mouse. A dimer of Fc domain monomers is an Fc domain that can bind to an Fc receptor, which is a receptor located on the surface of leukocytes. In some embodiments, an Fc domain monomer described herein may contain one or more amino acid substitutions, additions, and / or deletion relative to an Fc domain monomer having a sequence of any one of SEQ ID NOs: 1-120 and 283. In some embodiments, an Asn (e.g., N297) in an Fc domain monomer in the conjugates as described herein may be replaced by Ala (e.g., N297A), Gly (e.g., N297G), or Gln (e.g., N297Q) in order to prevent N-linked glycosylation. In some embodiments, the amino acid corresponding to N297 is substituted with Ala, Gly, or Gln. In some embodiments, an Fc domain monomer in a polypeptide or conjugate thereof as described herein includes an additional moiety for purification (e.g., a hexa-histidine peptide), or a signal sequence (e.g., IL2 signal sequence) attached to the N- or C-terminus of the Fc domain monomer. In some embodiments, an additional moiety for purification (e.g., a hexa-histidine peptide), or a signal sequence (e.g., IL2 signal sequence) attached to the N- or C-terminus of the Fc domain monomer is cleaved after expression of the polypeptide. In some embodiments, an Fc domain monomer in the compositions does not contain any type of antibody variable region, e.g., VH, VL, a complementarity determining region (CDR), or a hypervariable region (HVR). In some embodiments, an Fc domain monomer in a polypeptide or conjugate thereof as described herein may have a sequence that is at least 95% identical (e.g., 97%, 99%, or 99.5% identical) to the sequence of any one of SEQ ID NOs: 1-120 and 283, shown below. In some embodiments, an Fc domain monomer in the polypeptides or conjugates as described herein may include a sequence of any one of SEQ ID NOs: 1-120 and 283, shown below. SEQ ID NO: 1: mature human Fc IgG1, Z1is Cys or Ser, and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser NVNHKPSNTKVDKKVEPKSZ1DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPGK SEQ ID NO: 2: mature human Fc IgG1, Cys to Ser substitution (#), and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPGK SEQ ID NO: 3: mature human IgG1 Fc, Cys to Ser substitution (#), X4is Asp or Glu, and X5is Leu or Met NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 4: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 5: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 6: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGK SEQ ID NO: 7: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGK SEQ ID NO: 8: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 9: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 10: mature human Fc IgG1, Z1is Cys or Ser, and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser NVNHKPSNTKVDKKVEPKSZ1DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPG SEQ ID NO: 11: mature human Fc IgG1, Cys to Ser substitution (#), and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPG SEQ ID NO: 12: mature human IgG1 Fc, Cys to Ser substitution (#), X4is Asp or Glu, and X5is Leu or Met NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 13: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 14: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 15: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 16: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 17: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 18: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 19: mature human Fc IgG1, Z1is Cys or Ser, and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser VNHKPSNTKVDKKVEPKSZ1DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPGK SEQ ID NO: 20: mature human Fc IgG1, Cys to Ser substitution (#), and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPGK SEQ ID NO: 21: mature human IgG1 Fc, Cys to Ser substitution (#), X4is Asp or Glu, and X5is Leu or Met VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 22: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 23: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 24: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGK SEQ ID NO: 25: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGK SEQ ID NO: 26: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 27: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 28: mature human Fc IgG1, Z1is Cys or Ser, and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser VNHKPSNTKVDKKVEPKSZ1DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPG SEQ ID NO: 29: mature human Fc IgG1, Cys to Ser substitution (#), and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asp or Glu, and X5is Leu or Met, X6is Met or Leu, and X7is Asn or Ser VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVX6HEALHX7HYTQKSLSLSPG SEQ ID NO: 30: mature human IgG1 Fc, Cys to Ser substitution (#), X4is Asp or Glu, and X5is Leu or Met VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 31: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 32: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 33: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 34: mature human IgG1 Fc, Cys to Ser substitution (#), M428L, N434S mutations (Bold / Underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 35: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 36: mature human IgG1 Fc, Cys to Ser substitution (#), YTE triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 37: mature human Fc IgG1, J1is Asn or absent, J2is Lys or absent, Z1is Cys or Ser, and wherein X1is Met or Tyr, X2is Ser or Thr, X3is Thr or Glu, X4is Asn or Ala, X5is Leu or Asp, X6is Gln or His, X7is Asp or Glu, and X8is Leu or Met, X9is Met or Leu, and X10is Asn or Ser J1VNHKPSNTKVDKKVEPKSZ1DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLX1IX2RX3PEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVX5HX6DWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVX9HEALHX10HYTQKSLSLSPGJ2SEQ ID NO: 38: mature human Fc IgG1, Cys to Ser substitution (#), J1is Asn or absent, J2is Lys or absent, and wherein X4is Asn or Ala, X5is Leu or Asp, X6is Gln or His, X7is Asp or Glu, and X8is Leu or Met, and X10is Asn or Ser J1VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVX5HX6DWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHX10HYTQKSLSLSPGJ2SEQ ID NO: 39: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), J1is Asn or absent, J2is Lys or absent, wherein X4is Asn or Ala, X7is Asp or Glu, and X8is Leu or Met J1VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGJ2SEQ ID NO: 40: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), wherein X4is Asn or Ala, X7is Asp or Glu, and X8is Leu or Met NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 41: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), wherein X7is Asp or Glu and X8is Leu or Met NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 42: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 43: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 44: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 45: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 46: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 47: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 48: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 49: mature human Fc IgG1, Cys to Ser substitution (#), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 50: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), wherein X7is Asp or Glu and X8is Leu or Met NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 51: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 52: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 53: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 54: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 55: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 56: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 57: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 58: mature human Fc IgG1, Cys to Ser substitution (#), Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 59: mature human Fc IgG1, J1is Asn or absent, J2is Lys or absent, and wherein X4is Asn or Ala, X5is Leu or Asp, X6is Gln or His, X7is Asp or Glu, and X8is Leu or Met, and X10is Asn or Ser J1VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVX5HX6DWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHX10HYTQKSLSLSPGJ2SEQ ID NO: 60: mature human Fc IgG1, DHS triple mutation (bold and underlined), J1is Asn or absent, J2is Lys or absent, and wherein X4is Asn or Ala, X7is Asp or Glu, and X8is Leu or Met J1VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGJ2SEQ ID NO: 61: mature human Fc IgG1, DHS triple mutation (bold and underlined), wherein X4is Asn or Ala, and X7is Asp or Glu, and X8is Leu or Met NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYX4STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 62: mature human Fc IgG1, DHS triple mutation (bold and underlined), wherein X7is Asp or Glu and X8is Leu or Met NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 63: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 64: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 65: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 66: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 67: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 68: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 69: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 70: mature human Fc IgG1, DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 71: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), wherein X7is Asp or Glu and X8is Leu or Met NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRX7EX8TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 72: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 73: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 74: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 75: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 76: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 77: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGK SEQ ID NO: 78: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(fa) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 79: mature human Fc IgG1, Asn to Ala substitution (*), DHS triple mutation (bold and underlined), allotype G1m(f) (bold italics) VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 80: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics), Asn to Ala substitution (*) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 81: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(fa) (bold italics), Asn to Ala substitution (*) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 82: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics), YTE triple mutation (bold and underlined), Asn to Ala substitution (*) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 83: mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(fa) (bold italics), YTE triple mutation (bold and underlined), Asn to Ala substitution (*) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(*)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG In some embodiments, the variant Fc domain includes an amino acid substitution at position 246 (e.g., K246X where X is any amino acid that is not Lys, such as K246S, K246G, K246A, K246T, K246N, K246Q, K246R, K246H, K246E, or K246DC220S). In some embodiments, the variant Fc domain monomer includes at least the following mutations K246X, M252Y, S254T, and T256E, where X is not Lys. In some embodiments, the variant Fc domain monomer includes at least the following mutations K246X, V309D, Q311H, and N434S, where X is not Lys. In some embodiments, the variant Fc domain monomer includes at least the following mutations K246X, M428L, and N434S, where X is not Lys. In some embodiments, the variant Fc domain further includes a mutation of position 220, e.g., a C220S mutation. Amino acid substitutions are relative to a wild-type Fc monomer amino acid sequence, e.g., wild-type human IgG1 or IgG2. In some embodiments, a variant Fc domain monomer includes a sequence that is at least 95% identical (e.g., 97%, 99%, or 99.5% identical) to the sequence of any one of SEQ ID Nos: 84-112 and 115-120 shown below. In some embodiments, a variant Fc domain monomer includes the sequence of any one of SEQ ID Nos: 84-112 and 115-120 shown below. In some embodiments, a variant Fc domain monomer includes at least the following mutations K246X, M252Y, S254T, and T256E, where X is not Lys. In some embodiments, a variant Fc domain monomer includes at least the following mutations K246X, V309D, Q311H, and N434S, where X is not Lys. In some embodiments, a variant Fc domain monomer includes at least the following mutations K246X, M428L, and N434S, where X is not Lys. In some embodiments, the substitution at K246X is selected from Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp. In some embodiments, the substitution at K246X is Ser. SEQ ID NO: 84: mature human IgG1 Fc; X1(position 201) is Asn or absent; X2(position 220) is Cys or Ser; X3(position 246) is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X4(position 252) is Met or Tyr; X5(position 254) is Ser or Thr; X6(position 256) is Thr or Glu; X7(position 297) is Asn or Ala; X8(position 309) is Leu or Asp; X9(position 311) is Gln or His; X10(position 356) is Asp or Glu; and X11(position 358) is Leu or Met; X12(position 428) is Met or Leu; X13(position 434) is Asn or Ser; X14(position 447) is Lys or absent; N-terminal Fab residues are underlined; hinge residues are italicized X1VNHKPSNTKVDKKVEPKSX2DKTHTCPPCPAPELLGGPSVFLFPPX3PKDTLX4IX5RX6PEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX7STYRVVSVLTVX8HX9DWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX10EX11TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVX12HEALH X13HYTQKSLSLSPGX14SEQ ID NO: 85: mature human IgG1 Fc; Cys to Ser substitution (#); X1is Asn or absent; X2is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X3is Asn or Ala; X4is Asp or Glu; and X5is Leu or Met; X6is Lys or absent; N-terminal Fab residues are underlined; hinge residues are italicized X1VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX2PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX3STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGX6SEQ ID NO: 86: mature human IgG1 Fc; Cys to Ser substitution (#); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asn or Ala; X3is Asp or Glu; and X4is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX2STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX3EX4TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 87: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); X1is Asp or Glu; and X2is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 88: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 89: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 90: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Ala substitution (^); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asp or Glu; and X3is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX2EX3TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 91: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); Asn to Ala substitution (^); X1is Asp or Glu; and X2is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 92: mature human IgG1 Fc; Cys to Ser substitution (#); YTE triple mutation (bold and underlined); X1is Asn or absent; X2is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X3is Asn or Ala; X4is Asp or Glu; and X5is Leu or Met; X6is Lys or absent; N-terminal Fab residues are underlined; hinge residues are italicized X1VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX2PKDTLYITREPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX3STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGX6 SEQ ID NO: 93: mature human IgG1 Fc; Cys to Ser substitution (#); YTE triple mutation (bold and underlined); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asn or Ala; X3is Asp or Glu; and X4is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYX2STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRX3EX4TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 94: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); YTE triple mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLYITREPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 95: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); YTE triple mutation (bold and underlined); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLYITREPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 96: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); YTE triple mutation (bold and underlined); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLYITREPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 97: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Ala substitution (^); YTE triple mutation (bold and underlined); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asp or Glu; and X3is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLYITREPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX2EX3TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 98: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); Asn to Ala substitution (^); YTE triple mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N- terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLYITREPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 99: mature human IgG1 Fc; Cys to Ser substitution (#); DHS triple mutation (bold and underlined); X1is Asn or absent; X2is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X3is Asn or Ala; X4is Asp or Glu; and X5is Leu or Met; X6is Lys or absent; N-terminal Fab residues are underlined; hinge residues are italicized X1VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX2PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX3STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPGX6SEQ ID NO: 100: mature human IgG1 Fc; Cys to Ser substitution (#); DHS triple mutation (bold and underlined); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asn or Ala; X3is Asp or Glu; and X4is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX2STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX3EX4TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 101: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); DHS triple mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 102: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); DHS triple mutation (bold and underlined); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 103: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); DHS triple mutation (bold and underlined); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 104: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Ala substitution (^); DHS triple mutation (bold and underlined); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asp or Glu; and X3is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX2EX3TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 105: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); Asn to Ala substitution (^); DHS triple mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N- terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVDHHDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHSHYTQKSLSLSPG SEQ ID NO: 106: mature human IgG1 Fc; Cys to Ser substitution (#); LS double mutation (bold and underlined); X1is Asn or absent; X2is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X3is Asn or Ala; X4is Asp or Glu; and X5is Leu or Met; X6is Lys or absent; N-terminal Fab residues are underlined; hinge residues are italicized X1VNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX2PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX3STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX4EX5TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPGX6SEQ ID NO: 107: mature human IgG1 Fc; Cys to Ser substitution (#); LS double mutation (bold and underlined); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asn or Ala; X3is Asp or Glu; and X4is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYX2STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRX3EX4TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 108: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); LS double mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 109: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); LS double mutation (bold and underlined); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 110: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); LS double mutation (bold and underlined); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 111: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Ala substitution (^); LS double mutation (bold and underlined); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asp or Glu; and X3is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX2EX3TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 112: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); Asn to Ala substitution (^); LS double mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N- terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYA(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 113: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 114: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 115: mature human IgG1 Fc; Cys to Ser substitution (#);Lys to Ser substitution(*); LS double mutation (bold and underlined); Asn to Gln substitution (^); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 116: mature human IgG1 Fc; Cys to Ser substitution (#);LS double mutation (bold and underlined); Asn to Gln substitution (^); X1is Ser, Gly, Ala, Thr, Asn, Gln, Arg, His, Glu, or Asp; X2is Asp or Glu; and X3is Leu or Met; N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPX1PKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRX2EX3TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 117: mature human IgG1 Fc; Cys to Ser substitution (#); Lys to Ser substitution(*); Asn to Gln substitution (^); LS double mutation (bold and underlined); X1is Asp or Glu; and X2is Leu or Met; N- terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPS(*)PKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRX1EX2TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG SEQ ID NO: 118: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(f) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 119: mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized; GGGS insertion (bold, no italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 120: mature human IgG1 Fc; Cys to Ser substitution (#); allotype G1m(fa) (bold italics); N- terminal Fab residues are underlined; hinge residues are italicized; GGGS insertion (bold, no italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 283: mature human IgG1 Fc; Cys to Ser substitution (#); allotype G1m(fa) (bold italics); N- terminal Fab residues are underlined; hinge residues are italicized; GGGS insertion (bold, no italics) NVNHKPSNTKVDKKVEPKSS(#)DKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK As defined herein, an Fc domain includes two Fc domain monomers that are dimerized by the interaction between the CH3 antibody constant domains, as well as one or more disulfide bonds that form between the hinge domains of the two dimerizing Fc domain monomers. An Fc domain forms the minimum structure that binds to an Fc receptor, e.g., Fc-gamma receptors (i.e., Fcγ receptors (FcγR)), Fc-alpha receptors (i.e., Fcα receptors (FcαR)), Fc-epsilon receptors (i.e., Fcε receptors (FcεR)), and / or the neonatal Fc receptor (FcRn). In some embodiments, an Fc domain of the present disclosure binds to an Fcγ receptor (e.g., FcRn, FcγRI (CD64), FcγRIIa (CD32), FcγRIIb (CD32), FcγRIIIa (CD16a), FcγRIIIb (CD16b)), and / or FcγRIV and / or the neonatal Fc receptor (FcRn). In some embodiments, the Fc domain monomer or Fc domain of the disclosure is an aglycosylated Fc domain monomer or Fc domain (e.g., an Fc domain monomer that maintains engagement to an Fc receptor (e.g., FcRn). For example, the Fc domain is an aglycosylated IgG1 variants that maintains engagement to an Fc receptor (e.g., an IgG1 having an amino acid substitution at N297 and / or T299 of the glycosylation motif). Exemplary aglycosylated Fc domains and methods for making aglycosylated Fc domains are known in the art, for example, as described in Sazinsky S.L. et al., Aglycosylated immunoglobulin G1 variants productively engage activating Fc receptors, PNAS, 2008, 105(51):20167-20172, which is incorporated herein in its entirety. In some embodiments, the Fc domain or Fc domain monomer of the disclosure is engineered to enhance binding to the neonatal Fc receptor (FcRn). For example, the Fc domain may include the triple mutation corresponding to M252Y / S254T / T256E (YTE) (e.g., an IgG1, such as a human or humanized IgG1 having a YTE mutation). The Fc domain may include the single mutant corresponding to N434H (e.g., an IgG1, such as a human or humanized IgG1 having an N434H mutation). The Fc domain may include the single mutant corresponding to C220S (e.g., and IgG1, such as a human or humanized IgG1 having a C220S mutation). The Fc domain may include a quadruple mutant corresponding to C220S / L309D / Q311H / N434S (CDHS) (e.g., an IgG1, such as a human or humanized IgG1 having a DHS mutation). The Fc domain may include a triple mutant corresponding to L309D / Q311H / N434S (DHS) (e.g., an IgG1, such as a human or humanized IgG1 having a DHS mutation). The Fc domain may include a combination of one or more of the above-described mutations that enhance binding to the FcRn. Enhanced binding to the FcRn may increase the half-life Fc domain-containing conjugate. For example, incorporation of one or more amino acid mutations that increase binding to the FcRn (e.g., a YTE mutation, an LS mutation, or an N434H mutation) may increase the half-life of the conjugate by 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%.100%, 200%, 300%, 400%, 500% or more relative to a conjugate having the corresponding Fc domain without the mutation that enhances FcRn binding. Exemplary Fc domains with enhanced binding to the FcRN and methods for making Fc domains having enhanced binding to the FcRN are known in the art, for example, as described in Maeda, A. et al., Identification of human IgG1 variant with enhanced FcRn binding and without increased binding to rheumatoid factor autoantibody, MABS, 2017, 9(5):844-853, which is incorporated herein in its entirety. As used herein, an amino acid “corresponding to” a particular amino acid residue (e.g., of a particular SEQ ID NO.) should be understood to include any amino acid residue that one of skill in the art would understand to align to the particular residue (e.g., of the particular sequence). For example, any one of SEQ ID NOs: 1-120 and 283 may be mutated to include a YTE mutation, an LS mutation, and / or an N434H mutation by mutating the “corresponding residues” of the amino acid sequence. In some embodiments, the Fc domain or Fc domain monomer of the disclosure has the sequence of any one of SEQ ID NOs: 1-120 and 283 may further include additional amino acids at the N-terminus (Xaa)x and / or additional amino acids at the C-terminus (Xaa)z, wherein Xaa is any amino acid and x and z are a whole number greater than or equal to zero, generally less than 100, preferably less than 10 and more preferably 0, 1, 2, 3, 4, or 5. For example, the additional amino acids may be a single amino acid on the C-terminus corresponding to Lys330 of IgG1. In some embodiments, the Fc domain monomer includes less than about 300 amino acid residues (e.g., less than about 300, less than about 295, less than about 290, less than about 285, less than about 280, less than about 275, less than about 270, less than about 265, less than about 260, less than about 255, less than about 250, less than about 245, less than about 240, less than about 235, less than about 230, less than about 225, or less than about 220 amino acid residues). In some embodiments, the Fc domain monomer is less than about 40 kDa (e.g., less than about 35kDa, less than about 30kDa, less than about 25kDa). In some embodiments, the Fc domain monomer includes at least 200 amino acid residues (e.g., at least 210, at least 220, at least 230, at least 240, at least 250, at least 260, at least 270, at least 280, at least 290, or at least 300 amino residues). In some embodiments, the Fc domain monomer is at least 20 kDa (e.g., at least 25 kDa, at least 30 kDa, or at least 35 kDa). In some embodiments, the Fc domain monomer includes 200 to 400 amino acid residues (e.g., 200 to 250, 250 to 300, 300 to 350, 350 to 400, 200 to 300, 250 to 350, or 300 to 400 amino acid residues). In some embodiments, the Fc domain monomer is 20 to 40 kDa (e.g., 20 to 25 kDa, 25 to 30 kDa, 35 to 40 kDa, 20 to 30 kDa, 25 to 35 kDa, or 30 to 40 KDa). In some embodiments, the Fc domain monomer includes an amino acid sequence at least 90% identical (e.g., at least 95%, at least 98%) to the sequence of any one of SEQ ID NOs: 1-120 and 283, or a region thereof. In some embodiments, the Fc domain monomer includes the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283, or a region thereof. In some embodiments, the Fc domain monomer includes a region of any one of SEQ ID NOs: 1- 120 and 283, wherein the region includes positions 220, 252, 254, and 256. In some embodiments, the region includes at least 40 amino acid residues, at least 50 amino acid residues, at least 60 amino acid residues, at least 70 amino acids residues, at least 80 amino acids residues, at least 90 amino acid residues, at least 100 amino acid residues, at least 110 amino acid residues, at least 120 amino residues, at least 130 amino acid residues, at least 140 amino acid residues, at least 150 amino acid residues, at least 160 amino acid residues, at least 170 amino acid residues, at least 180 amino acid residues, at least 190 amino acid residues, or at least 200 amino acid residues. Activation of Immune Cells Fc-gamma receptors (FcγRs) bind the Fc portion of immunoglobulin G (IgG) and play important roles in immune activation and regulation. For example, the IgG Fc domains in immune complexes (Ics) engage FcγRs with high avidity, thus triggering signaling cascades that regulate immune cell activation. The human FcγR family contains several activating receptors (FcγRI, FcγRIIa, FcγRIIc, FcγRIIIa, and FcγRIIIb) and one inhibitory receptor (FcγRIIb). FcγR signaling is mediated by intracellular domains that contain immune tyrosine activating motifs (ITAMs) for activating FcγRs and immune tyrosine inhibitory motifs (ITIM) for inhibitory receptor FcγRIIb. In some embodiments, FcγR binding by Fc domains results in ITAM phosphorylation by Src family kinases; this activates Syk family kinases and induces downstream signaling networks, which include PI3K and Ras pathways. In the polypeptides or conjugates described herein, the polypeptide or conjugate bind to FcγRs (e.g., FcRn, FcγRI, FcγRIIa, FcγRIIc, FcγRIIIa, and FcγRIIIb) on immune cells and activate phagocytosis and effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC). Examples of immune cells that may be activated by the conjugates described herein include, but are not limited to, macrophages, neutrophils, eosinophils, basophils, lymphocytes, follicular dendritic cells, natural killer cells, and mast cells. Tissue distribution After a therapeutic enters the systemic circulation, it is distributed to the body’s tissues. Distribution is generally uneven because of differences in blood perfusion, tissue binding, regional pH, and permeability of cell membranes. The entry rate of a drug into a tissue depends on the rate of blood flow to the tissue, tissue mass, and partition characteristics between blood and tissue. Distribution equilibrium (when the entry and exit rates are the same) between blood and tissue is reached more rapidly in richly vascularized areas unless diffusion across cell membranes is the rate-limiting step. The size, shape, charge, target binding, FcRn and target binding mechanisms, route of administration, and formulation affect tissue distribution. In some instances, the polypeptides described herein may be optimized to distribute to lung tissue. In some instances, the polypeptides have a concentration ratio of distribution in epithelial lining fluid of at least 30% the concentration of the polypeptide in plasma within 2 hours after administration. In certain embodiments, ratio of the concentration is at least 45% within 2 hours after administration. In some embodiments, the ratio of concentration is at least 55% within 2 hours after administration. In particular, the ratio of concentration is at least 60% within 2 hours after administration. II. Complementarity-determining regions of the disclosure The disclosure features compositions (e.g., polypeptides and conjugates) which include complementarity-determining regions (CDRs) sequences from anti-PD-1 monoclonal antibodies. In some embodiments, the Fc domain may include three heavy chain variable regions and three light chain variable regions and binds to PD-1 (Table 3). In some embodiments, the polypeptide of each E includes three LCDRs and three HCDRs selected from SEQ ID NOs: 121-166. In some embodiments, the polypeptide includes LCDR1* (SEQ ID NO: 121), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1* (SEQ ID NO: 126), HCDR2* (SEQ ID NO: 129), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2a (SEQ ID NO: 130), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2b (SEQ ID NO: 131), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2c (SEQ ID NO: 132), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2d (SEQ ID NO: 133), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2e (SEQ ID NO: 134), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2f (SEQ ID NO: 135), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2g (SEQ ID NO: 136), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2a (SEQ ID NO: 130), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2b (SEQ ID NO: 131), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125) HCDR1a (SEQ ID NO: 127), HCDR2c (SEQ ID NO: 132), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2d (SEQ ID NO: 133), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI a (SEQ ID NO: 127), HCDR2e (SEQ ID NO: 134), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDR1a (SEQ ID NO: 127), HCDR2f (SEQ ID NO: 135), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO:

[0013] 124), LCDR3 (SEQ ID NO: 125), HCDRI a (SEQ ID NO: 127), HCDR2g (SEQ ID NO: 136), and HCDR3 (SEQ ID NO: 137).

[0014] In some embodiments, the polypeptide includes LCDRIa (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI b (SEQ ID NO: 128), HCDR2a (SEQ ID NO: 130), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRIa (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI b (SEQ ID NO: 128), HCDR2b (SEQ ID NO: 131), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI b (SEQ ID NO: 128), HCDR2c (SEQ ID NO: 132), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI b (SEQ ID NO: 128), HCDR2d (SEQ ID NO: 133), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRIa (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:

[0015] 125), HCDRI b (SEQ ID NO: 128), HCDR2e (SEQ ID NO: 134), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRIa (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI b (SEQ ID NO: 128), HCDR2f (SEQ ID NO: 135), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI a (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO: 125), HCDRI b (SEQ ID NO: 128), HCDR2g (SEQ ID NO: 136), and HCDR3 (SEQ ID NO: 137).

[0016] In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2a (SEQ ID NO: 130), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2b (SEQ ID NO: 131), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2c (SEQ ID NO: 132), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2d (SEQ ID NO: 133), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2e (SEQ ID NO: 134), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2f (SEQ ID NO: 135), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDRI b (SEQ ID NO: 123), LCDR2 (SEQ ID NO: 124), LCDR3 (SEQ ID NO:125), HCDRI b (SEQ ID NO: 128), HCDR2g (SEQ ID NO: 136), and HCDR3 (SEQ ID NO: 137). In some embodiments, the polypeptide includes LCDR1 (SEQ ID NO: 138), LCDR2 (SEQ ID NO: 139), LCDR3 (SEQ ID NO: 140), HCDR1 (SEQ ID NO: 141), HCDR2 (SEQ ID NO: 142), and HCDR3 (SEQ ID NO: 143). In some embodiments, the polypeptide includes LCDR1 (SEQ ID NO: 122), LCDR2 (SEQ ID NO: 144), LCDR3 (SEQ ID NO: 145), HCDR1 (SEQ ID NO: 146), HCDR2 (SEQ ID NO: 147), and HCDR3 (SEQ ID NO: 148). In some embodiments, the polypeptide includes LCDR1 (SEQ ID NO: 149), LCDR2 (SEQ ID NO: 150), LCDR3 (SEQ ID NO: 151), HCDR1 (SEQ ID NO: 152), HCDR2 (SEQ ID NO: 153), and HCDR3 (SEQ ID NO: 154). In some embodiments, the polypeptide includes LCDR1 (SEQ ID NO: 155), LCDR2 (SEQ ID NO: 156), LCDR3 (SEQ ID NO:157), HCDR1 (SEQ ID NO:158), HCDR2 (SEQ ID NO: 159), and HCDR3 (SEQ ID NO: 160). In some embodiments, the polypeptide includes LCDR1 (SEQ ID NO: 161), LCDR2 (SEQ ID NO: 162), LCDR3 (SEQ ID NO: 163), HCDR1 (SEQ ID NO: 164), HCDR2 (SEQ ID NO: 165), and HCDR3 (SEQ ID NO: 166). Table 3. CDR sequences of the polypeptides of the present disclosure

[0017] Nivolumab is a humanized, lgG4 monoclonal antibody that binds to human PD-1 , and its CDRs and variants thereof are incorporated herein by reference (see US Patent No. 7,943,743).

[0018] Pembrolizumab is a humanized, lgG4 monoclonal antibody that binds to human PD-1 , and its CDRs and variants thereof are incorporated herein by reference (see US Patent No. 8,354,509).

[0019] Cemiplimab is a humanized, lgG4 monoclonal antibody that binds to human PD-1 , and its CDRs and variants thereof are incorporated herein by reference (see US 9,987,500).

[0020] Dostarlimab is a humanized, lgG4 monoclonal antibody that binds to human PD-1 , and its CDRs and variants thereof are incorporated herein by reference (see US Patent No. 9,815,897). Retifanlimab is a humanized, lgG4 monoclonal antibody that binds to human PD-1 , and its CDRs and variants thereof are incorporated herein by reference (see US Patent No. 11 ,623,959). Tislelizumab is a humanized, IgG4 monoclonal antibody that binds to human PD-1, and its CDRs and variants thereof are incorporated herein by reference (see US Patent No.9,217,034). III. VL, VH, and ScFv sequences of the disclosure In some embodiments, VLis an anti-PD-1 light chain variable region and VHis an anti-PD-1 heavy chain variable region. In some embodiments, the polypeptide of each E includes one VLand one VH. In some embodiments, the polypeptide of each E includes a VLselected from SEQ ID NOs: 167-175 (Table 4). Table 4. VLsequences of the ScFv polypeptides of the present disclosure, CDRs are bolded In some embodiments, the polypeptide of each E includes a VHselected from SEQ ID NOs: 176- 204 (Table 5). Table 5. VHsequences of the polypeptides of the present disclosure, CDRs are bolded

[0021] In some embodiments, the polypeptide of each E is selected from SEQ ID NOs: 205-272 and 284. The C-terminal Lys of the Fc region may or may not be present, without affecting the structure or stability of the Fc region. The C-terminal Lys may be proteolytically cleaved upon expression of the polypeptide. In some embodiments of any of the polypeptide sequences described herein, the C-terminal Lys is optionally present or absent. SEQ ID NO: 205: CDRs bolded, Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 206: CDRs (bolded), Lys to Arg substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 207: CDRs bolded, Lys to Gln substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQ(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 208: CDRs bolded, Asn to Asp substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSD(^)SGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 209: CDRs bolded, Val to Ala substitution (^), Lys to Arg substitution (#), Fc underlined EIA(^)LTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSG TDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESG GGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(#)RYYADSVKGRFTISRDN SKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVD KKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 210: CDRs bolded, Val to Ala substitution (^), Lys to Arg substitution (#), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQA(^)QLVESG GGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(#)RYYADSVKGRFTISRDN SKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVD KKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 211: CDRs bolded, Lys to Arg substitution (^), Leu to Thr substitution (#), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTT(#)VTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDK KVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 212: CDRs bolded, Lys to Ser substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSS(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 213: CDRs bolded, Val to Ala substitution (^), Fc underlined EIA(^)LTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSG TDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESG GGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 214: CDRs bolded, Leu to Thr substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTT(^)VTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKV EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 215: CDRs bolded, Val to Glu substitution (^), Fc underlined EIE(^)LTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSG TDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESG GGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 216: CDRs bolded, Val to Ser substitution (^), Fc underlined EIS(^)LTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSG TDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESG GGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 217: CDRs bolded, Tyr to Ser substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSS(^)LAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSG TDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESG GGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 218: CDRs bolded, Gly to Glu substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGE (^)VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 219: CDRs bolded, Leu to Ser substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTS(^)VTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKV EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 220: CDRs bolded, Lys to Arg substitution (^), Fc underlined, Glycosylated Fc from Gln to Asn substitution (#) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYN(#)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 221: CDRs bolded, Fc underlined, Glycosylated Fc from Gln to Asn substitution (#) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYN(#)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 222: CDRs bolded, Lys to Arg substitution (^), Fc underlined, GGGS insertion in Fc bolded and italicized EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 223: CDRs bolded, Fc underlined, GGGS insertion in Fc bolded and italicized, Glycosylated Fc from Gln to Asn substitution (^) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYN(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 224: CDRs bolded, Lys to Arg substitution (^), Fc underlined, GGGS insertion in Fc bolded and italicized, Glycosylated Fc from Gln to Asn substitution (#) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSR(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYN(#)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 225: CDRs bolded, Lys to Asn substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSN(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 226: CDRs bolded, Fc underlined DIVMTQSPDSLAVSLGERATINCKSSESVSNDVAWYQQKPGQPPKLLINYAFHRFTGVPDRFSGSGYGT DFTLTISSLQAEDVAVYYCHQAYSSPYTFGQGTKLEIKGGGGSGGGGSGGGGSGGGGSQVQLQESGP GLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWIGVIYADGSTNYNPSLKSRVTISKDTSKNQVS LKLSSVTAADTAVYYCARAYGNYWYIDVWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSG GGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 227: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 228: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSHRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 229: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSERYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYQ(^)STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 230: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 231: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSHRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 232: CDRs bolded, (GGGGS)xin brackets, mature human IgG1 Fc, Cys to Ser substitution (#), allotype G1m(f) (bold italics) EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSERYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 233: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized; GGGS insertion (bolded and underlined) EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 234: CDRs bolded, (GGGGS)xlinker in brackets, mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized; GGGS insertion (bolded and underlined) EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSHRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 235: CDRs bolded, (GGGGS)xin brackets, mature human IgG1 Fc; Cys to Ser substitution (#); Asn to Gln substitution (^); allotype G1m(fa) (bold italics); N-terminal Fab residues are underlined; hinge residues are italicized; GGGS insertion (bolded and underlined) EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK[GGGGSGGGGSGGGGSGGGGS]QVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSERYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTARYYCATNDDYWGQGTKVEVSS[GGGGSGGGGSGGGGS]NVNHKPSNTKVDKK VEPKSS(#)DKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 236: CDRs (bolded), Lys to Glu substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSE(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 237: CDRs (bolded), Lys to His substitution (^), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSH(^)RYYADSVKGRFTISRDNSK NTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKK VEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 238: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGS GSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLV QSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTT DSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSGGGGSGGGGSGGGGSNVN HKPSNTKVDKKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 239: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGS GSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLV QSGG(^)G(*)VKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRV TLTTDSSTTTAYMELKSLQADDTAVYYCARRDYRFDMGFDYWGQGTLVTVSSGGGGSGGGGSGGGGS NVNHKPSNTKVDKKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 240: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYRESGVPARFSGS GSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLV QSGGGVKKPGASVKVDCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTT DSSTTTAYMELKSLQADDTAVYYCARRDYRFDMGFDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVN HKPSNTKVDKKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 241: CDRs (bolded), Fc underlined EIKLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGS GSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLV QSGKERKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTT DSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTRVTVSSGGGGSGGGGSGGGGSNVN HKPSNTKVDKKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 242: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSRRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 243: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 244: CDRs (bolded) , Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSRRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTSVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 245: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTSVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 246: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTARYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 247: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAKYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 248: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG KVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 249: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTHVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 250: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTDVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 251: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVEVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 252: CDRs (bolded), Fc underlined DIVMTQSPDSLAVSLGERATINCKSSESVSNDVAWYQQKPGQPPKLLINYAFHRFTGVPDRFSGSGYGT DFTLTISSLQAEDVAVYYCHQAYSSPYTFGQGTKLEIKGGGGSGGGGSGGGGSGGGGSQVQLQESGP GLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWIGVIYADGSTNYNPSLKSRVTISKDTSKNQVS LKLSSVTAADTAVYYCARAYGNYWYIDVWGQGTTVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDK KVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 253: CDRs (bolded), Fc underlined DIVMTQSPDSLAVSLGERATINCKSSESVSNDVAWYQQKPGQPPKLLINYAFHRFTGVPDRFSGSGYGT DFTLTISSLQAEDVAVYYCHQAYSSPYTFGQGTKLEIKGGGGSGGGGSGGGGSGGGGSQVQLQESGP GLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWIGVIYADGSTNYNPSLKSRVTISKDTSKNQVS LKLSSVTAADTAVYYCARAYGNYWYIDVWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPG SEQ ID NO: 254: CDRs (bolded), Fc underlined QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKN RVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSGGGGSGGGGSGGG GSGGGGSEIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGV PARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKGGGGSGGGGSGGGGSNVNH KPSNTKVDKKVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 255: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEGGGGSGGGGSGGGGSGVQLVESGGGVVQPGR SLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNTLFLQMN SLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVEPKSSDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPG SEQ ID NO: 256: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTKVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 257: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG SVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTKVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 258: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 259: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 260: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 261: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTKVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 262: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAKYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 263: CDRs (bolded), Fc underlined EIELTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG KVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 264: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEGGGGSGGGGSGGGGSGVQLVESGGGVVQPGR SLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNTLFLQMN SLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVEPKSSDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPG SEQ ID NO: 265: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSNVNHKPSNTKVDKKVEPKSSDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYQ STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPG SEQ ID NO: 266: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGKLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 267: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGGGSGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 268: CDRs (bolded), Fc underlined DIELTQSPDTLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGT DFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGG GVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKN TLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 269: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLQESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 270: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSTRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 271: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 272: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEPGGGGSGGGGSGPGVQLVESGGGVVQPGRSLR LDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNTLFLQMNSLR AEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVEPKSSDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPG SEQ ID NO: 284: CDRs (bolded), Fc underlined EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTD FTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSQRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSGGGGSGGGGSGGGGSNVNHKPSNTKVDKKVE PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 205. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 206. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 207. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 212. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 225. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 227. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 228. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 229. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 230. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 231. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 232. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 233. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 234. In some embodiments, the conjugate is any of Conjugate 7, Conjugate 44, or Conjugate 61 conjugated to SEQ ID NO: 235. IV. Linkers A linker refers to a linkage or connection between two or more components in a polypeptide or conjugate thereof described herein (e.g., between a peptide and an Fc domain monomer in a polypeptide described herein, between two CD73 inhibitors in a conjugate described herein, between a CD73 inhibitor and a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide in a conjugate described herein, and between a dimer of two CD73 inhibitors and a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide in a conjugate described herein). Linkers in conjugates having a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to monomers of CD73 inhibitors In a conjugate containing a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more monomers of CD73 inhibitors as described herein, a linker in the conjugate may be a divalent structure having two arms. One arm in a divalent linker may be attached to the monomer of CD73 inhibitor and the other arm may be attached to the polypeptide that contain an anti-PD-1 scFv-Fc polypeptide. In some embodiments, the one or more monomers of CD73 inhibitors in the conjugates described herein may each be, independently, connected to an atom in the polypeptide that contain an anti-PD-1 scFv-Fc polypeptide. In some embodiments, a linker is described by formula: J1-(Q1)g-(T1)h-(Q2)i-(T2)j-(Q3)k-(T3)l-(Q4)m-(T4)n-(Q5)o-J2wherein J1is a bond attached to A1; J2is a bond attached to E or is a functional group capable of reacting with a functional group conjugated to E (e.g., maleimide and cysteine, amine and activated carboxylic acid (e.g., carboxylic acid activated by tetrafluorophenyl or trifluorophenol), thiol and maleimide, activated sulfonic acid and amine, isocyanate and amine, azide and alkyne, and alkene and tetrazine); each of Q1, Q2, Q3, Q4, and Q5is, independently, optionally substituted C1-C40 alkylene, optionally substituted C1-C40 heteroalkylene, optionally substituted C1-C40 alkoxylene, optionally substituted C2-C20 alkenylene, optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene, optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene, or optionally substituted C2-C15 heteroarylene; each of T1, T2, T3, T4is, independently, O, S, NRi, P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, imino, or oximo; Riis H, optionally substituted C1-C20 alkyl, optionally substituted C1-C20 heteroalkyl, optionally substituted C2-C20 alkenyl, optionally substituted C2-C20 heteroalkenyl, optionally substituted C2-C20 alkynyl, optionally substituted C2-C20 heteroalkynyl, optionally substituted C3-C20 cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20 cycloalkenyl, optionally substituted C4-C20 heterocycloalkenyl, optionally substituted C8-C20 cycloalkynyl, optionally substituted C8-C20 heterocycloalkynyl, optionally substituted C5-C15 aryl, or optionally substituted C2-C15 heteroaryl; and each of g, h, i, j, k, l, m, n, and o is, independently, 0, 1, or 2. In some embodiments, each of g, h, i, j, k, l, m, n, and o is, independently, 0 or 1. In some embodiments, optionally substituted includes substitution with a polyethylene glycol (PEG). A PEG has a repeating unit structure (-CH2CH2O-)n, wherein n is an integer from 2 to 100. A polyethylene glycol may be selected any one of PEG2to PEG100(e.g., PEG2, PEG3, PEG4, PEG5, PEG5- PEG10, PEG10-PEG20, PEG20-PEG30, PEG30-PEG40, PEG50-PEG60, PEG60-PEG70, PEG70-PEG80, PEG80- PEG90, PEG90-PEG100). In some embodiments, J2may have two points of attachment to the Fc domain monomer or Fc domain (e.g., two J2). Linkers in conjugates having a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to dimers of CD73 inhibitors In a conjugate containing a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more dimers of CD73 inhibitors as described herein, a linker in the conjugate may be a branched structure. As described further herein, a linker in a conjugate described herein may be a multivalent structure, e.g., a divalent or trivalent structure having two or three arms, respectively. In some embodiments when the linker has three arms, two of the arms may be attached to the first and second CD73 inhibitors and the third arm may be attached to the polypeptide that contain an anti-PD-1 scFv-Fc polypeptide. In some embodiments when the linker has two arms, one arm may be attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide and the other arm may be attached to one of the two CD73 inhibitors. In other embodiments, a linker with two arms may be used to attach the two CD73 inhibitors on a conjugate containing a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more dimers of CD73 inhibitors. In some embodiments, a linker in a conjugate having a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more dimers of CD73 inhibitors is described by formula (D-L-I): wherein LAis described by formula GA1-(ZA1)g1-(YA1)h1-(ZA2)i1-(YA2)j1-(ZA3)k1-(YA3)l1-(ZA4)m1-(YA4)n1-(ZA5)o1- GA2; LBis described by formula GB1-(ZB1)g2-(YB1)h2-(ZB2)i2-(YB2)j2-(ZB3)k2-(YB3)l2-(ZB4)m2-(YB4)n2-(ZB5)o2-GB2; LCis described by formula GC1-(ZC1)g3-(YC1)h3-(ZC2)i3-(YC2)j3-(ZC3)k3-(YC3)l3-(ZC4)m3-(YC4)n3-(ZC5)o3-GC2; GA1is a bond attached to Qiin formula (D-L-I); GA2is a bond attached to the first CD73 inhibitor (e.g., A1); GB1is a bond attached to Qiin formula (D-L-I); GB2is a bond attached to the second CD73 inhibitor (e.g., A2); GC1is a bond attached to Qiin formula (D-L-I); GC2is a bond attached to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide or is a functional group capable of reacting with a functional group conjugated to E (e.g., maleimide and cysteine, amine and activated carboxylic acid, thiol and maleimide, activated sulfonic acid and amine, isocyanate and amine, azide and alkyne, and alkene and tetrazine); each of ZA1, ZA2, ZA3, ZA4, ZA5, ZB1, ZB2, ZB3, ZB4, ZB5, ZC1, ZC2, ZC3, ZC4, and ZC5is, independently, optionally substituted C1-C40 alkylene, optionally substituted C1-C40 heteroalkylene, optionally substituted C1-C40 alkoxylene, optionally substituted C2-C20 alkenylene, optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene, optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene, or optionally substituted C2-C15 heteroarylene; each of YA1, YA2, YA3, YA4, YB1, YB2, YB3, YB4, YC1, YC2, YC3, and YC4is, independently, O, S, NRi, P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, imino, or oximo; Riis H, optionally substituted C1-C20 alkyl, optionally substituted C1-C20 heteroalkyl, optionally substituted C2-C20 alkenyl, optionally substituted C2-C20 heteroalkenyl, optionally substituted C2-C20 alkynyl, optionally substituted C2-C20 heteroalkynyl, optionally substituted C3-C20 cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20 cycloalkenyl, optionally substituted C4-C20 heterocycloalkenyl, optionally substituted C8-C20 cycloalkynyl, optionally substituted C8-C20 heterocycloalkynyl, optionally substituted C5-C15 aryl, or optionally substituted C2-C15 heteroaryl; each of g1, h1, i1, j1, k1, l1, m1, n1, o1, g2, h2, i2, j2, k2, l2, m2, n2, o2, g3, h3, i3, j3, k3, l3, m3, n3, and o3 is, independently, 0 or 1; Q is a nitrogen atom, optionally substituted C1-C20 alkylene, optionally substituted C1-C20 heteroalkylene, optionally substituted C2-C20 alkenylene, optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene, optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene, or optionally substituted C2-C15 heteroarylene. In some embodiments, optionally substituted includes substitution with a PEG. A PEG has a repeating unit structure (-CH2CH2O-)n, wherein n is an integer from 2 to 100. A polyethylene glycol may be selected any one of PEG2to PEG100(e.g., PEG2, PEG3, PEG4, PEG5, PEG5-PEG10, PEG10-PEG20, PEG20-PEG30, PEG30-PEG40, PEG50-PEG60, PEG60-PEG70, PEG70-PEG80, PEG80-PEG90, PEG90-PEG100). In some embodiments, LCmay have two points of attachment to the Fc domain (e.g., two GC2). In some embodiments, L includes a polyethylene glycol (PEG) linker. A PEG linker includes a linker having the repeating unit structure (-CH2CH2O-)n, where n is an integer from 2 to 100. A polyethylene glycol linker may covalently join a CD73 inhibitor and E (e.g., in a conjugate of formula (M- I)). A polyethylene glycol linker may covalently join a first CD73 inhibitor and a second CD73 inhibitor (e.g., in a conjugate of formula (D-I)). A polyethylene glycol linker may covalently join a CD73 inhibitor dimer and E (e.g., in a conjugate of formula (D-I)). A polyethylene glycol linker may be selected from any one of PEG2to PEG100(e.g., PEG2, PEG3, PEG4, PEG5, PEG5-PEG10, PEG10-PEG20, PEG20-PEG30, PEG30-PEG40, PEG50-PEG60, PEG60-PEG70, PEG70-PEG80, PEG80-PEG90, PEG90-PEG100). In some embodiments, Lcincludes a PEG linker, where LCis covalently attached to each of Qiand E. Peptide linkers In the present disclosure, a linker between a peptide and an Fc domain monomer (e.g., in a polypeptide), between a VLand VH, between a VHand VL, or between two peptides (e.g. K1or K2) can be polypeptide including 1-200 amino acids (e.g., 1-200, 1-180, 1-160, 1-140, 1-120, 1-100, 1-90, 1-80, 1-70, 1-60, 1-50, 1-45, 1-40, 1-35, 1-30, 1-25, 1-20, 1-15, 1-10, 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 4-200, 5-200, 6-200, 7-200, 8-200, 9-200, 10-200, 15-200, 20-200, 25-200, 30-200, 35-200, 40-200, 45-200, 50-200, 60-200, 70-200, 80-200, 90-200, 100-200, 120-200, 140-200, 160-200, or 180-200 amino acids). In some embodiments, a linker is an polypeptide containing at least 12 amino acids, such as 12-200 amino acids (e.g., 12-200, 12-180, 12-160, 12-140, 12-120, 12-100, 12-90, 12-80, 12-70, 12-60, 12-50, 12-40, 12-30, 12-20, 12-19, 12-18, 12-17, 12-16, 12-15, 12-14, or 12-13 amino acids) (e.g., 14-200, 16-200, 18-200, 20- 200, 30-200, 40-200, 50-200, 60-200, 70-200, 80-200, 90-200, 100-200, 120-200, 140-200, 160-200, 180-200, or 190-200 amino acids). In some embodiments, a linker is polypeptide containing 12-30 amino acids (e.g., 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids). Suitable peptide linkers are known in the art, and include, for example, peptide linkers containing flexible amino acid residues such as glycine and serine. In certain embodiments, a linker can contain motifs, e.g., multiple or repeating motifs, of GS, GGS, GGGGS (SEQ ID NO: 273), GGSG (SEQ ID NO: 274), or SGGG (SEQ ID NO: 275). In preferred embodiments, a peptide linker (e.g., K1or K2) is a peptide linker including the amino acid sequence of any one of (GS)x, (GGS)x, (GGGGS)x, (GGSG)x, (SGGG)x, wherein x is an integer from 1 to 50 (e.g., 1-40, 1-30, 1-20, 1-10, or 1-5). In some embodiments, the peptide linker is GGGGSGGGGS (SEQ ID NO: 276), GGGGSGGGGSGGGGS (SEQ ID NO: 277); or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 278). In some embodiments, a peptide linker contains only glycine residues, e.g., at least 4 glycine residues (e.g., 4-200, 4-180, 4-160, 4-140, 4-40, 4-100, 4-90, 4-80, 4-70, 4-60, 4-50, 4-40, 4-30, 4-20, 4- 19, 4-18, 4-17, 4-16, 4-15, 4-14, 4-13, 4-12, 4-11, 4-10, 4-9, 4-8, 4-7, 4-6 or 4-5 glycine residues) (e.g., 4- 200, 6-200, 8-200, 10-200, 12-200, 14-200, 16-200, 18-200, 20-200, 30-200, 40-200, 50-200, 60-200, 70- 200, 80-200, 90-200, 100-200, 120-200, 140-200, 160-200, 180-200, or 190-200 glycine residues). In certain embodiments, a linker has 4-30 glycine residues (e.g., 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 glycine residues). In some embodiments, a linker containing only glycine residues may not be glycosylated (e.g., O-linked glycosylation, also referred to as O-glycosylation) or may have a decreased level of glycosylation (e.g., a decreased level of O- glycosylation) (e.g., a decreased level of O-glycosylation with glycans such as xylose, mannose, sialic acids, fucose (Fuc), or galactose (Gal) (e.g., xylose)) as compared to, e.g., a linker containing one or more serine residues. In some embodiments, a linker containing only glycine residues may not be O-glycosylated (e.g., O-xylosylation) or may have a decreased level of O-glycosylation (e.g., a decreased level of O- xylosylation) as compared to, e.g., a linker containing one or more serine residues. Linkers In some embodiments, linker provides space, rigidity, and / or flexibility between the CD73 inhibitors and the polypeptide in the conjugates described here or between two CD73 inhibitors in the conjugates described herein. In some embodiments, a linker may be a bond, e.g., a covalent bond, e.g., an amide bond, a disulfide bond, a C-O bond, a C-N bond, a N-N bond, a C-S bond, or any kind of bond created from a chemical reaction, e.g., chemical conjugation. In some embodiments, a linker (e.g., L as shown in formula (D-I) or (M-I)) includes no more than 250 atoms (e.g., 1-2, 1-4, 1-6, 1-8, 1-10, 1-12, 1- 14, 1-16, 1-18, 1-20, 1-25, 1-30, 1-35, 1-40, 1-45, 1-50, 1-55, 1-60, 1-65, 1-70, 1-75, 1-80, 1-85, 1-90, 1- 95, 1-100, 1-110, 1-120, 1-130, 1-140, 1-150, 1-160, 1-170, 1-180, 1-190, 1-200, 1-210, 1-220, 1-230, 1- 240, or 1-250 atom(s); 250, 240, 230, 220, 210, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 28, 26, 24, 22, 20, 18, 16, 14, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 atom(s)). In some embodiments, a linker (L) includes no more than 250 non-hydrogen atoms (e.g., 1-2, 1-4, 1-6, 1-8, 1-10, 1-12, 1-14, 1-16, 1-18, 1-20, 1-25, 1-30, 1-35, 1-40, 1-45, 1-50, 1-55, 1-60, 1-65, 1-70, 1-75, 1-80, 1-85, 1-90, 1-95, 1-100, 1-110, 1-120, 1-130, 1-140, 1-150, 1-160, 1-170, 1-180, 1-190, 1-200, 1-210, 1-220, 1-230, 1-240, or 1-250 non-hydrogen atom(s); 250, 240, 230, 220, 210, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 28, 26, 24, 22, 20, 18, 16, 14, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 non-hydrogen atom(s)). In some embodiments, the backbone of a linker (L) includes no more than 250 atoms (e.g., 1-2, 1-4, 1-6, 1-8, 1- 10, 1-12, 1-14, 1-16, 1-18, 1-20, 1-25, 1-30, 1-35, 1-40, 1-45, 1-50, 1-55, 1-60, 1-65, 1-70, 1-75, 1-80, 1- 85, 1-90, 1-95, 1-100, 1-110, 1-120, 1-130, 1-140, 1-150, 1-160, 1-170, 1-180, 1-190, 1-200, 1-210, 1- 220, 1-230, 1-240, or 1-250 atom(s); 250, 240, 230, 220, 210, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 28, 26, 24, 22, 20, 18, 16, 14, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 atom(s)). The “backbone” of a linker refers to the atoms in the linker that together form the shortest path from one part of the conjugate to another part of the conjugate. The atoms in the backbone of the linker are directly involved in linking one part of the conjugate to another part of the conjugate. For example, hydrogen atoms attached to carbons in the backbone of the linker are not considered as directly involved in linking one part of the conjugate to another part of the conjugate. Molecules that may be used to make linkers (L) include at least two functional groups, e.g., two carboxylic acid groups. In some embodiments of a trivalent linker, two arms of a linker may contain two dicarboxylic acids, in which the first carboxylic acid may form a covalent linkage with the first CD73 inhibitor in the conjugate and the second carboxylic acid may form a covalent linkage with the second CD73 inhibitor in the conjugate, and the third arm of the linker may for a covalent linkage (e.g., a C-O bond) with a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide in the conjugate. In some embodiments of a divalent linker, the divalent linker may contain two carboxylic acids, in which the first carboxylic acid may form a covalent linkage with one component (e.g., a CD73 inhibitor) in the conjugate and the second carboxylic acid may form a covalent linkage (e.g., a C-S bond or a C-N bond) with another component (e.g., a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide) in the conjugate. In some embodiments, dicarboxylic acid molecules may be used as linkers (e.g., a dicarboxylic acid linker). For example, in a conjugate containing a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide covalently linked to one or more dimers of CD73 inhibitors, the first carboxylic acid in a dicarboxylic acid molecule may form a covalent linkage with a hydroxyl or amine group of the first CD73 inhibitor and the second carboxylic acid may form a covalent linkage with a hydroxyl or amine group of the second CD73 inhibitor. In some embodiments, dicarboxylic acid molecules, such as the ones described herein, may be further functionalized to contain one or more additional functional groups. Dicarboxylic acids may be further functionalized, for example, to provide an attachment point to a polypeptide that contains an anti- PD-1 scFv-Fc polypeptide (e.g., by way of a linker, such as a PEG linker). In some embodiments, when the CD73 inhibitor is attached to a polypeptide that contains an anti- PD-1 scFv-Fc polypeptide, the linker may include a moiety including a carboxylic acid moiety and an amino moiety that are spaced by from 1 to 25 atoms. In some embodiments, a linker may include a diamino moiety, such as the ones described herein, may be further functionalized to contain one or more additional functional groups. Such diamino linker may be further functionalized, for example, to provide an attachment point to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide (e.g., by way of a linker, such as a PEG linker). In some embodiments, a molecule containing an azide group may be used to form a linker, in which the azide group may undergo cycloaddition with an alkyne to form a 1,2,3-triazole linkage. In some embodiments, a molecule containing an alkyne group may be used to form a linker, in which the alkyne group may undergo cycloaddition with an azide to form a 1,2,3-triazole linkage. In some embodiments, a molecule containing a maleimide group may be used to form a linker, in which the maleimide group may react with a cysteine to form a C-S linkage. In some embodiments, a molecule containing one or more haloalkyl groups may be used to form a linker, in which the haloalkyl group may form a covalent linkage, e.g., C-N and C-O linkages, with a CD73 inhibitor. In some embodiments, a linker (L) may include a synthetic group derived from, e.g., a synthetic polymer (e.g., a polyethylene glycol (PEG) polymer). In some embodiments, a linker may include one or more amino acid residues. In some embodiments, a linker may be an amino acid sequence (e.g., a 1-25 amino acid, 1-10 amino acid, 1-9 amino acid, 1-8 amino acid, 1-7 amino acid, 1-6 amino acid, 1-5 amino acid, 1-4 amino acid, 1-3 amino acid, 1-2 amino acid, or 1 amino acid sequence). In some embodiments, a linker (L) may include one or more optionally substituted C1-C40 alkylene, optionally substituted C1- C40 heteroalkylene (e.g., a PEG unit), optionally substituted C1-C40 alkoxylene, optionally substituted C2-C20 alkenylene (e.g., C2 alkenylene), optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene (e.g., cyclopropylene, cyclobutylene), optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene (e.g., C6 arylene), optionally substituted C2-C15 heteroarylene (e.g., imidazole, pyridine), O, S, NRi(Riis H, optionally substituted C1-C20 alkyl, optionally substituted C1-C20 heteroalkyl, optionally substituted C2-C20 alkenyl, optionally substituted C2-C20 heteroalkenyl, optionally substituted C2-C20 alkynyl, optionally substituted C2-C20 heteroalkynyl, optionally substituted C3-C20 cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20 cycloalkenyl, optionally substituted C4-C20 heterocycloalkenyl, optionally substituted C8-C20 cycloalkynyl, optionally substituted C8-C20 heterocycloalkynyl, optionally substituted C5-C15 aryl, or optionally substituted C2-C15 heteroaryl), P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, or imino. Conjugation chemistries CD73 inhibitor monomers or dimers may be conjugated to a polypeptide that contains an anti-PD- 1 scFv-Fc polypeptide, e.g., by way of a linker, by any standard conjugation chemistries known to those of skill in the art. The following conjugation chemistries are specifically contemplated, e.g., for conjugation of a PEG linker (e.g., a functionalized PEG linker) to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide. Covalent conjugation of two or more components in a conjugate using a linker may be accomplished using well-known organic chemical synthesis techniques and methods. Complementary functional groups on two components may react with each other to form a covalent bond. Examples of complementary reactive functional groups include, but are not limited to, e.g., maleimide and cysteine, amine and activated carboxylic acid, thiol and maleimide, activated sulfonic acid and amine, isocyanate and amine, azide and alkyne, and alkene and tetrazine. Site-specific conjugation to a polypeptide may be accomplished using techniques known in the art. Exemplary techniques for site-specific conjugation of a small molecule to a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide are provided in Agarwall. P., et al. Bioconjugate Chem.26:176-192 (2015). Other examples of functional groups capable of reacting with amino groups include, e.g., alkylating and acylating agents. Representative alkylating agents include: (i) an α-haloacetyl group, e.g., XCH2CO- (where X=Br, Cl, or I); (ii) a N-maleimide group, which may react with amino groups either through a Michael type reaction or through acylation by addition to the ring carbonyl group; (iii) an aryl halide, e.g., a nitrohaloaromatic group; (iv) an alkyl halide; (v) an aldehyde or ketone capable of Schiff’s base formation with amino groups; (vi) an epoxide, e.g., an epichlorohydrin and a bisoxirane, which may react with amino, sulfhydryl, or phenolic hydroxyl groups; (vii) a chlorine-containing of s-triazine, which is reactive towards nucleophiles such as amino, sulfhydryl, and hydroxyl groups; (viii) an aziridine, which is reactive towards nucleophiles such as amino groups by ring opening; (ix) a squaric acid diethyl ester; and (x) an α-haloalkyl ether. Examples of amino-reactive acylating groups include, e.g., (i) an isocyanate and an isothiocyanate; (ii) a sulfonyl chloride; (iii) an acid halide; (iv) an active ester, e.g., a nitrophenylester or N- hydroxysuccinimidyl ester; (v) an acid anhydride, e.g., a mixed, symmetrical, or N-carboxyanhydride; (vi) an acylazide; and (vii) an imidoester. Aldehydes and ketones may be reacted with amines to form Schiff’s bases, which may be stabilized through reductive amination. It will be appreciated that certain functional groups may be converted to other functional groups prior to reaction, for example, to confer additional reactivity or selectivity. Examples of methods useful for this purpose include conversion of amines to carboxyls using reagents such as dicarboxylic anhydrides; conversion of amines to thiols using reagents such as N-acetylhomocysteine thiolactone, S- acetylmercaptosuccinic anhydride, 2-iminothiolane, or thiol-containing succinimidyl derivatives; conversion of thiols to carboxyls using reagents such as α -haloacetates; conversion of thiols to amines using reagents such as ethylenimine or 2-bromoethylamine; conversion of carboxyls to amines using reagents such as carbodiimides followed by diamines; and conversion of alcohols to thiols using reagents such as tosyl chloride followed by transesterification with thioacetate and hydrolysis to the thiol with sodium acetate. In some embodiments, a linker of the disclosure (e.g., L, such as LCof D-L-I), is conjugated (e.g., by any of the methods described herein) to E (e.g., a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide). In preferred embodiments of the disclosure, the linker is conjugated by way of: (a) a thiourea linkage (i.e., -NH(C=S)NH-) to a lysine of E; (b) a carbamate linkage (i.e., -NH(C=O)-O) to a lysine of E; (c) an amine linkage by reductive amination (i.e., -NHCH2) between a lysine and E; (d) an amide (i.e., -NH-(C=O)CH2) to a lysine of E; I a cysteine-maleimide conjugate between a maleimide of the linker to a cysteine of E; (f) an amine linkage by reductive amination (i.e., -NHCH2) between the linker and a carbohydrate of E (e.g., a glycosyl group of a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide); (g) a rebridged cysteine conjugate, wherein the linker is conjugated to two cysteines of E; (h) an oxime linkage between the linker and a carbohydrate of E (e.g., a glycosyl group of a polypeptide that contains an anti-PD-1 scFv-Fc polypeptide); (i) an oxime linkage between the linker and an amino acid residue of E; (j) an azido linkage between the linker and E; (k) direct acylation of a linker to E; or (l) a thioether linkage between the linker and E. In some embodiments, a linker is conjugated to E, wherein the linkage includes the structure - NH(C=NH)X-, wherein X is O, HN, or a bond. In some embodiments, a linker is conjugated to E, wherein the linkage between the remainder of the linker and E includes the structure -NH(C=O)NH-. In some embodiments, a linker is conjugated to E, wherein the linkage includes the structure - R9OR9C(=O)NH-, wherein R9is H, optionally substituted C1-C20alkyl, optionally substituted C3-C20cycloalkyl, optionally substituted C2-C20heterocycloalkyl; optionally substituted C5-C15aryl, or optionally substituted C2-C15heteroaryl. In some embodiments, the linker is conjugated to E, wherein the linkage between the remainder of the linker and E includes the structure –CH2OCH2C(=O)NH-. Exemplary linking strategies (e.g., methods for linking a monomer or a dimer of a CD73 inhibitor to E, such as, by way of a linker) are further described in the Examples. In some embodiments, a linker (e.g., an active ester, e.g., a nitrophenylester or N- hydroxysuccinimidyl ester, or derivatives thereof (e.g., a functionalized PEG linker (e.g., azido-PEG2- PEG40-NHS ester), is conjugated to E, with a T of (e.g., drug-antibody ratio or DAR) of between 0.5 and 10.0, e.g., 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8.0, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, or 10.0. In these instances, the E-(PEG2-PEG40)-azide can react with an Int having a terminal alkyne linker (e.g., L, such as LCof D-L-I) through click conjugation. During click conjugation, the copper- catalyzed reaction of the azide (e.g., the Fc–(PEG2-PEG40)-azide) with the alkyne (e.g., the Int having a terminal alkyne linker (e.g., L, such as LCof D-L-I) forming a 5-membered heteroatom ring. In some embodiments, the linker conjugated to E is a terminal alkyne and is conjugated to an Int having a terminal azide. Exemplary preparations of preparations of E-(PEG2-PEG40)-azide are described in the Examples. One of skill in the art would readily understand the final product from a click chemistry conjugation. Exemplary linking strategies are further depicted herein. V. Methods of treatment This disclosure provides uses of polypeptides and conjugates thereof and pharmaceutical compositions described herein in the treatment of disorders associated with dysregulation or overexpression of CD73 (e.g., cancer). Cancer The polypeptides and conjugates thereof and pharmaceutical compositions described herein can be used to treat a cancer in a subject. In some embodiments, the cancer overexpresses or is known to overexpress CD73 relative to a non-cancerous cell of the same tissue type. In some embodiments, the subject has been determined to have a cancer that overexpresses CD73 relative to a non-cancerous cell of the same tissue type. In some embodiments, the method further comprises a step of determining whether the cancer overexpresses CD73 relative to a non-cancerous cell of the same tissue type and administering the conjugate only if the cancer overexpresses CD73. In some embodiments, the cancer is selected from lung cancer, optionally non-small cell lung cancer or small-cell lung cancer; head and neck cancer, optionally squamous cell carcinoma; renal cell carcinoma; breast cancer; ovarian cancer; pancreatic cancer; colorectal cancer; urothelial cancer; bile duct cancer; endometrial cancer; melanoma; or esophageal cancer. In some embodiments, the breast cancer is triple negative breast cancer. In some embodiments, the cancer is PD-L1 positive. In some embodiments, the triple negative breast cancer is PD-L1 positive. In some embodiments, the cancer is a solid tumor. Combination Therapies In some embodiments, one or more anticancer agents (e.g., immune checkpoint inhibitors, chemotherapeutic agents, PARP inhibitors, antibody drug conjugates, or a combination thereof) may be administered in combination (e.g., administered substantially simultaneously (e.g., in the same pharmaceutical composition or in separate pharmaceutical compositions) or administered separately) at different times with a polypeptide or conjugate thereof described herein (e.g., a conjugate of formula (D-I) or (M-I)). In some embodiments, one or more anticancer agents may be administered in combination with a polypeptide or conjugate thereof described herein to treat breast cancer. In some embodiments, the breast cancer is triple negative breast cancer. The anticancer agent may be administered substantially simultaneously (e.g., in the same pharmaceutical composition or in separate pharmaceutical compositions) as the conjugates, or may be administered prior to or following the conjugates (e.g., within a period of 1 day, 2, days, 5, days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 6 months, or 12 months, or more). i. Immune checkpoint inhibitors In some embodiments, the method includes administering to the subject an immune checkpoint inhibitor. In some embodiments, the immune checkpoint inhibitor is an inhibitor of any one of more of the following immune checkpoint targets: CTLA-4, PD-1, PD-L1, LAG-3, B7.1, B7-H3, B7-H4, TIM3, VISTA, CD137, OX-40, CD40, CD27, CCR4, GITR, NKG2D, and KIR. In some embodiments, the immune checkpoint inhibitor is a monoclonal antibody selected from one or more of an anti-PD-1 antibody, an anti- PD-L1 antibody, an anti-CTLA-4 antibody, an anti-LAG3 antibody, an anti-B7.1 antibody, an anti-B7H3 antibody, an anti-B7H4 antibody, an anti-TIM3 antibody, an anti-VISTA antibody, an anti-CD137 antibody, an anti-OX40 antibody, an anti-CD40 antibody, an anti-CD27 antibody, an anti-CCR4 antibody, an anti- GITR antibody, an anti-NKG2D antibody, and an anti-KIR antibody. In some embodiments, the immune checkpoint inhibitor is a PD-1 inhibitor. Immune checkpoint inhibitors approved or in development include, but are not limited to, YERVOY® (ipilimumab), OPDIVO® (nivolumab), KEYTRUDA® (pembrolizumab), tremelimumab, galiximab, MDX-1106, BMS-936558, MEDI4736, MPDL3280A, MEDI6469, BMS-986016, BMS-663513, PF-05082566, IPH2101, KW-0761, CDX-1127, CP-870, CP-893, GSK2831781, MSB0010718C, MK3475, CT-011, AMP-224, MDX-1105, IMP321, MGA271, dostarlimab, and cemiplimab, as well as numerous other antibodies directed to immune checkpoint proteins described herein. In some embodiments, the immune checkpoint inhibitor is pembrolizumab, nivolumab, dostarlimab, dostarlimab, or cemiplimab. In some embodiments, the method includes administering to said subject (1) a polypeptide or conjugate thereof described herein and (2) an immune checkpoint inhibitor. In some embodiments, the conjugate described herein is administered first, followed by administering of the immune checkpoint inhibitor alone. In some embodiments, the immune checkpoint inhibitor is administered first, followed by administering of the conjugate described herein alone. In some embodiments, the conjugate described herein and the immune checkpoint inhibitor are administered substantially simultaneously (e.g., in the same pharmaceutical composition or in separate pharmaceutical compositions). In some embodiments, when a polypeptide or conjugate thereof described herein and an immune checkpoint inhibitor are administered together (e.g., substantially simultaneously in the same or separate pharmaceutical compositions, or separately in the same treatment regimen), tumor growth suppression of each of the conjugate and the immune checkpoint inhibitor may be greater (e.g., occur at a lower concentration) than inhibition of tumor growth suppression of each of the conjugate and the immune checkpoint inhibitor when each is used alone in a treatment regimen. ii. Chemotherapeutic agents

[0022] In some embodiments, the method includes administering to the subject one or more chemotherapeutic agents, e.g.,:

[0023] (a) a cytotoxic agent;

[0024] (b) an antimetabolite;

[0025] (c) an alkylating agent;

[0026] (d) an anthracycline;

[0027] (e) an antibiotic;

[0028] (f) an anti-mitotic agent;

[0029] (g) a hormone therapy;

[0030] (h) a signal transduction inhibitor;

[0031] (i) a gene expression modulator;

[0032] (j) an apoptosis inducer;

[0033] (k) an angiogenesis inhibitor;

[0034] (l) an immunotherapy agent;

[0035] (m) a DNA damage repair inhibitor;

[0036] (n) a kinase inhibitor;

[0037] (o) an ionizing radiation therapy;

[0038] (p) a radioligand therapy; or a combination thereof.

[0039] The cytotoxic agent may be, e.g., actinomycin-D, alemtuzumab, alitretinoin, allopurinol, altretamine, amifostine, amphotericin, amsacrine, arsenic trioxide, asparaginase, azacitidine, azathioprine, Bacille Calmette-Guerin (BCG), bendamustine, bexarotene, bevacuzimab, bleomycin, bortezomib, busulphan, capecitabine, carboplatin, carfilzomib, carmustine, cetuximab, cisplatin, chlorambucil, cladribine, clofarabine, colchicine, crisantaspase, cyclophosphamide, cyclosporine, cytarabine, cytochalasin B, dacarbazine, dactinomycin, darbepoetin alfa, dasatinib, daunorubicin, 1 - dehydrotestosterone, denileukin, dexamethasone, dexrazoxane, dihydroxy anthracin dione, disulfiram, docetaxel, doxorubicin, liposomal doxorubicin, emetine, epirubicin, erlotinib, epigallocatechin gallate, epoetin alfa, estramustine, ethidium bromide, etoposide, everolimus, filgrastim, finasunate, floxuridine, fludarabine, flurouracil (5-FU), fulvestrant, ganciclovir, geldanamycin, gemcitabine, glucocorticoids, gramicidin D, histrelin acetate, hydroxyurea, ibritumomab, idarubicin, ifosfamide, imatinib, irinotecan, interferons, interferon alfa-2a, interferon alfa-2b, ixabepilone, lactate dehydrogenase A (LDH-A), lenalidomide, letrozole, leucovorin, levamisole, lidocaine, lomustine, mechlorethamine, melphalan, 6- mercaptopurine, mesna, methotrexate, methoxsalen, metoprine, metronidazole, mithramycin, mitomycin- C, mitoxantrone, nandrolone, nelarabine, nilotinib, nofetumomab, oprelvekin, oxaliplatin, paclitaxel, nab- paclitaxel, pemetrexed, pentostatin, palifermin, pamidronate, pegademase, pegaspargase, pegfilgrastim, pemetrexed disodium, plicamycin, porfimer sodium, procaine, procarbazine, propranolol, puromycin, quinacrine, radicicol, radioactive isotopes, raltitrexed, rapamycin, rasburicase, salinosporamide A, sargramostim, sunitinib, temozolomide, teniposide, tetracaine, 6-thioguanine, thiotepa, topotecan, toremifene, trastuzumab, treosulfan, tretinoin, valrubicin, vinblastine, vincristine, vindesine, vinorelbine, zoledronate, or a combination thereof. The antimetabolite may be, e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5- fluorouracil decarbazine, cladribine, pemetrexed, gemcitabine, capecitabine, hydroxyurea, mercaptopurine, fludarabine, pralatrexate, clofarabine, cytarabine, decitabine, floxuridine, nelarabine, trimetrexate, thioguanine, pentostatin, or a combination thereof. The alkylating agent may be, e.g., mechlorethamine, thiotepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, cis-dichlorodiamine platinum (II) (DDP) cisplatin, altretamine, cyclophosphamide, ifosfamide, hexamethylmelamine, altretamine, procarbazine, dacarbazine, temozolomide, streptozocin, carboplatin, cisplatin, oxaliplatin, uramustine, bendamustine, trabectedin, semustine, or a combination thereof. The anthracycline may be, e.g., daunorubicin, doxorubicin, aclarubicin, aldoxorubicin, amrubicin, annamycin, carubicin, epirubicin, idarubicin, mitoxantrone, valrubicin, or a combination thereof. The antibiotic may be, e.g., dactinomycin, bleomycin, mithramycin, anthramycin (AMC), ampicillin, bacampicillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, nafcillin, oxacillin, piperacillin, pivampicillin, pivmecillinam, ticarcillin, aztreonam, imipenem, doripenem, ertapenem, meropenem, cephalosporins, clarithromycin, dirithromycin, roxithromycin, telithromycin, lincomycin, pristinamycin, quinupristin, amikacin, gentamicin, kanamycin, neomycin, netilmicin, paromomycin, tobramycin, streptomycin, sulfamethizole, sulfamethoxazole, sulfisoxazole, demeclocycline, minocycline, oxytetracycline, tetracycline, penicillin, amoxicillin, cephalexin, erythromycin, clarithromycin, azithromycin, ciprofloxacin, levofloxacin, ofloxacin, doxycycline, clindamycin, metronidazole, tigecycline, chloramphenicol, metronidazole, tinidazole, nitrofurantoin, vancomycin, teicoplanin, telavancin, linezolid, cycloserine, rifamycins, polymyxin B, bacitracin, viomycin, capreomycin, quinolones, daunorubicin, doxorubicin, 4’-deoxydoxorubicin, epirubicin, idarubicin, plicamycin, mitomycin-c, mitoxantrone, or a combination thereof. The anti-mitotic agent may be, e.g., vincristine, vinblastine, vinorelbine, docetaxel, estramustine, ixabepilone, paclitaxel, maytansinoid, a dolastatin, a cryptophycin, or a combination thereof. The signal transduction inhibitor may be, e.g., imatinib, trastuzumab, erlotinib, sorafenib, sunitinib, temsirolimus, vemurafenib, lapatinib, bortezomib, cetuximab panitumumab, matuzumab, gefitinib, STI 571, rapamycin, flavopiridol, imatinib mesylate, vatalanib, semaxinib, motesanib, axitinib, afatinib, bosutinib, crizotinib, cabozantinib, dasatinib, entrectinib, pazopanib, lapatinib, vandetanib, or a combination thereof. The gene expression modulator may be, e.g., a siRNA, a shRNA, an antisense oligonucleotide, an HDAC inhibitor, or a combination thereof. An HDAC inhibitor may be, e.g., trichostatin A, trapoxin B, valproic acid, vorinostat, belinostat, LAQ824, panobinostat, entinostat, tacedinaline, mocetionstat, givinostat, resminostat, abexinostat, quisinostat, rocilinostat, practinostat, CHR-3996, butyric acid, phenylbutyric acid, 4SC202, romidepsin, sirtinol, cambinol, EX-527, nicotinamide, or a combination thereof. An antisense oligonucleotide may be, e.g., custirsen, apatorsen, AZD9150, trabadersen, EZN- 2968, LErafAON-ETU, or a combination thereof. An siRNA may be, e.g., ALN-VSP, CALAA-01, Atu-027, SPC2996, or a combination thereof. The hormone therapy may be, e.g., a luteinizing hormone-releasing hormone (LHRH) antagonist. The hormone therapy may be, e.g., firmagon, leuproline, goserelin, buserelin, flutamide, bicalutadmide, ketoconazole, aminoglutethimide, prednisone, hydroxyl-progesterone caproate, medroxy-progesterone acetate, megestrol acetate, diethylstil-bestrol, ethinyl estradiol, tamoxifen, testosterone propionate, fluoxymesterone, flutamide, raloxifene, droloxifene, iodoxyfene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, toremifine citrate, megestrol acetate, exemestane, fadrozole, vorozole, letrozole, anastrozole, nilutamide, tripterelin, histerelin, arbiraterone, medroxyprogesterone acetate, diethylstilbestrol, premarin, fluoxymesterone, tretinoin, fenretinide, troxacitabine, or a combination thereof. The apoptosis inducers may be, e.g., a recombinant human TNF-related apoptosis-inducing ligand (TRAIL), camptothecin, bortezomib, etoposide, tamoxifen, or a combination thereof. The angiogenesis inhibitors may be, e.g., sorafenib, sunitinib, pazopanib, everolimus or a combination thereof. The immunotherapy agent may be, e.g., a monoclonal antibody, cancer vaccine (e.g., a dendritic cell (DC) vaccine), oncolytic virus, cytokine, adoptive T cell therapy, Bacille Calmette-Guérin (BCG), GM- CSF, thalidomide, lenalidomide, pomalidomide, imiquimod, or a combination thereof. The monoclonal antibody may be, e.g., anti-CTLA4, anti-LAG3, anti-KIR, or a combination thereof. The monoclonal antibody may be, e.g., alemtuzumab, trastuzumab, ibritumomab tiuxetan, brentuximab vedotin, trastuzumab, ado-trastuzumab emtansine, blinatumomab, bevacizumab, cetuximab, pertuzumab, panitumumab, ramucirumab, obinutuzumab, ofatumumab, rituximab, pertuzumab, tositumomab, gemtuzumab ozogamicin, tositumomab, or a combination thereof. The cancer vaccine may be, e.g., Sipuleucel-T, BioVaxID, NeuVax, DCVax, SuVaxM, CIMAvax®, Provenge,®, hsp110 chaperone complex vaccine, CDX-1401, MIS416, CDX-110, GVAX Pancreas, HyperAcute™ Pancreas, GTOP-99 (MyVax®), or Imprime PGG®. The oncolytic virus may be, e.g., talimogene laherparepvec. The cytokine may be, e.g., IL-2, IFNα, or a combination thereof. The adoptive T cell therapy may be, e.g., tisagenlecleucel, axicabtagene ciloleucel, or a combination thereof. The DNA damage repair inhibitor may be, e.g., a PARP inhibitor, a DNA-PK inhibitor, a cell checkpoint kinase inhibitor, or a combination thereof. The PARP inhibitor may be, e.g., olaparib, rucaparib, veliparib (ABT-888), niraparib (ZL-2306), iniparib (BSI-201), talazoparib (BMN 673), 2X-121, CEP-9722, KU-0059436 (AZD2281), PF-01367338, AZD5305, AZD9574, seneparib (IMP4297), fluzoparib (SHR-3162), XIN005104, NMS-293 or a combination thereof. The DNA-PK inhibitor may be AZD7648, nedisertib (M3814), M9831, or BAY-8400. The cell checkpoint kinase inhibitor may be, e.g., RP-6306, MK-1775 or AZD1775, AZD7762, LY2606368, PF-0477736, AZD0156, GDC-0575, ARRY-575, CCT245737, PNT-737 or a combination thereof. DNA-dependent Protein Kinase (DNA-PK) inhibitors that may be used in the present invention include compounds that upon contacting DNA-PK, whether in vitro, in cell culture, or in an animal, reduce the activity of DNA-PK, such that the measured DNA-PK IC50is 10 µM or less (e.g., 5 µM or less or 1 µM or less). For certain DNA-PK inhibitors, the DNA-PK IC50may be 100 nM or less (e.g., 10 nM or less, or 1 nM or less) and could be as low as 100 pM or 10 pM. Preferably, the DNA-PK IC50is 0.1 nM to 1 µM (e.g., 0.1 nM to 750 nM, 0.1 nM to 500 nM, or 0.1 nM to 250 nM). DNA-PK inhibitors include AZD-7648, Peposertib, M9831, IMP11, NU5455, BAY-8400, ZL-2201, adMare Bioinnovations DNA-PK Program, XRD-0394, Avadomide, NERx Ku program, CC-115, KU57788, ZSTK474, LY3023414, BR101801, XRD-0394 and NK-314. Radiotherapy may be used in conjunction with the other methods of this disclosure for the treatment of cancer. Radiotherapy is a treatment method where ionizing radiation is provided to cancerous tissue to induce DNA damage and cell death. Radiotherapy methods of this disclosure include radiation from an external beam (i.e., external beam radiation), sealed source radiotherapy, (i.e., brachytherapy), and injection of radionuclide isotopes (i.e., radionuclide therapy) or radioligand therapy (RLT) in which pharmaceuticals including antibodies or cell surface ligands are linked to radionuclides for administration. External beam radiation can include treatment with photons (X-rays), electrons, protons, carbon ions, boron capture neutrons, etc. Radionuclides used in brachytherapy, radionuclide therapy, and radioligand therapy can include:131I,177Lu,153Sm,90Y,223Ra,225Ac,211At,213Bi,212Pb / 212Bi,161Tb,125I,131Cs,106Ru,103Pd,32P,33P,67Cu,89Sr,165Dy,166Ho,186Re,188Re,60Co, etc. In some embodiments, the radiotherapy is part of a chemoradiotherapy (CRT). The chemotherapeutic agent can be etoposide, doxorubicin, topotecan, irinotecan, fluorouracil, gemcitabine, paclitaxel, a platin, an anthracycline, and a combination thereof. The radiotherapy can be a treatment given with electrons, photons, protons, alpha-emitters, beta-emitters, other ions, radio-nucleotides, boron capture neutrons, and combinations thereof. In some embodiments, the radiotherapy is given either with fractionation (e.g., 0.10, 0.15, 0.20, 0.25, 0.30, 0.35, 0.40, 0.45, 0.50, 0.55, 0.60, 0.65, 0.70, 0.75, 0.80, 0.85, 0.90, 0.95, 1.00, 1.10, 1.15, 1.20, 1.25, 1.30, 1.35, 1.40, 1.45, 1.50, 1.55, 1.60, 1.65, 1.70, 1.75, 1.80, 1.85, 1.90, 1.95, and 2.00 Gy per day for 5 days a week) up to a total dose of 50-70 Gy. In some embodiments, the radiotherapy is given either with fractionation (0.1 to 2 Gy per day for 5 days a week) up to a total dose of 50-70 Gy. Other fractionation schedules could also be envisioned, for example, a lower dose per fraction but given twice daily. Higher daily doses over a shorter period of time can also be given. In one embodiment, stereotactic radiotherapy as well as the gamma knife are used. In the palliative setting, other fractionation schedules are also widely used for example 25 Gy in 5 fractions or 30 Gy in 10 fractions. For radiotherapy, the duration of treatment will be the time frame when radiotherapy is given. These interventions apply to treatment given with electrons, photons and protons, alfa-emitters or other ions, treatment with radio-nucleotides, for example, treatment with131I given to patients with thyroid cancer, as well in patients treated with boron capture neutron therapy. Radiotherapy Ligands (RLTs) that may be used in the present invention include agents that upon contacting cancer cells, whether in vitro, in cell culture, or in an animal, inhibit the cancer cell, such that the measured IC50is 10 µM or less (e.g., 5 µM or less or 1 µM or less). For certain RLTs, the IC50may be 100 nM or less (e.g., 10 nM or less, or 1 nM or less) and could be as low as 100 pM or 10 pM. Preferably, the RLT IC50is 0.1 nM to 1 µM (e.g., 0.1 nM to 750 nM, 0.1 nM to 500 nM, or 0.1 nM to 250 nM). RLTs include Zevalin, Actimab-A, Iomab-ACT, Iomab-B, Lutetium-177-DOTAGA-PEG-IAC, Tozaride, SS0110, BAY-2701439, 177Lu-rhPSMA-10.1, CTT-1403, Iopofosine, SAR-BBN, SAR-bisPSMA, SARTATE, FAP- 2286, CONV-01-α,177Lu-PSMA-I&T, FPI-2059, FPI-1434, FPI-1966, [177Lu] ludotadipep,161Tb-PSMA-I&T, ITM-31, ITM-11, JNJ-69086420, I-131-1095, Azedra, PSMA TTC / BAY-2315497,177Lu-DOTA-EB-TATE, Betalutin, AAA817, AAA603, Lutathera, Pluvicto, PPMX-T002, 186RNL, PNT2003, CAM-H2, AlphaMedix, RYZ101, Sn-117m-DTPA, TLX592, TLX66, TLX250, TLX591, TLX101,124I-omburtamab, GD2-SADA, and131I-omburtamab. In some embodiments, the chemotherapeutic agent is selected from paclitaxel, docetaxel, liposomal doxorubicin, carboplatin, gemcitabine, nab-paclitaxel, doxorubicin, oxaliplatin, cisplatin, carboplatin, or a combination thereof. iii. PARP Inhibitors In some embodiments, the method includes administering to the subject a PARP inhibitor. PARP inhibitors include compounds that upon contacting PARP, whether in vitro, in cell culture, in an animal or in a patient, reduce the activity of PARP, such that the measured PARP IC50is 10 µM or less (e.g., 5 µM or less or 1 µM or less). For certain PARP inhibitors, the PARP IC50may be 100 nM or less (e.g., 10 nM or less, or 1 nM or less) and could be as low as 100 pM or 10 pM. Preferably, the PARP IC50is 0.1 nM to 1 µM (e.g., 0.1 nM to 750 nM, 0.1 nM to 500 nM, or 0.1 nM to 250 nM). For example, certain PARP inhibitors may be prepared using techniques and methods disclosed in, e.g., International Application No. PCT / US2022 / 025357, which is incorporated by reference herein. The PARP inhibitor may be, e.g., olaparib, rucaparib, veliparib (ABT-888), niraparib (ZL-2306), iniparib (BSI-201), talazoparib (BMN 673), 2X-121, CEP-9722, KU-0059436 (AZD2281), PF-01367338, AZD5305, AZD9574, seneparib (IMP4297), fluzoparib (SHR-3162), XIN005104, NMS-293 or a combination thereof. Non-limiting examples of PARP inhibitors include those described in PCT applications PCT / CN2022 / 086311, PCT / CN2022 / 115259, PCT / US2022 / 027334, PCT / CN2022 / 088989, and PCT / CN2022 / 087969 and U.S. Patent Nos.11,325,906, 8,716,493, 8,236,802, 8,071,623, 8,012,976, 7,732,491, 7,550,603, 7,531,530, 7,151,102, and 6,495,541, each of which is incorporated herein by reference herein. A PARP inhibitor may be isotopically enriched (e.g., enriched for deuterium). In some embodiments, the PARP inhibitor is olaparib or talazoparib. iv. Antibody drug conjugates In some embodiments, the method includes administering to the subject an antibody drug conjugate (ADC). ADCs that may be used in the present invention include conjugates that upon contacting cancer cells, whether in vitro, in cell culture, or in an animal, inhibit the cancer cell, such that the measured IC50is 10 µM or less (e.g., 5 µM or less or 1 µM or less). For certain ADCs, the IC50may be 100 nM or less (e.g., 10 nM or less, or 1 nM or less) and could be as low as 100 pM or 10 pM. Preferably, the ADC IC50is 0.1 nM to 1 µM (e.g., 0.1 nM to 750 nM, 0.1 nM to 500 nM, or 0.1 nM to 250 nM). ADCs include Disitamab vedotin, Belantamab mafodotin, Trastuzumab deruxtecan, Ujvira, Mirvetuximab soravtansine, Gemtuzumab ozogamicin, Enfortumab vedotin, Inotuzumab ozogamicin, Trastuzumab emtansine, Tisotumab vedotin, Sacituzumab govitecan, Polatuzumab vedotin, Loncastuximab Tesirine, Brentuximab vedotin, PF-06804103, MGTA-117, FOR46, MRG001, SOT102, ZV0203, AOC 1020, PRO1184, BAT8009, BB-1705, JS107, SHR-A1912, CMG901, Ladiratuzumab vedotin, BAT8006, RC108, BAT8008, Mipasetamab Uzoptirine, NBE-002, Zanidatamab zovodotin, F0002-ADC, SKB315, GQ1001, ABBV-637, XMT-2056, TORL-1-23, FDA022, DYNE-251, STI-6129, Ozuriftamab vedotin, Farletuzumab Ecteribulin, Trastuzumab vedotin, DB-1303, OMTX705, TRS005, Ispectamab debotansine, DXC-005, ESG-401, ARX788, BAT8010, Tusamitamab ravtansine, ABBV-154, Naratuximab emtansine, PSMA ADC, TAK-164, ADCT-602, ADCT-901, SHR-A1201, GB251, ABL202, SHR-A1921, 9MW2821, HS-20093, BIO-106, SKB264, Camidanlumab Tesirine, Datopotamab deruxtecan, Telisotuzumab vedotin, Ladiratumab vedotin, L-DOS47, AVID100, OBI-999, DP303c, AURIXIM, MT-8633, IMGC936, BB-1701, AOC 1001, JS108, TAC-001, SYSA1801, SHR-A2009, TORL- 2-307-ADC, BL-M07D1, STRO-001, A166, Mecbotamab vedotin, Trastuzumab duocarmazine, ASN004, ABBV-011, Mirzotamab clezutoclax, OBT076, HS630, SGN-STNV, FDA018, ABBV-400, AZD8205, IBI- 343, SGN-ALPV, TAK-500, JBH492, ALT-P7, Ifinatamab deruxtecan, DXC-004, IMGN151, XMT-1660, M1231, LM-102, ORM-5029, STI-3258, SGN-B7H4V, TPX-4589, IKS03, Zilovertamab Vedotin, ARX517, Pivekimab Sunirine, Lonigutamab Ugodotin, TRPH-222, MRG004a, DS-6000a, REGN5093-M114, Trastuzumab imbotolimod, RC88, HTI-1066, BI-CON-02, SGN-CD228A, AOC 1044, DB-1305, ABBV- 319, Patritumab Deruxtecan, RC118, Trastuzumab re...

Claims

CLAIMS 1. A conjugate, or a pharmaceutically acceptable salt thereof, described by formula (D-I) or (M-I):wherein each of A1and A2, independently, has the structure of formula (A): ,m is 0, 1, 2, 3, 4, 5, or 6; s is 0 or 1; each of X1, X2, X3, X4, X5, and X6is, independently, N, CR4, or C-Y-R5, wherein at least one of X1, X2, X3, X4, X5, and X6is C-Y-R5and R5is a bond to L; R1isZ is O, S, or sulfonyl; each of R2aand R2bis, independently, H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; each R3is, independently, OH, SH, halogen, optionally substituted amino, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; R4is H, halogen, OH, SH, optionally substituted amino, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl;each of R6aand R6bis, independently, H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; Y is a first linker; L is a second linker; n is 1 or 2; each E is a polypeptide comprising an anti-PD-1 scFv-Fc domain monomer ; T is an integer from 1 to 20; and the squiggly line indicates that L is covalently attached to E.

2. The conjugate of claim 1, or a pharmaceutically acceptable salt thereof, wherein the conjugate is described by formula (D-I):

3. The conjugate of claim 1, or a pharmaceutically acceptable salt thereof, wherein the conjugate is described by formula (M-I):

4. The conjugate of any one of claims 1-3, or a pharmaceutically acceptable salt thereof, wherein A1and A2have the structure of formula (A-I):

5. The conjugate of claim 4, or a pharmaceutically acceptable salt thereof, wherein A1and A2each have the structure of formula (A-la):

6. The conjugate of claim 5, or a pharmaceutically acceptable salt thereof, wherein A1and A2each have the structure of formula (A-lb):

7. The conjugate of any one of claims 1 -3, or a pharmaceutically acceptable salt thereof, wherein A1andA2each have the structure of formula (A-ll):

8. The conjugate of claim 7, or a pharmaceutically acceptable salt thereof, wherein A1and A2each have the structure of formula (A-lla):

9. The conjugate of claim 8, or a pharmaceutically acceptable salt thereof, wherein A1and A2each have the structure of formula (A-IIb):

10. The conjugate of any one of claims 1-9, or a pharmaceutically acceptable salt thereof, wherein s is 0.

11. The conjugate of any one of claims 1-9, or a pharmaceutically acceptable salt thereof, wherein s is 1.

12. The conjugate of any one of claims 1-11, or a pharmaceutically acceptable salt thereof, wherein each of R2aand R2bis, independently, H, optionally substituted C1-C20alkyl, or optionally substituted C1-C20heteroalkyl.

13. The conjugate of claim 12, or a pharmaceutically acceptable salt thereof, wherein each of R2aand R2bis H.

14. The conjugate of any one of claims 1-13, or a pharmaceutically acceptable salt thereof, wherein R4is H, halogen, OH, SH, optionally substituted amino, optionally substituted C1-C20alkyl, or optionally substituted C1-C20heteroalkyl.

15. The conjugate of claim 14, or a pharmaceutically acceptable salt thereof, wherein R4is halogen.

16. The conjugate of claim 15, or a pharmaceutically acceptable salt thereof, wherein R4is Cl.

17. The conjugate of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, wherein R1is.

18. The conjugate of any one of claims 1-17, or a pharmaceutically acceptable salt thereof, wherein R1is.

19. The conjugate of claim 18, or a pharmaceutically acceptable salt thereof, wherein each of R6aand R6bis, independently, H, optionally substituted C1-C20alkyl, or optionally substituted C1-C20heteroalkyl.

20. The conjugate of claim 19, or a pharmaceutically acceptable salt thereof, wherein each of R6aand R6bis, independently, H, -CH3, -CH2CH3, -CH2OH, -CH2OCH3-CH2CH2OH, or -CH2CH2OCH3.

21. The conjugate of claim 20, or a pharmaceutically acceptable salt thereof, wherein each of R6aand R6bis H.

22. The conjugate of any one of claims 1-21, wherein Y is: ,each of p1, p2, p3, and p4 is, independently, 0, 1, 2, 3, or 4; q is 0, 1, 2, 3, or 4; each X7is, independently, N or CH; each X8is, independently, O, NH, CH2, or C(=O); RN1is H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, optionally substituted C2-C19heteroaryl, optionally substituted C1-C20alkaryl, or optionally substituted C1-C20alkylcycloalkyl; each R7is, independently,, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, or optionally substituted C2-C20heterocycloalkenyl; each of R7aand R7bis, independently, H, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl,optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl; and each R8is, independently, halogen, OH, SH, optionally substituted amino, optionally substituted C1-C20alkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20alkynyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C3-C20cycloalkenyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C2-C20heterocycloalkenyl, optionally substituted C6-C18aryl, or optionally substituted C2-C19heteroaryl.

23. The conjugate of claim 22, or a pharmaceutically acceptable salt thereof, wherein Y is24. The conjugate of claim 23, or a pharmaceutically acceptable salt thereof, wherein q is 1 and Y is25. The conjugate of claim 24, or a pharmaceutically acceptable salt thereof, wherein R7isand Y is26. The conjugate of claim 24, or a pharmaceutically acceptable salt thereof, wherein Y is.

27. The conjugate of claim 23, or a pharmaceutically acceptable salt thereof, wherein q is 0 and Y is28. The conjugate of any one of claims 23-27, or a pharmaceutically acceptable salt thereof, wherein RN1is H,29. The conjugate of any one of claims 1-22, or a pharmaceutically acceptable salt thereof, wherein Y is.

30. The conjugate of any one of claims 1-22, or a pharmaceutically acceptable salt thereof, wherein Y is.

31. The conjugate of claim 30, or a pharmaceutically acceptable salt thereof, wherein Y is32. The conjugate of any one of claims 1-22, or a pharmaceutically acceptable salt thereof, wherein Y is.

33. The conjugate of claim 32, or a pharmaceutically acceptable salt thereof, wherein Y is.

34. The conjugate of claim 33, or a pharmaceutically acceptable salt thereof, wherein Y is35. The conjugate of any one of claims 1-22, or a pharmaceutically acceptable salt thereof, wherein Y is.

36. The conjugate of claim 35, or a pharmaceutically acceptable salt thereof, wherein Y is.

37. The conjugate of claim 36, or a pharmaceutically acceptable salt thereof, wherein Y is.

38. The conjugate of any one of claims 1-37, or a pharmaceutically acceptable salt thereof, wherein L comprises one or more optionally substituted C1-C40alkylene, optionally substituted C1-C40heteroalkylene, optionally substituted C1-C40alkoxylene, optionally substituted C2-C20alkenylene, optionally substituted C2-C20heteroalkenylene, optionally substituted C2-C20alkynylene, optionally substituted C2-C20heteroalkynylene, optionally substituted C3-C20cycloalkylene, optionally substituted C2- C20heterocycloalkylene, optionally substituted C4-C20cycloalkenylene, optionally substituted C4-C20heterocycloalkenylene, optionally substituted C8-C20cycloalkynylene, optionally substituted C8-C20heterocycloalkynylene, optionally substituted C5-C15arylene, optionally substituted C2-C15heteroarylene, O, S, NRi, P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, or imino, wherein Riis H, optionally substituted C1-C20alkyl, optionally substituted C1-C20heteroalkyl, optionally substituted C2-C20alkenyl, optionally substituted C2-C20heteroalkenyl, optionally substituted C2- C20alkynyl, optionally substituted C2-C20heteroalkynyl, optionally substituted C3-C20cycloalkyl, optionally substituted C2-C20heterocycloalkyl, optionally substituted C4-C20cycloalkenyl, optionally substituted C4- C20 heterocycloalkenyl, optionally substituted C8-C20cycloalkynyl, optionally substituted C8-C20heterocycloalkynyl, optionally substituted C5-C15aryl, or optionally substituted C2-C15heteroaryl.

39. The conjugate of any one of claims 1-38, or a pharmaceutically acceptable salt thereof, wherein L is oxo substituted.

40. The conjugate of any one of claims 1-39, or a pharmaceutically acceptable salt thereof, wherein the backbone of L comprises between 1 and 250 atoms.

41. The conjugate of any one of claims 1-40, or a pharmaceutically acceptable salt thereof, wherein L is capable of forming an amide, a carbamate, a sulfonyl, or a urea linkage.

42. The conjugate of any one of claims 3-41, or a pharmaceutically acceptable salt thereof, wherein L is described by the formula: J1-(Q1)g-(T1)h-(Q2)i-(T2)j-(Q3)k-(T3)l-(Q4)m-(T4)n-(Q5)o-J2wherein J1is a bond attached to A1; J2is a bond attached to E or is a functional group capable of reacting with a functional group conjugated to E; each of Q1, Q2, Q3, Q4, and Q5is, independently, optionally substituted C1-C40 alkylene, optionally substituted C1-C40 heteroalkylene, optionally substituted C1-C40 alkoxylene, optionally substituted C2-C20 alkenylene, optionally substituted C2-C20 heteroalkenylene, optionally substituted C2-C20 alkynylene, optionally substituted C2-C20 heteroalkynylene, optionally substituted C3-C20 cycloalkylene, optionally substituted C2-C20heterocycloalkylene, optionally substituted C4-C20 cycloalkenylene, optionally substituted C4-C20 heterocycloalkenylene, optionally substituted C8-C20 cycloalkynylene, optionally substituted C8-C20 heterocycloalkynylene, optionally substituted C5-C15 arylene, or optionally substituted C2-C15 heteroarylene; each of T1, T2, T3, T4is, independently, O, S, NRi, P, carbonyl, thiocarbonyl, sulfonyl, phosphate, phosphoryl, imino, or oximo; Riis H, optionally substituted C1-C20 alkyl, optionally substituted C1-C20 heteroalkyl, optionally substituted C2-C20 alkenyl, optionally substituted C2-C20 heteroalkenyl, optionally substituted C2-C20 alkynyl, optionally substituted C2-C20 heteroalkynyl, optionally substituted C3-C20 cycloalkyl, optionallysubstituted C2-C20heterocycloalkyl, optionally substituted C4-C20 cycloalkenyl, optionally substituted C4- C20 heterocycloalkenyl, optionally substituted C8-C20 cycloalkynyl, optionally substituted C8-C20 heterocycloalkynyl, optionally substituted C5-C15 aryl, or optionally substituted C2-C15 heteroaryl; and each of g, h, i, j, k, l, m, n, and o is, independently, 0, 1, or 2.

43. The conjugate of claim 42, or a pharmaceutically acceptable salt thereof, wherein Q1is44. The conjugate of claim 42 or 43, or a pharmaceutically acceptable salt thereof, wherein Q2is optionally substituted C1-C40alkylene, optionally substituted C1-C40heteroalkylene, optionally substituted C1-C40alkoxylene, or optionally substituted C2-C15heteroarylene.

45. The conjugate of any one of claims 42-44, or a pharmaceutically acceptable salt thereof, wherein Q3is optionally substituted C2-C15heteroarylene.

46. The conjugate of any one of claims 42-45, or a pharmaceutically acceptable salt thereof, wherein Q4is optionally substituted C1-C40alkylene, optionally substituted C1-C40heteroalkylene, or optionally substituted C1-C40alkoxylene.

47. The conjugate of any one of claims 42-46, or a pharmaceutically acceptable salt thereof, wherein J2is.

48. A conjugate, or a pharmaceutically acceptable salt thereof, described by a formula of Table 2.

49. The conjugate of any one of claims 1-48, or a pharmaceutically acceptable salt thereof, wherein the squiggly line connected to E indicates that the L of each A1-L or each A1-L-A2is covalently attached to a nitrogen atom of a solvent-exposed lysine of E.

50. The conjugate of any one of claim 1-48, or a pharmaceutically acceptable salt thereof, wherein the squiggly line connected to E indicates that the L of each A1-L or each A1-L-A2is covalently attached to the sulfur atom of a solvent-exposed cysteine of E.

51. The conjugate of any one of claims 1-48, or a pharmaceutically acceptable salt thereof, wherein n is 2, and each E dimerizes to form an Fc domain.

52. The conjugate of any one of claims 1-49, wherein the polypeptide of each E comprises the structure, from N-terminal to C-terminal: VL-K1-VH-K2-G or VH-K1-VL-K2-G wherein VLis an anti-PD-1 light chain variable region; VHis an anti-PD-1 heavy chain variable region; G is an Fc domain monomer; and K1and K2are each, independently, a linker.

53. The polypeptide of claim 52, wherein VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 121, 124, and 125; and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 126, 129, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 130, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 136, and 137;VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 130, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 136, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 130, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 136, and 137;VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 130, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 136, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 138, 139, and 140 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 141, 142, and 143; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 144, and 145 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 146, 147, and 148; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 149, 150, and 151 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 152, 153, and 154; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 155, 156, and 157 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 158, 159, and 160; or VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 161, 162, and 163 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 164, 165, and 166.

54. The polypeptide of claim 52, wherein VLcomprises a sequence set forth in SEQ ID NO: 167 and VHcomprises a sequence set forth in SEQ ID NO: 176; VLcomprises a sequence set forth in SEQ ID NO: 168 and VHcomprises a sequence set forth in SEQ ID NO: 177;VLcomprises a sequence set forth in SEQ ID NO: 168 and VHcomprises a sequence set forth in SEQ ID NO: 178; VLcomprises a sequence set forth in SEQ ID NO: 168 and VHcomprises a sequence set forth in SEQ ID NO: 179; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 170 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 171 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 172 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 173 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 181; VLcomprises a sequence set forth in SEQ ID NO: 170 and VHcomprises a sequence set forth in SEQ ID NO: 181; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 182; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 183; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 184; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 185; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 186; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 187; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 188; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 189; VLcomprises a sequence set forth in SEQ ID NO: 174 and VHcomprises a sequence set forth in SEQ ID NO: 190; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 191; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 192; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 193;VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 194; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 195; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 196; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 197; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 198; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 199; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 200; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 201; VLcomprises a sequence set forth in SEQ ID NO: 175 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 202; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 203; or VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO:

204.

55. The polypeptide of any one of claims 52-54, wherein K1and K2are each, independently, a peptide linker comprising between 1 and 200 amino acids or a bond.

56. The polypeptide of claim 55, wherein K1and K2are each, independently, a peptide linker comprising between 5 and 25 amino acids.

57. The polypeptide of any one of claims 52-56, wherein K1and K2are each an independently selected peptide linker comprising the amino acid sequence of any one of (GS)x, (GGS)x, (GGGGS)x, (GGSG)x, (SGGG)x, or (GGGGS)xGGG, wherein x is an integer from 1 to 10.

58. The polypeptide of any one of claims 52-57, wherein the Fc domain monomer is an IgG1 Fc domain monomer.

59. The polypeptide of any one of claims 52-58, wherein the Fc domain monomer comprises a substitution mutation at N297 selected from N297A, N297G, or N297Q, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index.

60. The polypeptide of any one of claims 52-59, wherein the Fc domain monomer comprises a C220S substitution mutation, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index.

61. The polypeptide of any one of claims 52-60, wherein the Fc domain monomer comprises a M252Y, a S254T, and a T256E substitution mutation, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index.

62. The polypeptide of any one of claims 52-61, wherein the Fc domain monomer comprises the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283.

63. The polypeptide of claim 62, wherein the Fc domain monomer comprises the amino acid sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 17, or SEQ ID NO:

18.

64. The polypeptide of claim 63, wherein the Fc domain monomer comprises the amino acid sequence of any one of SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 113, SEQ ID NO: 114, or SEQ ID NO:

118.

65. The polypeptide of any one of claims 52-57, wherein the polypeptide of each E comprises the amino acid sequence of any one of SEQ ID NOs: 205-272 and 284.

66. A dimer comprising: a first polypeptide described by any one of claims 52-65; and a second polypeptide described by any one of claims 52-65; wherein the Fc domain monomer of the first polypeptide and the Fc domain monomer of the second polypeptide dimerize to form an Fc domain.

67. The dimer of claim 66, wherein the first polypeptide and the second polypeptide have the same amino acid sequence and the dimer is a homodimer.

68. A pharmaceutical composition comprising the polypeptide of any one of claims 52-65 or the dimer of claims 66 or 67 and a pharmaceutically acceptable carrier.

69. The conjugate of any one of claims 1-68, or a pharmaceutically acceptable salt thereof, wherein T is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.

70. A population of conjugates of any one of claims 1-68, or a pharmaceutically acceptable salt thereof, wherein the average value of T is 1 to 10.

71. A population of conjugates of claim 70, or a pharmaceutically acceptable salt thereof, wherein the average value of T is 1 to 5.

72. A pharmaceutical composition comprising a conjugate or a population of conjugates of any one of claims 1-71 , or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.

73. A method of treating a cancer in a subject, the method comprising administering to the subject a conjugate, population of conjugates, or pharmaceutical composition of any one of claims 1 -72.

74. The method of claim 73, wherein the cancer is selected from lung cancer, optionally non-small cell lung cancer or small-cell lung cancer; head and neck cancer, squamous cell carcinoma; renal cell carcinoma; breast cancer; ovarian cancer; pancreatic cancer; colorectal cancer; urothelial cancer; bile duct cancer; endometrial cancer; melanoma; or esophageal cancer.

75. The method of claim 74, wherein the breast cancer is triple negative breast cancer.

76. The method of claim 74, wherein the cancer is PD-L1 positive.

77. The method of claim 75, wherein the triple negative breast cancer is PD-L1 positive.

78. The method of any one of claims 73-77, wherein the cancer is a solid tumor.

79. The method of any one of claims 73-78, wherein the cancer overexpresses or is known to overexpress CD73 relative to a non-cancerous cell of the same tissue type.

80. The method of any one of claims 73-79, further comprising administering to the subject an antibody drug conjugate.81 . The method of claim 80, wherein the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004.

82. A method of treating a PD-L1 positive cancer in a subject, the method comprising administering to the subject a conjugate, population of conjugates, or pharmaceutical composition of any one of claims 1 -72 and an antibody drug conjugate.

83. The method of claim 82, wherein the PD-L1 positive cancer is triple negative breast cancer.

84. The method of claim 82 or 83, wherein the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004.

85. The method of any one of claims 72-84, wherein the conjugate, population of conjugates, or pharmaceutical composition is administered intramuscularly, intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally,intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, locally, by inhalation, by injection, or by infusion.

86. A polypeptide comprising the structure, from N-terminal to C-terminal: VL-L1-VH-L2-B or VH-L1-VL-L2-B wherein VLis an anti-PD-1 light chain variable region; VHis an anti-PD-1 heavy chain variable region; B is an Fc domain monomer; and L1and L2, are each, independently, a peptide linker.

87. The polypeptide of claim 86, wherein VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 121, 124, and 125; and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 126, 129, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 130, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 136, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 130, and 137;VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 127, 136, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 130, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 136, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 130, and 137;VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 131, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 132, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 133, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 134, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 135, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 123, 124, and 125 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 128, 136, and 137; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 138, 139, and 140 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 141, 142, and 143; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 122, 144, and 145 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 146, 147, and 148; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 149, 150, and 151 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 152, 153, and 154; VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 155, 156, and 157 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 158, 159, and 160; or VLcomprises an LCDR1, LCDR2, and LCDR3 comprising the sequences set forth in SEQ ID NOs: 161, 162, and 163 and VHcomprises an HCDR1, HCDR2, and HCDR3 comprising the sequences set forth in SEQ ID NOs: 164, 165, and 166.

88. The polypeptide of claim 86, wherein VLcomprises a sequence set forth in SEQ ID NO: 167 and VHcomprises a sequence set forth in SEQ ID NO: 176; VLcomprises a sequence set forth in SEQ ID NO: 168 and VHcomprises a sequence set forth in SEQ ID NO: 177; VLcomprises a sequence set forth in SEQ ID NO: 168 and VHcomprises a sequence set forth in SEQ ID NO: 178;VLcomprises a sequence set forth in SEQ ID NO: 168 and VHcomprises a sequence set forth in SEQ ID NO: 179; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 170 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 171 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 172 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 173 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 181; VLcomprises a sequence set forth in SEQ ID NO: 170 and VHcomprises a sequence set forth in SEQ ID NO: 181; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 182; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 183; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 184; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 185; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 186; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 187; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 188; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 189; VLcomprises a sequence set forth in SEQ ID NO: 174 and VHcomprises a sequence set forth in SEQ ID NO: 190; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 191; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 192; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 193; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 194;VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 195; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 196; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 197; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 198; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 199; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 200; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 201; VLcomprises a sequence set forth in SEQ ID NO: 175 and VHcomprises a sequence set forth in SEQ ID NO: 180; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 202; VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO: 203; or VLcomprises a sequence set forth in SEQ ID NO: 169 and VHcomprises a sequence set forth in SEQ ID NO:

204.

89. The polypeptide of any one of claims 86-88, wherein L1and L2are each, independently, a peptide linker comprising between 1 and 200 amino acids or a bond.

90. The polypeptide of claim 89, wherein L1and L2are each, independently, a peptide linker comprising between 5 and 25 amino acids.

91. The polypeptide of any one of claims 86-90, wherein L1and L2are each an independently selected peptide linker comprising the amino acid sequence of any one of (GS)x, (GGS)x, (GGGGS)x, (GGSG)x, (SGGG)x, or (GGGGS)xGGG, wherein x is an integer from 1 to 10.

92. The polypeptide of any one of claims 86-91, wherein the Fc domain monomer is an IgG1 Fc domain monomer.

93. The polypeptide of any one of claims 86-92, wherein the Fc domain monomer comprises a substitution at N297 selected from N297A, N297G, or N297Q, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index.

94. The polypeptide of any one of claims 86-93, wherein the Fc domain monomer comprises a C220S substitution, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index.

95. The polypeptide of any one of claims 86-94, wherein the Fc domain monomer comprises a M252Y, a S254T, and a T256E substitution, wherein the amino acid numbering of each Fc domain monomer is according to the Kabat EU index.

96. The polypeptide of any one of claims 86-91 , wherein the Fc domain monomer comprises the amino acid sequence of any one of SEQ ID NOs: 1-120 and 283.

97. The polypeptide of claim 96, wherein the Fc domain monomer comprises the amino acid sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 17, or SEQ ID NO: 18.

98. The polypeptide of claim 97, wherein the Fc domain monomer comprises the amino acid sequence of any one of SEQ ID NO: 80, SEQ ID NO: 81 , SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 113, SEQ ID NO: 114, or SEQ ID NO: 118.

99. The polypeptide of any one of claims 86-91 , wherein the polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 205-272 and 284.

100. A dimer comprising: a first polypeptide described by any one of claims 86-99; and a second polypeptide described by any one of claims 86-99; wherein the Fc domain monomer of the first polypeptide and the Fc domain monomer of the second polypeptide dimerize to form an Fc domain.101 . The dimer of claim 100, wherein the first polypeptide and the second polypeptide have the same amino acid sequence and the dimer is a homodimer.

102. A pharmaceutical composition comprising the polypeptide of any one of claims 86-99 or the dimer of claims 100 or 101 and a pharmaceutically acceptable carrier.

103. A method of treating a cancer in a subject, the method comprising administering to the subject an effective amount of a polypeptide of any one of claims 86-99, the dimer of claims 100 or 101 , or a pharmaceutical composition of claim 102.

104. The method of claim 103, wherein the cancer is selected from lung cancer, optionally non-small cell lung cancer or small-cell lung cancer; head and neck cancer, optionally squamous cell carcinoma; renal cell carcinoma; breast cancer; ovarian cancer; pancreatic cancer; colorectal cancer; urothelial cancer; bile duct cancer; endometrial cancer; melanoma; or esophageal cancer.

105. The method of claim 104, wherein the breast cancer is triple negative breast cancer.

106. The method of claim 104, wherein the cancer is PD-L1 positive.

107. The method of claim 105, wherein the triple negative breast cancer is PD-L1 positive.

108. The method of any one of claims 103-107, wherein the cancer is a solid tumor.

109. The method of any one of claims 103-108, wherein the cancer overexpresses or is known to overexpress PD-1 relative to a non-cancerous cell of the same tissue type.

110. The method of any one of claims 103-109, further comprising administering to the subject an antibody drug conjugate.

111. The method of claim 110, wherein the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004.

112. A method of treating a PD-L1 positive cancer in a subject, the method comprising administering to the subject a polypeptide of any one of claims 86-99, the dimer of claims 100 or 101 , or a pharmaceutical composition of claim 102 and an antibody drug conjugate.

113. The method of claim 112, wherein the PD-L1 positive cancer is triple negative breast cancer.

114. The method of claim 112 or 113, wherein the antibody drug conjugate is Sacituzumab govitecan, Trastuzumab deruxtecan, Datopotamab deruxtecan, Enfortumab vedotin, Tisotumab vedotin, Ladiratumab vedotin, M9140, or ASN004.

115. The method of any one of claims 103-114, wherein the polypeptide, dimer, or pharmaceutical composition is administered intramuscularly, intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically , intraocularally, orally, locally, by inhalation, by injection, or by infusion.