Cyclic dinucleotides and conjugates thereof with antibodies
Novel cyclic dinucleotides with phosphorothioate/phosphonothioate linkages and antibody conjugates via cleavable linkers address activation across all STING haplotypes, improving stability and efficacy in treating cancers by inducing cytokine and interferon expression.
Patent Information
- Application Number
- PCT/CZ2025/050016
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-02-29
- Filing Date
- 2025-02-23
- Publication Date
- 2025-09-04
AI Technical Summary
Existing cyclic dinucleotides and their conjugates face challenges in activating all STING haplotypes identified in humans, with limited efficacy and stability issues, particularly in plasma, and synthesis difficulties due to regioisomer resolution and low yields.
Development of cyclic dinucleotides with phosphorothioate and phosphonothioate groups, linked via adenine bases to antibodies through cleavable linkers, ensuring targeted delivery and controlled release at the site of action, enhancing activation across all STING haplotypes and improving plasma stability.
The novel cyclic dinucleotides and antibody conjugates demonstrate potent STING activation, increasing half-life and therapeutic effect, effectively inducing cytokine and interferon expression for treating various cancers, including solid tumors and lymphomas.
Smart Images

Figure CZ2025050016_04092025_PF_FP_ABST
Abstract
Description
[0001] Cyclic dinucleotides and conjugates thereof with antibodies Field of Art The present disclosure relates to cyclic dinucleotides and their conjugates with antibodies that may be useful in the treatment of diseases in which modulation of STING adaptor protein (STING = Stimulator of Interferon Genes) is beneficial. Background Art The innate immune system recognizes the presence of pathogens or disruptions in host homeostasis through a variety of Pattern Recognition Receptors (PRRs). These receptors detect a limited set of ligands associated with pathogens or damage, commonly referred to as Pathogen or Damage-Associated Molecular Patterns (PAMPs and DAMPs) (Takeuchi O et al., Cell, 2010:140, 805-820). Over the past three decades, several PRRs have been identified, including Toll-like receptors, retinoic acid-inducible gene (RIG-I)-like receptors, nucleotide-binding oligomerization domain-like (NOD) receptors, C-type lectin receptors, and cytosolic DNA sensors (Brubaker SW et al., Annu Rev Immunol, 2015:33, 257- 290). Recognition of PAMPs and DAMPs by PRRs leads to the upregulation of cytokines and chemokines, including interferons, and recruits immune cells to sites of infection or damage. These processes contribute to the development of antitumoral adaptive immunity. In healthy cells, cellular DNA is typically confined to the nucleus and mitochondria. The presence of DNA in the cytosol is therefore an indicator of either pathogenic activity or disruption in host homeostasis. Cytosolic DNA sensing is initiated by various DNA sensors, such as DNA-dependent activator of IRFs (DAI), cyclic guanosine-adenosine synthase (cGAS), DEAD-box polypeptide 41 (DDX41), and absent in melanoma 2 (AIM2) (Unterholzner L, Immunology, 2013: 218, 1312-1321). cGAS serves as the primary sensor of cytosolic DNA; upon DNA binding, it synthesizes a second messenger, cyclic dinucleotide (CDN), called 2'3'-cGAMP (Zhang et al., Molecular Cell, 2013:51, 226– 235). This CDN activates STING (Stimulator Of Interferon Genes, also known as TMEM173, MITA, ERIS), which in turn triggers the expression of type I and III interferons and proinflammatory cytokines via TBK1 / IKK kinases and transcription factors IRF3, STAT6, and NF-kB (Burdette et al., Nature, 2011: 478, 515–518; Motwani et al., Nat Rev Genet, 2019: 20, 657-674). CDNs that have an affinity for STING contain two purine nucleotide monophosphates linked with either two 3′-5′ (3′3′-CDNs), two 2′-5′ (2′2′-CDNs), or a combination of 2′-5′ and 3′-5′ phosphodiester bonds (2′3′-CDNs). The prototype 2'3' cGAMP (c[G(2’,5’)pA(3’,5’)p]) is synthesized by the cGAS enzyme, while 3′3′ cGAMP, 3′3′ c-diAMP, and 3′3′ c-diGMP are produced by bacterial dinucleotide cyclases (Zhang et al., Molecular Cell, 2013:51, 226–235; Novotna et al., Biochemistry, 2021:60, 3714-3727). Cyclic dinucleotides (CDNs) are believed to foster the priming of both cellular and humoral immunity. For instance, type I IFNs, whose expression is triggered by STING activation, have shown promise in the treatment of various human cancers (Cohen et al., N Engl J Med, 2005:353, 2477-2490; Tsao et al., N Engl J Med, 2004:351, 998-1012). They can directly inhibit tumor cell proliferation and demonstrate synergy with many approved anticancer agents. Furthermore, type I IFNs can act on immune cells to trigger antitumor responses (Musella et al., Oncoimmunology, 2017:6, e1314424). In mouse models, type I IFN signaling was found to be essential for tumor-initiated T-cell priming. Animals lacking the IFN-α / β receptor in dendritic cells failed to reject immunogenic tumors and showed defects in antigen cross-presentation to CD8+ T cells (Fuertes et al., J Exp Med, 2011:208, 2005–2016; Diamond et al., J Exp Med, 2011:208, 1989–2003). Consistent with these findings, intratumoral injections of STING agonists have been shown to induce regression of established tumors in mice, generating substantial systemic immune responses capable of rejecting distant metastases and providing long-lasting immunological memory (Corrales et al., Cell Rep, 2015:11, 1018-1030). Disclosure of the Invention In one aspect, the invention relates to compounds of formula I: wherein R is selected from H, , , ; wherein R1 is selected from H, F, and Cl; R3 is selected from C1-C6alkyl, and amino acid side chains; -L- is selected from –C(O)- and –C(O)-O-CH2-CH2-N(CH3)-C(O)-; -K- is selected from -C(O)-(CH2)m-, -C(O)-(CH2CH2O)n-CH2CH2-, -C(O)-(CH2CH2O)n-CH2CH2NH- C(O)-(CH2)p-, -C(O)-(CH2)m-NH-C(O)-(CH2)p-, -C(O)-(CH2)m-N(CH3)-C(O)-(CH2)p-; wherein m=1-8, n=1-8, p=1-5; or a pharmaceutically acceptable salt or solvate or formulation thereof. In some embodiments, R1 is preferably H. In some embodiments, R1 is preferably F or Cl. In these embodiments, R1 increases the plasma stability of the compounds. Preferably, R3 is selected from C1-C6alkyl (preferably methyl), –(CH2)3-NH-C(O)-NH2. In some preferred embodiments, -K- is -C(O)-(CH2)m-. In some embodiments, m is 1 to 5. In some embodiments, p is 1. In some embodiments, C1-C6alkyl refers to linear or branched saturated alkyl chain. Examples include methyl, ethyl, propyl, isopropyl. In some embodiments, „amino acid sidechain“ refers to a side chain of an amino acid, said side chain being preferably selected from CH3–, HN=C(NH2)-NH-(CH2)3–, H2N-CO-CH2–, HOOC-CH2–, HS- CH2–, H2N-CO-(CH2)2–, HOOC-(CH2)2–, H–, CH3-CH2-CH(CH3)–, (CH3)2-CH-CH2–, H2N-(CH2)4–, CH3-S-(CH2)2–, Ph-CH2–, HO-CH2–, CH3-CH(OH)–, HO-Ph-CH2–, (CH3)2-CH–, –(CH2)3-NH-C(O)- In a second aspect, the present invention relates to a compound of formula II, and its pharmaceutically acceptable salts or solvates: The compound of formula II is a cyclic dinucleotide bearing one phosphorothioate group and one phosphonothioate group. Within the scope of the invention, cyclic dinucleotides were found to exhibit varying activation abilities for different STING haplotypes. Only a limited number of cyclic dinucleotides exhibited activity against all STING haplotypes identified in humans. Compound of formula II demonstrated a potent activatory activity against all STING haplotypes. Furthermore, it has been found that the activity of antibody-CDN conjugates containing phosphorothio / phosphonothio linkages was significantly improved compared to analogs containing phosphodiester / phosphonoester linkages in vivo. Moreover, it was found that it is advantageous to limit the number of free hydroxy and amino groups on the cyclic dinucleotide to a minimum in order to facilitate the synthesis of CDN conjugates. The compound of formula II complies with all these requirements. In a third aspect, the invention relates to compounds of general formula III and their pharmaceutically acceptable salts and solvates, wherein R1, R3, L and K are as defined herein above. The conjugates of formula III contain an active moiety corresponding to the compound of formula II and a linker moiety allowing to bind the active moiety to a targeting carrier such as an antibody. Within the framework of the invention, it was found that binding the linker moiety via the thiol group on phosphorus in the parent compound II leads to a significant decrease in plasma stability of antibody CDN cojugates, and presents challenges in synthesis such as difficult resolution of regiomers and low yields. It is therefore necessary to bind the linker moiety via the adenine base. The linker moieties are designed to allow for the targeting of the active moiety, to provide a sufficient stability of the conjugate and / or to enable a controlled release of the active moiety at the site of action. The linker connects the CDN and the antibody through a covalent linkage. Within the framework of the invention, the linker part is a cleavable linker comprising one or more cleavable elements. Each cleavable element is independently selected from spacer -L- containing a self-immolative linker or carbonyl group; an enzymatically-cleavable peptide linker containing preferably PAB-Cit-Val or PAB- Ala-Val spacer; and linker part -K- containing alkyl and / or PEG spacer which is connected to maleimide group. Maleimide group is typically suitable for a coupling with reactive thiol moieties of antibodies in antibody–drug conjugates. In some preferred embodiments, the invention relates to compounds of formula 3.3-3.10 and 3.13-3.18, and their pharmaceutically acceptable salts and solvates. 5 5 In a fourth aspect, the invention relates to compounds of formula IV, V or VI, and their pharmaceutically acceptable salts and solvates, wherein R1, R3, L and K are as defined herein above: (IV), In the compounds of formulas IV, V, VI the active moiety is bound via the linker to an antibody to form an antibody-CDN conjugate. The antibody is bound via its cysteine residue. „-S-antibody“ thus refers to an antibody bound via a cysteine residue. The antibody serves to target the active moiety as desired and / or to increase the therapeutic effect by increasing the amount of the active moiety at the site of the action. It is thus preferred if the target antigen of the antibody is a tumor antigen. It was found that the antibodies significantly improve pharmacokinetic properties of compounds of general formula (II), such as half-life in the organism (half-life in mice is <10 minutes for compounds of general formula (II), and more than 9 days when the compound of general formula (II) is conjugated to antibody via the linker as shown in formulas (IV), (V), (VI)). As used herein, the term “antibody” refers to an immunoglobulin molecule that specifically binds to a particular target antigen. Antibodies may be of human or non-human origin. In some embodiments, the antibodies may be humanized. The antibodies may be polyclonal, monoclonal, genetically engineered, and / or otherwise modified in nature. The antibodies composing the antibody CDN conjugates of the disclosure are suitable for administration to humans, for example, as humanized antibodies or fully human antibodies. Antibodies composing antibody CDN conjugates of the disclosure may be in the form of full-length antibodies that may be of any antibody isotype, or derived from any antibody isotype, including for example, IgA, IgD, IgE, IgG, IgM, or IgY. In some embodiments, the antibody present in the antibody- CDN conjugates is an IgG (e.g., IgG1, IgG2, IgG3, or IgG4). In some embodiments, the antibodies comprise all or a portion of a constant region of an antibody. In some embodiments, the antibody comprises a modified Fc region. The antibody is preferably a monoclonal antibody. The antibody is typically bound to the linker via a cysteine residue. The antibody is preferably engineered to contain at least one cysteine in the heavy or light chain portion, preferably at positions 110 (light chain) and 152, 375 (heavy chain, EU numbering). Such modifications are known in the art as Thiomab technology and are described, for example, in WO 2006 / 034488 A2. Antibodies may preferably be conjugated to the compounds of formulas 3.3-3.10 and 3.13-3.18 to form the antibody CDN conjugates of formulas (IV), (V), (VI), respectively. The antibodies present in the antibody-CDN conjugates of formulas (IV), (V) or (VI) as contemplated in the present disclosure specifically bind to one or more cancer related tumor or immune cell associated antigens. Such antibodies or manners of obtaining them are known to a person skilled in the art. The antigens are preferably Her2 (aliases ERBB2, CD340, HER-2, HER-2 / neu), TROP2 (aliases TACSTD2, EGP-1, EGP1, GA733-1, GA7331, GP50, M1S) and FOLR1 (aliases FBP, FOLR, Folate receptor 1, folate receptor alpha). Solvates of compounds of the invention are entities containing the compound and a molecule of solvent, preferably of a pharmaceutically acceptable solvent. Solvates include hydrates, i.e., solvates with water. Further solvents forming the solvates may include water, alcohols and polyalkylene glycols, in particular water, methanol, ethanol, n-propanol, isopropanol, n-butanol, isobutanol, t-butanol, polyethylene glycol, polypropylene glycol. Solvates formed with water may also be called hydrates. Pharmaceutically acceptable salts are formed by a compound of the invention and an acid and / or a base. Pharmaceutically acceptable bases include cations of ammonia, aluminum, arginine, benzathine, calcium, chloroprocaine, choline, diethanolamine, ethanolamine, ethylenediamine, lysine, magnesium, histidine, lithium, meglumine, potassium, procaine, sodium, triethylamine, zinc. Pharmaceutically acceptable acid salts include acetate, aspartate, benzenesulfonate, benzoate, besylate, bicarbonate, bitartrate, bromide, camsylate, carbonate, chloride, citrate, decanoate, edetate, esylate, fumarate, gluceptate, gluconate, glutamate, glycolate, hexanoate, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate, mesylate, methylsulfate, mucate, napsylate, nitrate, octanoate, oleate, pamoate, pantothenate, phosphate, polygalacturonate, propionate, salicylate, stearate, succinate, sulfate, tartrate, teoclate, tosylate, trifluoroacetate. Compounds of the invention may be in the form of enantiomers or mixtures thereof, such as racemate mixtures. In a fifth aspect, the invention relates to the compounds of formula (I), (II), (IV), (V) and / or (VI) in the treatment or prevention cancers. Activation of the cGAS-STING pathway induces the expression of type I and III interferons as well as cytokines. This is achieved through the activation of downstream transcription factors, specifically STAT6 and IRF3 via TBK1 kinase, and NF-κB through IKKβ kinase. It is generally believed that this cascade ultimately results in the release of a variety of signaling molecules, including type I and III interferons, as well as cytokines like IL-6, TNF-α. Chemokines such as IP10 and RANTES are also released. The present invention also provides a method to induce a STING adaptor protein-dependent response in humans or animals. This involves administering a therapeutically effective amount of the compound of formula (I), (II), (IV), (V) and / or (VI), or its pharmaceutically acceptable salt, solvate or formulation. Consequently, the compound formula (I), (II) and / or the immunoconjugate of formula (IV), (V) and / or (VI), or the cleavage product thereof, has STING agonist activity if it binds to STING and is able to stimulate production of one or more STING-dependent cytokines selected from interferon, type 1 interferon, IFN-^, IFN-β, type 3 interferon, IFNX, IP10, TNF, IL-6, CXCL9, CCL4, CXCL11, CCL5, CCL3, or CCL8. Cancers that can be treated or prevented by the methods of the disclosure include solid tumors and lymphomas, including but not limited to adrenal cancer, bladder cancer, bone cancer, brain cancer, breast cancer, colon cancer, colorectal cancer, eye cancer, head-and-neck cancer, kidney cancer such as renal cell carcinoma, liver cancer, lung cancer such as non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer such as squamous cell carcinoma and melanoma, thyroid cancer, uterine cancer, vaginal cancer, and myeloma such as multiple myeloma. The cancer can be naïve, or relapsed and / or refractory. In some embodiments, the cancer is Burkitt’s lymphoma, Hodgkin’s lymphoma, non-Hodgkin’s lymphoma (NHL), indolent non-Hodgkin’s lymphoma (iNHL), refractory iNHL, multiple myeloma (MM), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), B-cell ALL, acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), myelodysplastic syndrome (MDS), myeloproliferative disease (MPD), mantle cell lymphoma (MCL), follicular lymphoma (FL), Waldestrom’s macroglobulinemia (WM), T-cell lymphoma, B-cell lymphoma, diffuse large B-cell lymphoma (DLBCL), or marginal zone lymphoma (MZL). In one embodiment, the cancer is minimal residual disease (MRD). In some embodiments, the cancer is selected from Hodgkin’s lymphoma, non-Hodgkin’s lymphoma (NHL), indolent non-Hodgkin’s lymphoma (iNHL), and refractory iNHL. In some embodiments, the cancer is indolent non-Hodgkin’s lymphoma (iNHL). In some embodiments, the cancer is refractory iNHL. In some embodiments, the cancer is chronic lymphocytic leukemia (CLL). In some embodiments, the cancer is diffuse large B- cell lymphoma (DLBCL). In some embodiments, the cancer is a solid tumor selected from the group consisting of pancreatic cancer; bladder cancer; colorectal cancer; breast cancer, including metastatic breast cancer; prostate cancer, including androgen-dependent and androgen-independent prostate cancer; kidney or renal cancer, including, e.g., metastatic renal cell carcinoma; hepatocellular cancer; lung cancer, including, e.g., non-small cell lung cancer (NSCLC), bronchioloalveolar carcinoma (BAC), and adenocarcinoma of the lung; ovarian cancer, including, e.g., progressive epithelial or primary peritoneal cancer; cervical cancer; gastric cancer; esophageal cancer; head and neck cancer, including, e.g., squamous cell carcinoma of the head and neck; melanoma; neuroendocrine cancer, including metastatic neuroendocrine tumors; brain tumors, including, e.g., glioma, anaplastic oligodendroglioma, adult glioblastoma multiforme, and adult anaplastic astrocytoma; bone cancer; and soft tissue sarcoma, hepatic carcinoma, rectal cancer, penile carcinoma, vulval cancer, thyroid cancer, salivary gland carcinoma, endometrial or uterine carcinoma, hepatoma, hepatocellular cancer, liver cancer, gastric or stomach cancer including gastrointestinal cancer, cancer of the peritoneum, squamous carcinoma of the lung, gastroesophagal cancer, biliary tract cancer, gall bladder cancer, colorectal / appendiceal cancer, squamous cell cancer (e.g., epithelial squamous cell cancer). In a sixth aspect, the invention relates to pharmaceutical composition comprising a compound of formula (I), (II), (IV), (V) and / or (VI), or a pharmaceutically acceptable salt, solvate or formulation thereof, and at least one pharmaceutically acceptable excipient. Pharmaceutical compositions comprising the compounds disclosed herein, or pharmaceutically acceptable salts, solvates or formulations thereof, may be prepared with one or more pharmaceutically acceptable excipients which may be selected in accordance with ordinary practice. Tablets may contain excipients including glidants, fillers, binders and the like. Aqueous compositions may be prepared in sterile form, and when intended for delivery by other than oral administration generally may be isotonic. All compositions may optionally contain excipients such as those set forth in the Rowe et al, Handbook of Pharmaceutical Excipients, 6thedition, American Pharmacists Association, 2009. Excipients can include ascorbic acid and other antioxidants, chelating agents such as EDTA, carbohydrates such as dextrin, hydroxyalkylcellulose, hydroxyalkylmethylcellulose, stearic acid and the like. In certain embodiments, the composition is provided as a solid dosage form, including a solid oral dosage form. The compositions include those suitable for various administration routes, including oral administration. The compositions may be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. Such methods include the step of bringing into association the active ingredient (e.g., a compound of the present disclosure or a pharmaceutical salt thereof) with one or more pharmaceutically acceptable excipients. The compositions may be prepared by uniformly and intimately bringing into association the active ingredient with liquid excipients or finely divided solid excipients or both, and then, if necessary, shaping the product. Techniques and formulations generally are found in Remington: The Science and Practice of Pharmacy, 21stEdition, Lippincott Wiliams and Wilkins, Philadelphia, Pa., 2006. In some embodiments, the compound of formula (II) and / or immunoconjugates of formula (IV), (V) and / or (VI) are administered to the subject parenterally, preferably intravenously, intratumorally, intramuscularly or subcutaneously. The present application also discloses use of, in particular, compound of formula (II) and / or an immunconjugate of formula (IV), (V) and / or (VI), a pharmaceutical composition thereof, in combination with one or more additional therapeutic agents for the treatment of cancer in a subject in need thereof. The compound of formula (II) and / or immunconjugates of formula (IV), (V) and / or (VI) can be used in combination with one or more additional therapeutic agents. In a particular embodiment, the compound of formula (II) and / or immunconjugates of formula (IV), (V) and / or (VI) can be used in combination with an immune checkpoint inhibitor. For instance, the compound of formula (II) and / or immunconjugate of formula (IV), (V) and / or (VI) can be administered with an inhibitor of PD-1, PD- L1, or CTLA-4, or a combination thereof. Brief Description of Drawings Figure 1. In vivo testing of anti-HER2 mAb1 conjugated with Compounds 3.4 or 3.11 in Her2 expressing HCC1954 breast tumor xenograft model. Figure 2. Effect of intratumoral injection of Compound 2.2 on tumor growth, induction of tumor specific CD8 T cells and immunological memory in CT26 mouse tumor model. Figure 3. Release of the payload CDN 2.2 from anti Her2 mAb2 CDN conjugates in mouse plasma in vitro. Figure 4. Release of the payload CDN 2.2 from anti TROP2 mAb5 CDN conjugates in mouse plasma in vitro. Figure 5. Release of the payload CDN 2.2 from anti-HER2 mAb2 or anti-TROP2 mAb5 conjugated with Compounds 3.3, 3.4, or 3.13 in vivo and in vivo pharmacokinetic of Compound 2.2. Figure 6. Comparative analysis of in vivo mouse plasma cytokine induction by anti-Her2 mAb2 conjugated with the compound 3.3 at the inter-chain Cys sites and anti-HER2 mAb3 conjugated with the compound 3.3 at engineered light chain C110 and heavy chain C375 sites. Figure 7. Comparative analysis of in vivo mouse plasma cytokine induction by anti-TROP2 mAb4 conjugated with the compound 3.3 at the inter-chain Cys sites, anti-TROP2 mAb5 conjugated with compound 3.3 at engineered light chain C110 and heavy chain C375 sites and the warhead CDN 2.2. Figure 8. Activity of anti-HER2 mAb3 conjugated with Compound 3.3 to light chain C110 and heavy chain C375 in Her2 expressing HCC1954 breast tumor xenograft model. Figure 9. Activity of anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 in TROP2 expressing HCC1954 breast tumor xenograft model. Figure 10. Activity of anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 in TROP2 expressing Bx-PC3 prostate tumor xenograft model. Figure 11. Activity of anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 in TROP2 expressing Colo205 colon tumor xenograft model. Figure 12. Intratumoral cytokines induced in TROP2 positive HCC1954 mouse model treated with anti- TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy Chain C375. Figure 13. Activity of anti-HER2 mAb3 conjugated with Compound 3.13 to engineered light chain C110 and heavy chain C375 in Her2 expressing HCC1954 breast tumor xenograft model. Figure 14. Activity of anti-TROP2 mAb5 conjugated with Compound 3.13 to engineered light chain C110 and heavy chain C375 in Her2 expressing HCC1954 breast tumor xenograft model. Figure 15. Activity of anti-FOLR1 mAb6 conjugated with Compound 3.3 to engineered heavy chain C152 and C375 in FOLR1 expressing KB cervical tumor xenograft model. Examples of carrying out the Invention Abbreviations A adenosine unit (NMR description) ACN acetonitrile AcOH acetic acid Bz benzoyl BOC-Val-OH N-(tert-butoxycarbonyl)-L-valine DBU 1,8-diazabicyclo[5.4.0]undec-7-ene DCM dichloromethane DEA diethylamine DIPEA N,N-diisopropylethylamine DMF dimethylformamide DMOCP 2-chloro-5,5-dimethyl-1,3,2-dioxaphosphorinane 2-oxide DMTr dimethoxytrityl Et3SiH triethylsilane EtOH ethanol FMOC-Cit-OH N-alpha-(9-fluorenylmethyloxycarbonyl)-L-citrulline HATU 1-[bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate HOAt 1-hydroxy-7-azabenzotriazole Hpx inosine unit (NMR description) LiAlH4lithium aluminium hydride Mal maleimide unit (NMR description) mAb1-3.3 Antibody Drug Conjugate, Antibody 1 conjugated with Compound 3.3 MeNH2methylamine MeOH methanol NH4OAc ammonium acetate (O2NC6H4O)2CO bis(4-nitrophenyl)carbonate PEG polyethylene glycol linker (NMR description) PhOCOCl phenyl chloroformate +Psi reagent (2R,3aR,6S,7aR)-3a-methyl-2-((perfluorophenyl)thio)-6-(prop-1-en-2- yl)hexahydrobenzo[d][1,3,2]oxathiaphosphole 2-sulfide PyBroP Bromo-tris-pyrrolidino-phosphonium hexafluorophosphate r.t. room temperature SE self-immolative linker (NMR description) TEA triethylamine TEAB triethylammonium bicarbonate buffer TFA trifluoroacetic acid THF tetrahydrofuran TMS-Cl chlorotrimethylsilane Analytical methods LC‐MS Time Flow Column and solvent Instrument Solvents A‐B Method (min) (mL / min) system Acquity BEH C18 Waters 0.0 100 0 0.50 (50 mm x 2.1 mm, 1.7 Acquity H class A1 µm) plus with SQ 4.0 0 100A: 10 mM NH4OAc in H2O Detector 2 0.50 B: ACN Prep‐HPLC Time Flow Column and solvent Instrument Solvents A / B Method (min) (mL / min) system 0 100 0 30 LUNA C18 (10 µm, 200 x 90 mm) Ingos LCP5080 with P1 UV monitor 254 10 100 0 30 A: 0.1M TEAB in H2O 70 70 30 30 B: ACN 0 100 0 10 LUNA C18 (5 µm, 250 x 21 mm) Ingos LCP5020 with P2 LCD5000 5 100 0 10 A: 0.1M TEAB in H2O 65 50 50 10 B: ACN 0 100 0 10 Kinetex PFP (5 µm, 250 x 21 mm) Ingos LCP5020 with P3 LCD5000 5 100 0 10 A: 0.05% TFA in H2O 65 75 25 10 B: ACN 0 100 0 10 Kinetex PFP (5 µm, 250 Ingos LCP5020 with x 21 mm) P4 LCD5000 5 100 0 10 A: 0.05% TFA in H2O 65 50 50 10 B: ACN 0 90 10 10 Luna C18 (5 µm, 250 x Ingos LCP5020 with 21 mm) P5 LCD5000 50 50 50 10 A: 0.1% TFA in H2O B: ACN Kinetex P with 0 100FP (5 µm, 250 Ingos LCP5020 0 10 P6 x 21 mm) LCD5000 5 100 0 10 65 62 38 10 A: 0.05% TFA in H2O B: ACN 0 100 0 10 Luna C18 (5 µm, 250 x Ingos LCP5020 with 21 mm) P7 LCD5000 40 50 50 10 A: H2O B: ACN Unless stated otherwise, all used solvents were anhydrous. Mass spectra were recorded on Acquity H class plus UPLC (Waters) and on LTQ Orbitrap XL (Thermo Fisher Scientific) using ESI ionization. Unless stated otherwise, the NMR spectra were measured on Bruker AVANCE III 600 instrument (1H,13C) with a cryoprobe, and Bruker AVANCE III 500 instrument with a cryoprobe (31P,19F). The structural assignment of the proton and carbon signals was achieved using a combination of 1D and 2D NMR techniques (H,H-COSY, H,C-HSQC, H,C-HMBC). Example 1 - Synthesis of linkers Example 1.1 4-((S)-2-((S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-3-methylbutanamido)-5- ureidopentanamido)benzyl (4-nitrophenyl) carbonate (1.1) Step 1: HATU (228 mg; 0.6 mmol) was added to a mixture of 2-(2,5-dioxo-2,5-dihydro-1H- pyrrol-1-yl)acetic acid (78 mg; 0.5 mmol) and DIPEA (0.17 mL; 1.0 mmol) in DMF (4 mL) and the reaction mixture was stirred for 15 minutes at r.t. After that, ValCitPAB (0.15 g; 0.4 mmol) was added and the reaction mixture was stirred for 2 hours at r.t. The reaction mixture was evaporated. The product was purified by reverse phase chromatography (Method P5) to yield 0.15 g (73 %) of (S)-2-((S)-2-(2- (2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-3-methylbutanamido)-N-(4- (hydroxymethyl)phenyl)-5-ureidopentanamide. UPLC-MS (Method A1): Rt = 1.85 min; m / z 517.2 [M+H]+. Step 2: Bis(4-nitrophenyl)carbonate (97 mg; 0.32 mmol) was added to a mixture of (S)-2-((S)- 2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-3-methylbutanamido)-N-(4- (hydroxymethyl)phenyl)-5-ureidopentanamide (83 mg; 0.16 mmol) and DIPEA (56 µL; 0.32 mmol) in DMF (1.6 mL) and the reaction mixture was stirred for 5 hours at 35oC. The mixture was precipitated with diethyl ether and the precipitate was collected by centrifugation. The product was lyophilized from dioxane to yield 80 mg (74 %) of 4-((S)-2-((S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)- 3-methylbutanamido)-5-ureidopentanamido)benzyl (4-nitrophenyl) carbonate. UPLC-MS (Method A1): Rt = 3.01 min; m / z 682.2 [M+H]+.1H NMR (401 MHz, DMSO-d6) δ 10.10 (s, 1H), 10.08 (s, 1H), 8.39 – 8.16 (m, 4H), 7.70 – 7.60 (m, 2H), 7.60 – 7.52 (m, 2H), 7.47 – 7.35 (m, 2H), 7.08 (d, J = 1.1 Hz, 2H), 5.98 (t, J = 5.9 Hz, 1H), 5.42 (s, 2H), 5.37 (s, 1H), 5.24 (s, 2H), 4.39 (p, J = 7.2 Hz, 1H), 4.26 (dd, J = 8.8, 6.5 Hz, 1H), 4.13 (s, 2H), 3.57 (s, 1H), 2.98 (dh, J = 25.9, 6.5 Hz, 2H), 1.98 (h, J = 6.7 Hz, 1H), 1.75 – 1.52 (m, 1H), 1.50 – 1.29 (m, 1H), 0.92 – 0.77 (m, 7H).13C NMR (101 MHz, DMSO-d6) δ 171.30, 171.18, 166.54, 159.38, 155.76, 152.44, 145.65, 139.89, 135.32, 129.98, 129.73, 125.89, 123.10, 119.48, 70.74, 66.83, 57.94, 53.74, 31.45, 29.58, 27.33, 19.59, 18.45. Example 1.2 4-((S)-2-((S)-2-(2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)acetamido)-3- methylbutanamido)-5-ureidopentanamido)benzyl (4-nitrophenyl) carbonate (1.2)
[0002] Step 1: HATU (228 mg; 0.6 mmol) was added to a mixture of BOC-Gly-OH (70 mg; 0.4 mmol) and DIPEA (0.14 mL; 0.8 mmol) in DMF (2 mL) and the reaction mixture was stirred for 15 minutes at r.t. After that, ValCitPAB (0.15 g; 0.4 mmol) was added and the reaction mixture was stirred for 2 hours at r.t. The reaction mixture was evaporated. The product was purified by reverse phase chromatography (Method P7) to yield 0.2 g (92 %) of tert-butyl (2-(((S)-1-(((S)-1-((4-(hydroxymethyl)phenyl)amino)- 1-oxo-5-ureidopentan-2-yl)amino)-3-methyl-1-oxobutan-2-yl)amino)-2-oxoethyl)carbamate. UPLC-MS (Method A1): Rt = 2.31 min; m / z 537.5 [M+H]+. Step 2: Tert-butyl (2-(((S)-1-(((S)-1-((4-(hydroxymethyl)phenyl)amino)-1-oxo-5-ureidopentan- 2-yl)amino)-3-methyl-1-oxobutan-2-yl)amino)-2-oxoethyl)carbamate (0.2 g; 0.37 mmol) was treated with 20 % TFA in DCM (5 mL) for 3 hours at r.t. After that, the reaction mixture was evaporated. The crude was dissolved in 50 % MeOH / H2O and treated with DOWEX OH-. The resin was filtered off and the solution evaporated. The product was purified by reverse phase chromatography (Method P7) to yield 0.15 g (90 %) of (S)-2-((S)-2-(2-aminoacetamido)-3-methylbutanamido)-N-(4- (hydroxymethyl)phenyl)-5-ureidopentanamide. UPLC-MS (Method A1): Rt = 1.54 min; m / z 437.5 [M+H]+. Step 3: Analogous to Example 1.1, Step-1 affording (S)-2-((S)-2-(2-(2-(2,5-dioxo-2,5-dihydro- 1H-pyrrol-1-yl)acetamido)acetamido)-3-methylbutanamido)-N-(4-(hydroxymethyl)phenyl)-5- ureidopentanamide (20 mg, 35 %). UPLC-MS (Method A1): Rt = 1.82 min; m / z 574.4 [M+H]+. Step 4: Analogous to Example 1.1, Step-2 affording 4-((S)-2-((S)-2-(2-(2-(2,5-dioxo-2,5- dihydro-1H-pyrrol-1-yl)acetamido)acetamido)-3-methylbutanamido)-5-ureidopentanamido)benzyl (4- nitrophenyl) carbonate (6.4 mg, 25 %). UPLC-MS (Method A1): Rt = 3.14 min; m / z 739.5 [M+H]+. The compounds listed in the table below were prepared following an analogous procedure to the one above using commercially available or described starting materials (use of appropriate reagents and purification methods known to the skilled in the art): Cmpd Structure, reaction conditions and characterization 1.3 Step 1 using BOC‐Sar‐OH. Step 3 using PyBroP, DIPEA, DMF. UPLC‐MS (Method A1): Rt = 3.03 min. m / z 753.5 [M+H]+ O O HOOH N O O O O O O N N O N HOHH 1.4 HN O H2N Following only Step 1 using compound CAS 882847‐13‐4. UPLC‐MS (Method A1): Rt = 2.40 min. m / z 813.2 [M‐H]‐ O O O OOOH O N N O O O N N O O O N O2NHOHHOHN 1.5 O H2N Starting from Compound 1.4 following Steps 2‐4. UPLC‐MS (Method A1): Rt = 2.79 min. m / z 1017.6 [M+H]+ 1.6 Step 1 using Ala‐PAB. UPLC‐MS (Method A1): Rt = 2.91 min. m / z 612.5 [M+H]+ Example 1.7 tert-butyl ((S)-1-(((S)-1-((3-chloro-4-(hydroxymethyl)phenyl)amino)-1-oxo-5-ureidopentan-2- yl)amino)-3-methyl-1-oxobutan-2-yl)carbamate (1.7) Step 1: Lithium aluminium hydride (2 M THF solution, 5 mL, 10 mmol) was added dropwise to a solution of methyl 4-amino-2-chlorobenzoate (0.93 g, 5 mmol) in THF (25 mL). The reaction mixture was stirred for 2 hours at r.t. After that, saturated aqueous sodium chloride was added (200 mL) and the product was extracted with chloroform (2×500 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and evaporated. The product was lyofilized from dioxane to yield 0.78 g (99 %) of (4-amino-2-chlorophenyl)methanol. UPLC-MS (Method A1): Rt = 1.63 min; m / z 158.1 [M+H]+. Step 2: HATU (1.14 g, 3 mmol) was added to a mixture of FMOC-Cit-OH (0.79 g, 2 mmol) and DIPEA (0.52 mL, 3 mmol) in DMF (10 mL) and the reaction mixture was stirred for 15 minutes at r.t. After that, (4-amino-2-chlorophenyl)methanol (0.31 g, 2 mmol) was added and the reaction mixture was stirred for 2 hours at r.t. The reaction mixture was evaporated. The product was purified by chromatography on silica gel (gradient of methanol in chloroform). The FMOC protected derivative was then treated with DEA (1 mL) in DMF (10 mL) and the reaction mixture was stirred for 1 hour at r.t. The reaction mixture was evaporated. The crude was dissolved in water (50 mL) and washed with ethyl acetate (3x100 mL). The aqueous layer was evaporated and (S)-2-amino-N-(3-chloro-4- (hydroxymethyl)phenyl)-5-ureidopentanamide used without further purification. UPLC-MS (Method A1): Rt = 1.41 min; m / z 315.3 [M+H]+. Step 3: HATU (1.14 g, 3 mmol) was added to a mixture of BOC-Val-OH (0.44 g, 2 mmol) and DIPEA (0.52 mL, 3 mmol) in DMF (10 mL) and the reaction mixture was stirred for 15 minutes at r.t. After that, (S)-2-amino-N-(3-chloro-4-(hydroxymethyl)phenyl)-5-ureidopentanamide (0.57 g, 1.8 mmol) was added and the reaction mixture was stirred for 2 hours at r.t. The reaction mixture was evaporated. The product was purified by chromatography on silica gel (gradient of methanol in chloroform) to yield 0.59 g (63 %) of tert-butyl ((S)-1-(((S)-1-((3-chloro-4- (hydroxymethyl)phenyl)amino)-1-oxo-5-ureidopentan-2-yl)amino)-3-methyl-1-oxobutan-2- yl)carbamate. UPLC-MS (Method A1): Rt = 2.59 min; m / z 514.4 [M+H]+.1H NMR (401 MHz, DMSO-d6) δ 10.16 (s, 1H), 8.02 (d, J = 7.4 Hz, 1H), 7.82 – 7.77 (m, 1H), 7.49 – 7.40 (m, 2H), 6.75 (d, J = 8.8 Hz, 1H), 5.96 (t, J = 5.8 Hz, 1H), 5.41 (s, 2H), 5.30 (t, J = 5.6 Hz, 1H), 4.50 (d, J = 5.4 Hz, 2H), 4.44 – 4.34 (m, 1H), 3.87 – 3.79 (m, 1H), 3.08 – 2.87 (m, 2H), 2.01 – 1.89 (m, 1H), 1.76 – 1.52 (m, 2H), 1.38 (s, 9H), 1.50 – 1.31 (m, 2H), 0.84 (dd, J = 16.5, 6.7 Hz, 6H).13C NMR (101 MHz, DMSO-d6) δ 171.92, 171.30, 159.32, 155.98, 139.06, 134.63, 131.40, 128.97, 119.41, 118.06, 78.58, 60.43, 60.18, 53.52, 30.85, 29.87, 28.64, 27.18, 19.68, 18.63. The compounds listed in the table below were prepared following an analogous procedure to the one above using commercially available or described starting materials (use of appropriate reagents and purification methods known to the skilled in the art): Cmpd Structure Reaction conditions and characterization Step 1 using methyl 4‐amino‐ 2‐fluorobenzoate. 1.8 UPLC‐MS (Method A1): Rt = 2.53 min. m / z 498.4 [M+H]+ Step 1 using methyl 4‐amino‐ 3‐fluorobenzoate. 1.9 UPLC‐MS (Method A1): Rt = 2.33 min. m / z + 498.4 [M+H] Example 1.10 (S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-N-((S)-1-((4-(iodomethyl)phenyl)amino)- 1-oxopropan-2-yl)-3-methylbutanamide (1.10) Step 1: Analogous to Example 1.1, Step-1 affording (S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol- 1-yl)acetamido)-N-((S)-1-((4-(hydroxymethyl)phenyl)amino)-1-oxopropan-2-yl)-3-methylbutanamide (117 mg, 54 %). UPLC-MS (Method A1): Rt = 2.00 min; m / z 431.2 [M+H]+. Step 2: (S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-N-((S)-1-((4- (hydroxymethyl)phenyl)amino)-1-oxopropan-2-yl)-3-methylbutanamide (43 mg; 0.1 mmol) was treated with thionyl chloride (29 µL; 0.4 mmol) in dioxane (2 mL). The reaction mixture was stirred for 1 h at r.t., evaporated and coevaporated with dioxane. UPLC-MS (Method A1): Rt = 2.79 min; m / z 449.2 / 451.2 [M+H]+. Step 3: The crude (S)-N-((S)-1-((4-(chloromethyl)phenyl)amino)-1-oxopropan-2-yl)-2- (2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-3-methylbutanamide was treated with sodium iodide (60 mg; 0.4 mmol) in acetone (4 mL) for 16 h at r.t. The reaction mixture was filtered through syringe filter and evaporated. The product was used without further purification. UPLC-MS (Method A1): Rt = 3.04 min; m / z 541.2 [M+H]+. Example 2 - Synthesis of CDNs Example 2.1 9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-15-(6-Amino-9H-purin-9-yl)-16,17-difluoro-3,11-dimercapto- 3,11-dioxidodecahydro-6,9-methanofuro[3,2-m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin- 8-yl)-1,9-dihydro-6H-purin-6-one (Compounds 2.1 and 2.2) Step 1: DMOCP (4.3 g; 23.4 mmol) was added to a solution of (2R,3S,4R,5R)-4-fluoro-5- (hydroxymethyl)-2-(6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl benzoate (2.9 g; 7.8 mmol) and ((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-fluorotetrahydrofuran-3-yl)oxy)methyl)phosphinic acid TEA salt (5.6 g; 6.5 mmol) in pyridine (200 mL), and the reaction mixture was stirred for 2 hours at r.t. After that, sulfur (0.75 g; 23.4 mmol) was added and the reaction mixture was stirred for additional 30 minutes at r.t. The reaction was quenched by the addition of 1M TEAB (30 mL) and the reaction mixture was evaporated. The crude was dissolved in DCM (200 mL) and washed with 0.1 M TEAB (3x100 mL). The organic layer was dried over sodium sulfate and evaporated. (2R,3S,4R,5R)-5-(((((((2R,3R,4R,5R)- 5-(6-Benzamido-9H-purin-9-yl)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4- fluorotetrahydrofuran-3-yl)oxy)methyl)(mercapto)phosphoryl)oxy)methyl)-4-fluoro-2-(6-oxo-1,6- dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl benzoate TEA salt was obtained as a mixture of phosphonothioate diastereomers and used without further purification. UPLC-MS (Method A1): Rt = 3.52 min; m / z 1140.5 [M-H]-. Step 2: The crude (2R,3S,4R,5R)-5-(((((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2- ((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-fluorotetrahydrofuran-3- yl)oxy)methyl)(mercapto)phosphoryl)oxy)methyl)-4-fluoro-2-(6-oxo-1,6-dihydro-9H-purin-9- yl)tetrahydrofuran-3-yl benzoate TEA salt was dissolved in 80 % AcOH in water (200 mL) and the reaction mixture was stirred for 2 hours at r.t. The reaction mixture was evaporated and co-evaporated with water. After that, the crude was treated with 33% MeNH2in absolute EtOH (60 mL) and EtOH (120 mL) and the reaction mixture was stirred for 30 minutes at r.t. The reaction mixture was evaporated. The crude was dissolved in 0.1M TEAB (200 mL) and washed with DCM (3x100 mL). The aqueous layer was evaporated. The product was purified by reverse phase chromatography (Method P1) to yield 3.6 g (76 %) of O-(((2R,3S,4S,5R)-3-fluoro-4-hydroxy-5-(6-oxo-1,6-dihydro-9H-purin-9- yl)tetrahydrofuran-2-yl)methyl) S-hydrogen ((((2R,3R,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-fluoro-2- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)methyl)phosphonothioate TEA salt as a 1:1 mixture of phosphonothioate diastereomers. UPLC-MS (Method A1): Rt = 1.60 min; m / z 630.2 [M-H]-.31P (D2O) δ 71.59, 71.05. Step 3: DBU (8.6 mL; 57.7 mmol) was added to a solution of O-(((2R,3S,4S,5R)-3-fluoro-4- hydroxy-5-(6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-2-yl)methyl) S-hydrogen ((((2R,3R,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-fluoro-2-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)methyl)phosphonothioate TEA salt (3.6 g; 5.8 mmol) and (2R,3aR,6S,7aR)-3a-methyl-2- ((perfluorophenyl)thio)-6-(prop-1-en-2-yl)hexahydrobenzo[d][1,3,2]oxathiaphosphole 2-sulfide (2.6 g; 5.8 mmol; +PSI reagent) in DMF (300 mL) and the reaction mixture was stirred for 1 hours at r.t. The reaction mixture was evaporated. The crude was treated with 0.1M TEAB (80 mL). The formed heterogeneous mixture was centrifuged. The supernatant was collected and evaporated. The diastereomers were purified by reverse phase chromatography (Method P1) and lyophilized from dioxane / water (1:1) to yield 1.35 g (30 %) of HPLC faster eluting diastereomer (Compound 2.1) and 1.45 g (32 %) of HPLC slower eluting diastereomer (Compound 2.2) as diTEA salts. Compound 2.1: UPLC-MS (Method A1): Rt = 1.36 min; m / z 710.0 [M+H]+. ESI-HRMS calculated for C21H24O9N9F2P2S2(M+H)+710.05762; found 710.05742. Compound 2.2: UPLC-MS (Method A1): Rt = 1.60 min; m / z 710.0 [M+H]+. ESI-HRMS calculated for C21H24O9N9F2P2S2(M+H)+710.05762; found 710.05750. Table 1.1H,31P and19F NMR data of Compound 2.1 and Compound 2.2 in D2O. Cmpd Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b P‐CH2‐O 5.385 4.255 dddd dddd 5.59 dd 4.19 ddd 5a,4 = 2.2 6.33 d 2,1 = 8.2 3,2 = 4.0 4.84 5b,4 = 2.2 Hpx 5a,5b = 11.5 ‐‐ 1,2 = 8.2 2,3 = 4.0 3,4 = 0 overlap 5b,5a = 11.5 5a,P = 3.2 2,P =10.6 3,F = 53.0 5b,P = 5.3 5a,F = 3.0 2.1 2,F = 24.8 4.57 dq 4.22 dd 5.70 dd 4.69 ddd 4.36 ddd 4.13 ddd 6.42 d 4,3 = 9.0 (13.4; 2,1 = 0 3,2 = 3.6 5a,4 = 3.2 5b,4 = 2.3 A 1,2 = 0 4,5a = 3.2 2.6); 2,3 = 3.6 3,4 = 9.0 5a,5b = 11.9 5b,5a = 11.9 1,F =16.9 4,5b = 2.3 4.02 dd 2,F = 51.8 3,F = 24.8 5a,P = 4.6 5b,P = 4.5 4,F =2.5 (13.4; 6.9) Nucleobase: H‐2: 8.09 s, H‐8: 8.40 s (Hpx); H‐2: 8.24 s, H‐8: 8.17 s (A). 31P 54.10, 69.00. 19F ‐192.50, ‐199.72. 5.35 dddd 4.05 dq 5.495 dd 4.53 ddd 2,1 = 8.2 5b,4 = 2.2 6.325 d 3,2 = 4.2 4.81 5a,4 = 2.2 Hpx 2,3 = 4.2 5b,5a = 11.8 ‐‐ 1,2 = 8.2 3,4 = 0 overlap 5a,5b = 11.8 2,P = 10.8 5b,P = 2.2 3,F = 53.5 5a,P = 8.2 2,F = 24.2 4,F = 2.2 4.085 dd 4.58 dq 4.38 q 2.2 5.69 dd 4.70 ddd 4.12 ddd (12.7; 6.44 d 4,3 = 9.0 5a,4 = 3.0 2,1 = 0 3,2 = 3.7 5b,4 = 2.3 1.2); A 1,2 = 0 4,5a = 3.0 5a,5b = 12.0 2,3 = 3.7 3,4 = 9.0 5b,5a = 12.0 4.08 dd 1,F =17.3 4,5b = 2.3 5a,P = 3.0 2,F = 52.0 3,F = 25.2 5b,P = 4.4 (12.7; 4,F = 3.0 5a,F = 3.0 12.2) Nucleobase: H‐2: 8.07 s, H‐8: 8.34 s (Hpx); H‐2: 8.25 s, H‐8: 8.17 s (A). 31P 54.18, 72.52. 19F ‐192.61, ‐199.12. Table 2.13C NMR data of Compound 2.1 and Compound 2.2 in D2O. Cmpd Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 78.09 94.76 85.19 64.33 88.34 Hpx (15.9; (184.8; (23.6; (11.8; (4.1) ‐‐ 148.59 152.01 126.72 161.12 143.09 7.9) 4.3) 10.5) 5.7) 2.1 79.35 89.70 93.84 81.36 66.21 73.41 A (16.4; (33.6) (188.9) (11.3) (4.2) (121.5) 155.58 150.65 121.51 158.30 141.80 11.7) 77.77 94.52 85.44 65.16 88.20 Hpx (15.0; (184.8; (24.2; (12.3; (3.3) ‐‐ 147.51 152.11 126.77 161.22 143.09 8.8) 5.0) 10.6) 5.3) 2.2 79.56 89.74 93.82 81.26 66.05 72.94 A (16.2; (33.8) (188.8) (11.4) (4.4) (127.7) 155.44 150.66 121.51 158.22 141.86 13.3) Example 2.2 (Comparative compound) Compound 2.3 was prepared according to WO2019193542A1. Example 2.3 (Comparative compound) Compound 2.4 was prepared according to WO2019193542A1. Example 2.4 (Comparative compounds) Three phosphorothioate diastereomers 2.5, 2.6 and 2.7 were prepared according to WO2020178769A1. Example 3 - Synthesis of CDN probes Example 3.1 2-(Methylamino)ethyl (9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17-difluoro-3,11-dimercapto-3,11- dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6-yl)carbamate TFA salt (3.1)
[0003] Step 1: tert-Butyl (2-hydroxyethyl)(methyl)carbamate (1.8 g; 10.1 mmol) and pyridine (1.9 mL; 23.1 mmol) in DCM (10 mL) were added to a solution of 20 % phosgene in toluene (11.1 mL) in DCM (50 mL) under argon at -78oC. The reaction mixture was stirred for 10 minutes under argon at -78oC and then left to warm up to r.t. After that, DCM was evaporated, the crude was diluted with pyridine (20 mL) and added to a stirred solution of 9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-15-(6-amino-9H-purin- 9-yl)-16,17-difluoro-3,11-dimercapto-3,11-dioxidodecahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-8-yl)-1,9-dihydro-6H-purin-6-one diTEA salt (0.23 g; 0.26 mmol; Compound 2.2). The reaction mixture was stirred for 1 h at r.t. After that, the reaction mixture was cooled to 4oC and water (2 mL) was added. The reaction mixture was left to warm up to r.t. and evaporated. The crude was dissolved in DMSO (10 mL) and directly loaded on C18 column. The products were purified by reverse phase chromatography (Method P2) as HPLC faster eluting monocarbamate and HPLC slower eluting biscarbamate. The mono and biscarbamate derivatives were evaporated. The biscarbamate derivative was treated with 60 % pyridine in water for 16 h at 55oC affording monocarbamate derivative. Both portions of monocarbamate derivative were collected and lyophilized from dioxane / water (1:1) to yield 0.21 g (72 %). biscarbamate: UPLC-MS (Method A1): Rt = 2.73 min; m / z 1110.6 [M-H]-. monocarbamate: UPLC-MS (Method A1): Rt = 2.11 min; m / z 909.5 [M-H]-. ESI-HRMS calculated for C30H39O13N10F2P2S2(M+H)+911.15773, found 911.15756. Step 2: A mixture of 20 % TFA in DCM (50 mL) and triethylsilane (0.6 mL; 3.8 mmol) was added to monocarbamate derivative (0.21 g; 0.19 mmol). The reaction mixture was stirred for 30 minutes at r.t. and evaporated. The product was purified by reverse phase chromatography (Method P3) and lyophilized from dioxane / water (1:1) to yield 0.11 g (46 %) of Compound 3.1. Compound 3.1: UPLC-MS (Method A1): Rt = 1.75 min; m / z 809.3 [M-H]-. ESI-HRMS calculated for C25H31O11N10F2P2S2(M+H)+811.10530, found 811.10544. Table 3.1H,31P and19F NMR data of Compound 3.1 in DMSO-d6. Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b P‐CHa‐ P‐CHb‐ H‐2,8 O O 5.36 4.60 3.87 4.12 dddd 5.26 dq dq 6.08 ddd 8.09 d (26.2; dd (27.0; (11.6; Hpx d (11.6; ‐‐ ‐‐ (3.7); 8.6; (54.2; 2.2; 2.2; (8.6) 8.2; 8.40 s 12.5; 3.9) 2.2; 2.2; 2.2) 3.9) 2.2) 2.2) 5.36 5.92 6.47 ddd 4.36 4.21 3.71 4.14 3.95 dd 8.72 s; A d (27.5; dm dm dm bd bd (51.6; 8.74 s (16.3) 9.0; (9.0) (11.8) (11.8) (14.6) (14.6) 3.2) 3.2) Linker: ‐CO‐O‐CH2‐CH2‐NH‐CH3: 4.44 m and 4.39 m (O‐CH2), 3.16 m (N‐CH2), 2.57 (N‐ CH3). 31P 55.06, 75.14. 19F ‐191.41, ‐200.67. Table 4.13C NMR data of Compound 3.1 in DMSO-d6. Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 Hpx 83.45 74.10 92.76 81.72 64.52 ‐‐ 146.40 149.33 123.60 156.77 138.94 (185.1) (22.8; 9.5) A 85.87 91.53 74.10 79.57 62.61 67.78 152.27 149.48 122.99 151.63 141.90 (32.6) (186.8) (114.6) Linker: ‐CO‐O‐CH2‐CH2‐NH‐CH3: 152.02 (C=O), 60.70 (O‐CH2), 46.80 (N‐CH2), 32.07 (N‐CH3). The Compound 3.2 in the table below was prepared following an analogous procedure to the one above using commercially available or described starting materials (use of appropriate reagents and purification methods known to the skilled in the art): Reaction conditions and Structure characterization Step 1 using Compound 2.3. Step 2 was performed in the absence of Et3SiH. UPLC‐MS (Method A1): Rt = 1.25 min. m / z 779.3 [M+H]+ Example 3.3 4-((S)-2-((S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-3-methylbutanamido)-5- ureidopentanamido)benzyl (2-(((9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17-difluoro-3,11- dimercapto-3,11-dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6- yl)carbamoyl)oxy)ethyl)(methyl)carbamate (3.3) Step 1: DIPEA (14.6 µL; 87 µmol) and HOAt (8.2 mg; 43.5 µmol) were added to a solution of Compound 1.1 (5.9 mg; 8.7 µmol) and 2-(methylamino)ethyl (9-((6R,8R,9S,13aR,15R,16R,16aR,17R)- 16,17-difluoro-3,11-dimercapto-3,11-dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9- methanofuro[3,2-m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6- yl)carbamate TFA salt (8 mg; 8.7 µmol; Compound 3.1) in DMF (3 mL) and the reaction mixture was stirred for 8 h at 35oC. The reaction mixture was evaporated. The product was purified by reverse phase chromatography (Method P4) and lyophilized from dioxane / water (1:1) to yield 8.2 mg (64 %) of Compound 3.3. UPLC-MS (Method A1): Rt = 2.04 min; m / z 1353.8 [M+H]+. ESI-HRMS calculated for C50H59O19N16F2P2S2(M-H)- 1351.30326, found 1351.30228. Table 5.1H,31P and19F NMR data of Compound 3.3 in DMSO-d6. P‐ P‐ Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b CHa‐ CHb‐ H‐2,8 O O 5.44 dddd 4.63 dq 8.09 d 6.11 d 5.31 dd Hpx (24.8; 8.6; (27.8; 2.2; 4.28 m 3.92 m ‐‐ ‐‐ (3.8); (8.6) (54.2; 4.2) 12.6; 4.2) 2.2; 2.2) 8.35 s 4.17 4.08 5.12 ddd 6.46 d 5.89 dd 4.34 dm dd dd 8.67 s; A (25.0; 8.2; (19.0) (52.2; 3.8) (8.2) 4.23 m 3.89 m (14.0; (14.0 8.47 s 3.8) 1.8) ; 5.0) Linker: Mal Gly: 7.08 s (CH=), 4.13 s (N‐CH2); Val: 8.21 d (NH), 4.25 dd (N‐CH), 1.98 m (CH), 0.85 d and 0.82 d (2x CH3); Cit: 8.23 d (NH), 4.38 ddd (N‐CH), 1.69 m and 1.59 m (CH2), 1.44 m and 1.37 m (CH2), 3.03 m and 2.94 m (N‐CH2); PAB: 10.01 bs and 9.99 bs (NH), 7.58 m, 7.54 m, 7.30 m and 7.26 m (4x ArH), 5.00 b and 4.97 b (O‐CH2); SE: 2.95 s and 2.92 s (N‐ CH3), 3.52 m (N‐CH2), 4.25 m (O‐CH2). 31P 57.70, 79.82. 19F ‐191.70, ‐198.74. Table 6.13C NMR data of Compound 3.3 in DMSO-d6. Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 74.12 92.13 81.59 83.54 Hpx (16.0; (184.2; (23.0; 64.47 ‐‐ 146.48 149.21 124.11 156.73 138.47 8.0) 2.0) 10.8) 86.29 91.74 78.81 68.44 A 76.36 63.21 (33.7) (187.2) (10.8) (123.8) 152.06 151.14 123.47 149.87 141.72 Linker: Mal‐Gly: 170.89 (C=O), 135.02 (CH=), 39.73 (N‐CH2), 166.23 (C=O); Val: 170.96 (C=O), 57.65 (N‐CH), 31.16 (CH), 19.30 and 18.14 (2x CH3); Cit: 170.71 (C=O), 53.37 (N‐CH), 29.36 (CH2), 26.94 (CH2), 38.76 (N‐CH2), 159.15 (C=O); PAB: 138.80 (ArC), 119.20, 119.13, 128.63 and 128.54 (4x ArCH), 131.78 (ArC), 66.29 (O‐CH2), SE: 152.21 (C=O), 63.13 (O‐CH2), 47.91 and 47.37 (N‐CH2), 35.83 and 35.39 (N‐CH3), 155.75 and 155.50 (C=O) The compounds listed in the table below were prepared following an analogous procedure to the one above using commercially available or described starting materials (use of appropriate reagents and purification methods known to the skilled in the art): Cmpd Structure, reaction conditions and characterization Compound 3.1 and MC‐Val‐Cit‐PAB‐PNP (CAS 159857‐81‐5). UPLC‐MS (Method A1): Rt = 2.20 min; m / z 1409.7 [M+H]+. ESI‐HRMS calculated for C54H69O19N16F2P2S2 (M+H)+ 1409.38041, found 1409.38025. NMR Tables 7‐8. Compound 3.1 and Mal‐beta‐Ala‐PEG(4)‐Val‐Cit‐PAB‐PNP (CAS 2003260‐12‐4). UPLC‐MS (Method A1): Rt = 2.05 min; m / z 1614.9 [M+H]+. ESI‐HRMS calculated for C62H82O24N17F2P2S2 (M‐H)‐ 1612.46088, found 1612.45994. NMR Tables 7‐8. Compound 3.1 and MC‐Val‐Ala‐PAB‐PNP (CAS 1639939‐40‐4). UPLC‐MS (Method A1): Rt = 2.28 min; m / z 1323.9 [M+H]+. ESI‐HRMS calculated for C51H61O18N14F2P2S2 (M‐H)‐ 1321.31784, found 1321.31732. NMR Tables 7‐8. Compound 3.1 and Compound 1.3. UPLC‐MS (Method A1): Rt = 2.06 min; m / z 1424.4 [M+H]+. ESI‐HRMS calculated for C53H64O20N17F2P2S2 (M‐H)‐ 1422.34037, found 1422.33973. NMR Tables 7‐8. 3.8 Compound 3.1 and Compound 1.2. UPLC‐MS (Method A1): Rt = 1.98 min; m / z 1410.9 [M+H]+. ESI‐HRMS calculated for C52H64O20N17F2P2S2 (M+H)+ 1410.33927, found 1410.33956. NMR Tables 7‐8. 3.9 Compound 3.1 and Compound 1.5. UPLC‐MS (Method A1): Rt = 2.00 min; m / z 1688.9 [M+H]+. ESI‐HRMS calculated for C65H88O26N17F2P2S2 (M‐H)‐ 1686.49766, found 1686.49665. NMR Tables 7‐8. 3.10 Compound 3.1 and Compound 1.6. UPLC‐MS (Method A1): Rt = 1.93 min; m / z 1283.9 [M+H]+. ESI‐HRMS calculated for C47H53O19N14F2P2S2 (M‐H)‐ 1281.25016, found 1281.24931. NMR Tables 7‐8. 3.11 (Comparative Compound) Compound 3.2 and MC‐Val‐Cit‐PAB‐PNP (CAS 159857‐81‐5) UPLC‐MS (Method A1): Rt = 2.05 min; m / z 1377.4 [M+H]+. ESI‐HRMS calculated for C54H67O21N16F2P2 (M‐H)‐ 1375.41155, found 1375.41019. NMR Tables 7‐8. Table 7.1H,31P and19F NMR data of Compounds 3.4-3.11 in DMSO-d6. P‐ P‐Cmpd Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b CHa‐ CHb‐ H‐2,8 O O 4.63 dq 5.46 dddd 5.31 dd (27.4; 8.09 d 6.11 d (24.9; 4.22 Hpx (54.0; 2.3; 3.885 dt ‐‐ ‐‐ (3.7); (8.5) 12.0; 8.5; m 4.0) 2.3; 8.35 s 4.0) 2.3) 5.12 4.17 4.08 6.46 d 5.89 dd ddd 4.29 dd dd 8.67 s; A 4.34 m 3.92 m 3.4 (18.9) (52.0; 3.6) (24.7; m (14.0; (14.0; 8.47 s 8.4; 3.6) 1.8) 5.4) Linker: Mal: 6.99 s (CH=); C6: 3.36 t (2H), 1.47 m (2H), 1.18 m (2H), 1.48 m (2H); 2.11 dt (1H), 2.18 dt (1H) (5x CH2); Val: 7.79 d (NH), 4.19 dd (N‐CH), 1.96 m (CH), 0.845 d and 0.81 d (2x CH3); Cit: 8.065 d (NH), 4.38 m (N‐CH<), 1.69 m and 1.59 m (CH2), 1.43 m and 1.36 m, (CH2), 3.02 m and 2.94 m (N‐CH2); PAB: 9.99 s and 9.97 s (NH), 7.58 m, 7.54 m, 7.30 m and 7.26 m (4x ArH), 5.00 bs and 4.98 bs (O‐CH2); SE: 4.25 m (O‐CH2), 3.52 m (N‐ CH2), 2.95 s and 2.92 s (N‐CH3). 31P 57.69, 79.88. 19F ‐191.67, ‐198.78. 4.62 dq 5.45 dddd 5.32 dd (27.4; 4.25 8.09 d 6.10 d 3.90 bd Hpx (25.5; 8.5; (53.8; 2.2; bd ‐‐ ‐‐ (3.0); (8.6) (12.0) 12.0; 4.0) 4.0) 2.2; (12.0) 8.36 s 2.2) 5.15 4.05 4.17 6.45 d 5.88 dd ddd 4.20 dd 8.66 s; A 4.33 m 3.88 m bd (19.0) (52.0; 3.8) (24.6; m (14.5; 8.48 s 3.5 (14.5) 8.4; 3.8) 4.5) Linker: Mal‐PEG: 6.98 s (CH=), 3.58 m (N‐CH2), 2.32 dd (CH2‐CO), 3.14 q (N‐CH2), 3.35 t (O‐CH2), 3.48 m (6x O‐CH2), 3.59 m (O‐CH2), 2.47 m and 2.37 m (CH2‐CO), Val: 7.86 d (NH), 4.22 dd (N‐CH), 1.96 m (CH), 0.85 d and 0.82 d (2x CH3); Cit: 8.10 d (NH), 4.38 ddd (N‐CH), 1.69 m and 1.58 m (CH2), 1.42 m and 1.36 m (CH2), 3.02 m and 2.93 m (N‐CH2); PAB: 9.98 d (NH), 7.63 m, 7.54 m, 7.30 m and 7.26 m (4x ArH), 5.00 b and 4.97 b (O‐ CH2); SE: 2.95 s and 2.92 s (N‐CH3), 3.52 m (N‐CH2), 4.25 m (O‐CH2). 31P 57.50, 79.19. 19F ‐191.82, ‐198.64. 4.62 dq 5.45 dddd 5.31 dd (27.4; 8.09 d 6.11 d 4.28 Hpx (25.2; 8.6; (54.0; 2.2; 3.98 m ‐‐ ‐‐ (3.6); (8.6) m 12.0; 4.0) 4.0) 2.2; 8.35 s 2.2) 5.13 4.08 4.17 6.46 d 5.89 dd ddd 4.21 dd 8.66 s; 3.6 A 4.34 m 3.88 m bd (18.8) (51.8; 3.8) (24.6; m (14.0; 8.47 s (14.0) 8.4; 3.8) 5.0) Linker: Mal‐C6: 6.98 s (CH=), 3.36 t (N‐CH2), 1.47 m (2x CH2), 1.18 (CH2), 2.18 dt and 2.11 dt (CH2‐CO); Val: 7.80 d (NH), 4.17 dd (N‐CH), 1.96 m (CH), 0.86 d and 0.82 d (2x CH3); Ala: 8.14 d (NH), 4.38 p (N‐CH), 1.30 d (CH3); PAB: 9.93 d (NH), 7.57 m, 7.53 m, 7.30 m and 7.26 m (4x ArH), 5.00 b and 4.97 b (O‐CH2); SE: 2.95 s and 2.92 s (N‐CH3), 3.52 m (N‐CH2), 4.25 m (O‐CH2). 31P 57.69, 79.79. 19F ‐191.69, ‐198.81. 3.7 Hpx 6.09 d 5.45 dddd 5.32 dd 4.61 4.24 8.09 d dm m 3.90 dm ‐‐ ‐‐ (3.7) (25.2; 8.4; (53.8; (8.4) 12.4; 4.0) 4.0) (27.0) (11.5) 8.36 s 6.45 d 5.88 dd 5.16 4.32 4.17 4.08 4.23.86 dm 8.66 s ddd dm dd dd A 1 (18.6) (52.0; 3.4) (25.0; (8.4) m (11.6) (14.2; (14.2; 8.48 s 8.4; 3.4) 1.8) 5.3) Linker: Mal‐GlySar: 7.09 s (CH=), 4.16 s (N‐CH2), 2.76 s (N‐CH3), 4.30 s N‐CH2); Val: 7.95 d (NH), 4.23 dd (N‐CH), 1.98 m (CH), 0.86 d and 0.82 d (2x CH3); Cit: 8.17 d (NH), 4.38 ddd (N‐CH), 1.69 m and 1.54 m (CH2), 1.44 m and 1.37 m (CH2), 3.02 m and 2.93 m (N‐ CH2); PAB: 10.03 b and 9.96 b (NH), 7.57 m, 7.54 m, 7.30 m and 7.26 m (4x ArH), 5.00 bs and 4.97 bs (O‐CH2); SE: 2.95 s and 2.92 s (N‐CH3), 3.52 m (N‐CH2), 4.25 m (O‐CH2). 31P 57.02, 78.82. 19F ‐191.73, ‐198.89. 4.62 dq 3.91 dq 5.46 dddd 5.31 dd (27.3; 8.09 d 6.11 d 4.28 (11.6; Hpx (25.4; 8.6; (54.2; 2.3; (8.6) m 2.3; 2.3; ‐‐ ‐‐ (3.8); 12.4; 4.2) 4.2) 2.3; 8.35 s 2.3) 2.2) 6.46 5.13 4.23 3.89 4.17 4.08 5.89 ddd 4.34 dd ddd bdd ddd dd dd 8.67 s; A (52.2; 3.8; dm (19.0; (25.0; (11.7; (11.7; (14.2; (14.2; 8.47 s 0.9) (8.6) 0.9) 8.6; 3.8) 5.5) 4.5; 2.5) 1.8) 5.3) Linker: Mal‐GlyGly: 7.09 s (CH=), 4.08 s (N‐CH2), 8.49 t (NH), 3.80d (N‐CH2); Val: 7.86 d (NH), 4.24 dd (N‐CH), 1.98 m (CH), 0.86 d and 0.82 d (2x CH3); Cit: 8.18 d (NH), 4.37 ddd (N‐CH), 1.69 m and 1.57 m (CH2), 1.44 m and 1.36 m (CH2), 3.03 m and 2.94 m (N‐CH2); PAB: 9.96 bs and 9.95 bs (NH), 7.59 m, 7.55 m, 7.31 m and 7.26 m (4x ArH), 5.00 bs and 4.97 bs (O‐CH2); SE: 2.95 s and 2.92 s (N‐CH3), 3.52 m (N‐CH2), 4.25 m (O‐CH2). 31P 57.55, 79.66. 19F ‐191.69, ‐198.80. 4.30 3.92 dq 5.46 dddd 5.31 dd 4.63 ddd 8.09 d 6.12d (11.6; Hpx (24.9; 8.6; (53.9; dm (11.6; ‐‐ ‐‐ (3.7); (8.6) 2.4; 2.4; 12.2; 4.0) 4.0) (27.3) 7.7; 8.34 s 2.4) 1.8) 6.46 5.12 4.17 4.09 5.89 ddd dd ddd 4.21 dd dd 8.67 s; A (51.6; 3.8; 4.34 m 3.90 m (18.7; (24.8; m (14.2; (14.2; 8.46 s 0.8)) 0.8) 8.6; 3.8) 1.7) 5.4) Linker: Mal‐Gly: 7.08 s (CH=), 4.01 s (N‐CH2); PEG: 8.22 t (NH), 3.20 q (N‐CH2); 3.40 t (O‐CH2); 3.48 – 3.51 m (11x O‐CH2‐), 2.47 and 2.48 (N‐CH2); Val: 7.86 d (NH), 4.23 dd (N‐CH), 1.96 m (CH), 0.85 d and 0.82 d (2x CH3); Cit: 8.10 d (NH), 4.38 ddd (N‐CH), 1.69 m and 1.59 m (CH2), 1.44 m and 1.36 m (CH2), 3.03 m and 2.94 m (N‐CH2); PAB: 9.99 bs and 9.97 bs (NH), 7.56 m (2x ArH), 7.28 m (2x ArH), 5.00 bs and 4.97 bs (O‐CH2); SE: 2.95 s and 2.92 s (N‐CH3), 3.52 m (N‐CH2), 4.26 m (O‐CH2). 31P 57.88, 80.04. 19F ‐191.70, ‐198.69. 4.64 dq 5.46 dddd 5.31 dd 8.10 d 6.12d (27.6; 4.30 Hpx (25.5; 8.5; (54.0; 3.92 m ‐‐ ‐‐ (3.8); (8.5) 2.3 2.3; m 12.0; 4.1) 4.1) 8.34 s 2.3) 5.11 4.18 4.10 6.46 d 5.89 ddd ddd 4.22 dd dd 8.66 s; A 4.34 m 3.92 m (19.4) (52.1; 3.9) (24.6; m (14.0; (14.0; 8.46 s 8.6; 3.9) 1.7) 5.7) Linker: Mal‐Gly: 7.07 s (CH=), 4.01 s (N‐CH2); PEG: 8.17 t (NH), 3.19 q (N‐CH2); 3.38 t (O‐CH2), 3.60 td (O‐CH2), 2.41 td (N‐CH2); Ala: 8.19 d (NH), 4.42 p (N‐CH), 1.28 d (CH3); PAB: 10.03 bs and 10.01 bs (NH), 7.57, 7.52, 7.30 and 7.25 m (4x ArH), 5.00 bs and 4.97 bs (O‐CH2); SE: 2.95 s and 2.92 s (N‐CH3), 3.57 m and 3.52 m (N‐CH2), 4.26 m (O‐CH2). 31P 58.14, 80.16. 19F ‐191.72, ‐198.65. 4.62 dt 5.47 dddd 5.39 dd 8.09 d 6.14 d (27.0; 4.225 Hpx (24.6; 9.4; (54.0; 4.075 dt ‐‐ ‐‐ (3.6); (8.6) 3.6; m 8.6; 3.8) 3.8) 8.35 s 3.6) 4.90 6.46 d 5.92 dd ddd 4.22 8.65 s; A 4.35 m (19.0) (52.0; 3.8) (23.5; m 4.01 m n.d. n.d. 8.46 s 3.11 8.0; 3.8) Linker: Mal: 6.99 s (CH=); C6: 3.355 t (2H), 1.465 m (2H), 1.17 m (2H), 1.48 m (2H); 2.11 dt (1H), 2.17 dt (1H) (5x CH2); Val: 7.81 d (NH), 4.19 dd (N‐CH), 1.955 m (CH), 0.84 d and 0.81 d (2x CH3); Cit: 8.075 d (NH), 4.37 m (N‐CH), 1.68 m and 1.58 m (CH2), 1.43 m and 1.355 m, (CH2), 3.01 m and 2.94 m (N‐CH2); PAB: 9.99 s (NH), 7.57 m, 7.51 m, 7.285 m and 7.23 m (4x ArH), 4.97 b (O‐CH2); SE: 4.25 m (O‐CH2), 3.52 m (N‐CH2), 2.94 s and 2.91 s (N‐CH3). 31P ‐1.91, 18.64. 19F ‐192.89, ‐198.67. Table 8.13C NMR data of Compounds 3.4-3.11 in DMSO-d6. Cmpd Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 Hpx 83.55 74.13 92.13 81.58 63.09 ‐‐ 146.40 149.21 124.11 156.73 138.47 (3.2) (184.8) (23.0; 11.1) A 86.28 91.73 76.32 78.80 64.45 68.45 152.04 151.14 123.46 149.87 141.71 (33.7) (187.2) (16.0; (10.5) (123.0) 8.0) 3.4 Linker: Mal: 171.24 (C=O), 134.62 (CH=); C6: 37.18 (N‐CH2), 27.93 (CH2), 25.96 (CH2), 25.09 (CH2), 35.11 (CH2), 172.41 (C=O); Val: 171.44 (C=O), 57.70 (N‐CH), 30.58 (CH), 19.42 and 18.36 (2x CH3); Cit: 170.73 (C=O), 53.22 (N‐CH), 29.49 (CH2), 26.91 (CH2), 38.82 (N‐CH2), 159.11 (C=O); PAB: 138.77 (ArC), 119.19 (ArCH), 119.12 (ArCH), 128.60 (ArCH), 128.53 (ArCH), 131.79 (ArC), 66.26 (O‐CH2), SE: 152.20 (C=O),), 63.21 (O‐CH2), 47.91 and 47.36 (N‐CH2), 35.24 (N‐CH3), 155.74 and 155.49 (C=O). Hpx 83.52 74.08 92.24 81.64 64.54 ‐‐ 146.45 149.96 124.11 156.78 138.48 (15.2; (185.9) (23.4; (12.7; 8.1) 10.0) 5.1) A 86.32 91.81 76.39 78.92 63.20 68.37 152.10 151.17 123.45 149.90 141.78 (33.6) (187.1) (13.9; (11.1) (3.8) (122.2) 8.6) 3.5 Mal: 170.37 (C=O), 134.76 (CH=), 34.28 (CH2), 34.16 (CH2), 169.76 (C=O), PEG: 38.71 (N‐CH2), 69.18, 69.98(2), 69.91(2), 69.75, 69.68, 67.13 (8x O‐CH2), 36.13 (CH2), 170.55 (C=O); Val: 171.36 (C=O), 57.70 (N‐CH), 30.81 (CH), 19.40 and 18.31 (2x CH3); Cit: 170.77 (C=O), 53.30 (CH), 29.49 (CH2), 26.94 (CH2), 38.83 (N‐CH2), 159.21 (C=O); PAB: 138.75 (ArC), 119.26, 119.18, 128.66 and 128.97 (4x ArCH), 131.86 (ArC), 66.32 (O‐CH2), SE: 152.24 (C=O), 63.20 (CH2), 47.69 (CH2), 35.42 (CH3), 155.56 (CO). Hpx 83.54 74.10 92.14 81.58 64.48 ‐‐ 146.40 149.21 124.10 156.72 138.48 3.6 (185.1) (22.5; (12.0 9.0) ) A 86.26 91.74 76.34 78.83 63.23 68.43 152.05 151.14 123.47 149.88 141.70 (34.7) (187.1) (10.5) (10.6 (121.3) ) Linker: Mal‐C6: 171.24 (CO), 134.61 (CH=), 37.19 (N‐CH2), 27.94, 25.96, 25.07 and 35.08 (4x ‐ CH2‐), 172.43 (CO); ); Val: 171.28 (CO), 57.64 (CH), 30.58 (CH), 19.39 and 18.35 (2x CH3); Ala: 171.18 (CO), 49.18 (CH), 18.14 (CH3); PAB: 138.83 (ArC), 119.19, 119.11, 128.58 and 128.50 (4x ArCH), 131.76 (ArC), 66.27 (O‐CH2), SE: 152.21 (C=O), 63.14 (O‐CH2), 47.36 (N‐CH2), 35.14 and 35.44 (N‐CH3), 155.74 and 155.51 (C=O). Hpx 83.50 73.94 92.28 81.61 64.51 ‐‐ 146.38 149.24 124.06 156.74 138.50 (186.1) (23.0; 10.0) A 86.19 91.79 76.22 78.98 63.09 68.33 152.19 151.16 123.44 149.89 141.70 (33.9) (187.1) (11.0) (117.0) Linker: Mal‐GlySar: 170.92 and 170.90 (C=O), 135.15 and 135.08 (CH=), 51.13 (N‐CH2), 166.77 (C=O), 34.65 (N‐CH3), 57.85 (N‐CH2), 168.02 and 168.67 (C=O); Val: 171.11 and 171.00 (C=O), 57.70 (N‐CH), 30.86 (CH), 19.36 and 18.22 (2x CH3); Cit: 170.71 (C=O), 53.27 (N‐CH), 29.45 (CH2), 26.95 (CH2), 38.88 (N‐CH2), 159.14 (C=O); PAB: 138.76 (ArC), 119.18 (2), 128.62 and 128.53 (4x ArCH), 131.79 (ArC), 66.28 (O‐CH2), SE: 152.19 (C=O), 63.23 (O‐CH2), 47.61 (N‐CH2), 35.26 (N‐CH3), 155.75 and 155.51 (C=O). Hpx 83.53 74.10 92.16 81.58 64.47 ‐‐ 146.40 149.21 124.10 155.74 138.48 (16.0; (184.7; (24.1; (12.2 8.0) 3.8) 9.8) ) A 86.26 91.74 76.32 78.84 63.21 68.41 152.05 151.14 123.46 149.86 141.70 (33.7) (187.7) (10.4) (9.2) (122.0) Linker: Mal‐GlyGly: 170.80 (C=O), 135.14 (CH=), 39.75 (N‐CH2), 166.64 (C=O), 42.14 (N‐CH2), 168.67 (C=O); Val: 171.09 (C=O), 57.62 (N‐CH), 30.84 (CH), 19.33 and 18.19 (2x CH3); Cit: 170.71 (C=O), 53.36 (N‐CH), 29.37 (CH2), 26.97 (CH2), 38.78 (N‐CH2), 159.12 (C=O); PAB: 138.72 (ArC), 119.21, 119.14, 128.61 and 128.53 (4x ArCH), 131.78 (ArC), 66.28 (O‐CH2), SE: 152.20 (C=O), 63.13 (O‐CH2), 47.92 and 47.37 (N‐CH2), 35.39 and 35.12 (N‐CH3), 155.74 and 155.50 (C=O). Hpx 83.55 74.17 92.12 81.58 64.46 ‐‐ 146.42 149.21 124.12 156.73 138.46 (15.2; (185.6; (22.8; 9.4) 3.8) 10.4) A 86.32 91.73 76.42 78.76 63.26 68.46 152.05 151.14 123.47 149.88 141.73 (34.6) (187.1) (10.3) (123.8) Mal‐Gly: 170.86 (C=O), 135.04 (CH=), 39.76 (N‐CH2), 166.31 (C=O); PEG: 38.97 (N‐CH2), 69.07, 69.95(5), 69.88(2), 69.79, 69.64, 67.10, 66.53 (12x O‐CH2), 36.10 (‐CH2), 170.46 (C=O); Val: 171.31 (C=O), 57.63 (N‐CH), 30.79 (CH), 19.36 and 18.28 (2x CH3); Cit: 170.73 (C=O), 53.25 (N‐CH), 29.46 (CH2), 26.90 (CH2), 38.74 (N‐CH2), 159.14 (C=O); PAB: 138.78 and 138.73 (ArC), 119.21, 119.13, 128.62 and 128.54 (4x ArCH), 131.81 (ArC), 66.28 (O‐CH2), SE: 152.22 (C=O), 63.11 (O‐CH2), 47.36 (N‐CH2), 35.33 and 35.11 (N‐CH3), 155.50 (C=O). Hpx 83.56 74.23 92.08 81.58 64.44 ‐‐ 146.44 149.21 124.14 156.73 138.46 (15.6; (183.4; (24.4; 8.9) 3.4) 10.0) A 86.36 91.73 76.47 78.73 63.28 68.48 152.01 151.14 123.48 149.84 141.75 (33.9) (187.3) (14.4; (10.8) (122.8) 7.7) Mal‐Gly: 170.84 (C=O), 135.03 (CH=), 39.71 (N‐CH2), 166.29 (C=O); PEG: 38.87 (N‐CH2), 68.69 (O‐CH2), 66.67 (O‐CH2), 35.79 (‐CH2), 170.19 (C=O); Ala: 171.60 (C=O), 49.14 (N‐CH), 18.39 (CH3); PAB: 138.78 and 138.72 (ArC), 119.36, 119.26, 128.54 and 128.46 (4x ArCH), 131.81 (ArC), 66.26 (O‐CH2), SE: 152.23 (C=O), 63.10 (O‐CH2), 47.90 and 47.36 (N‐CH2), 35.38 and 35.11 (N‐CH3), 150.75 and 155.51 (C=O). Hpx 83.80 74.14 91.56 81.10 62.75 ‐‐ 146.46 149.09 124.54 156.76 138.77 (6.4) (18.0) (181.0) (23.0; 8.5) A 86.58 91.60 77.27 78.84 63.43 n.d. 152.14 151.12 123.70 149.98 141.84 (34.4) (187.8) (14.4) (8.5) 3.11 Linker: Mal: 171.26 (C=O), 134.63 (CH=); C6: 37.20 (N‐CH2), 27.95 (CH2), 25.97 (CH2), 25.10 (CH2), 35.19 (CH2), 172.48 (C=O); Val: 171.47 (C=O), 57.78 (N‐CH), 30.58 (CH), 19.44 and 18.38 (2x CH3); Cit: 170.74 (C=O), 53.29 (N‐CH), 29.49 (CH2), 26.87 (CH2), 38.82 (N‐CH2), 159.17 (C=O); PAB: 138.77 (ArC), 119.13 (2x ArCH), 128.50 (2x ArCH), 131.72 (ArC), 66.31 (O‐CH2), SE: 152.21 (C=O), 63.02 (O‐CH2), 47.63 (N‐CH2), 35.13 (N‐CH3), 155.55 (C=O). Example 3.12 Phenyl (9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17-difluoro-3,11-dimercapto-3,11-dioxido-8-(6- oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6- yl)(phenoxycarbonyl)carbamate (3.12) Step 1: Trimethylsilyl chloride (0.21 mL; 1.75 mmol) in ACN (1.5 mL) was added to a solution of 9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-15-(6-amino-9H-purin-9-yl)-16,17-difluoro-3,11- dimercapto-3,11-dioxidodecahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-8-yl)-1,9-dihydro-6H-purin-6-one diTEA salt (0.32 g; 0.35mmol; Compound 2.2) in pyridine (18 mL) and the reaction mixture was stirred for 45 minutes at r.t. After that, phenyl chloroformate (0.21 mL; 1.75 mmol) in ACN (1.5 mL) was added and reaction mixture was stirred for additional 1.5 h at r.t. The reaction mixture was cooled to 4oC and water (1 mL) was added. The reaction mixture was left to warm up to r.t. and carefully evaporated. The crude was dissolved in DMSO (5 mL) and directly loaded on C18 column. The product was purified by reverse phase chromatography (Method P2) and lyophilized from dioxane / water (1:1) to yield 0.26 g (64 %) of Compound 3.12 as diTEA salt. UPLC-MS (Method A1): Rt = 2.47 min; m / z 950.2 [M+H]+. ESI-HRMS calculated for C35H30O13N9F2P2S2(M-H)- 948.08533, found 948.08422. Table 9.1H,31P and19F NMR data of Compound 3.12 in DMSO-d6. Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b P‐CHa‐ P‐CHb‐ H‐2,8 O O 5.52 4.50 3.74 3.87 dddd 5.37 dq dq ddd 6.06 d (26.4; dd (26.8; (11.8; 8.07 s; Hpx (11.8; (8.5) 8.5; (54.7; 2.3; 2.3; ‐‐ ‐‐ 8.49 s 8.2; 12.8; 3.9) 2.2; 2.3; 2.2) 3.9) 2.2) 2.3) 4.27 5.65 3.69 5.94 dq 4.16 dt 4.04 ddd ddd 3.64 dd 6.48 d dd (9.4; (12.4; dd 9.10 s; A (27.8; (12.4; (14.6; (19.0) (52.0; 2.8; 2.8; (14.6; 8.90 s 9.4; 4.4; 2.1) 3.4) 2.0; 2.8) 4.2) 3.4) 2.0) 2.0) Linker: 2x CO‐O‐C6H5: 7.25 m (4x o‐ArH), 7.47 m (4x m‐ArH), 7.31 m (2x p‐ArH). 31P 54.28, 68.77. 19F ‐191.99, ‐198.80. Table 10.13C NMR data of Compound 3.12 in DMSO-d6. Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 Hpx 83.63 73.59 93.38 82.26 64.54 ‐‐ 146.08 149.32 123.78 156.82 138.96 (15.1; (182.2) (22.4; (12.7; 8.3) 9.0) 5.1) A 85.83 92.34 73.37 79.81 62.28 67.36 152.55 153.29 128.35 147.73 145.39 (34.0) (186.4) (15.6) (11.6) (3.8) (103.8) Linker: 2x CO‐O‐C6H5: 149.78 (C=O), 154.02 (i‐ArC), 121.47 (2x o‐ArC), 130.12 (2x m‐ArC), 126.96 (p‐ArC). Example 3.13 4-((S)-2-((S)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetamido)-3-methylbutanamido)-5- ureidopentanamido)benzyl (9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17-difluoro-3,11-dimercapto- 3,11-dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6-yl)carbamate (3.13)
[0004] Step 1: DBU (61 µL; 435 µmol) was added to a solution of BOC-ValCitPAB (42 mg; 87 µmol; CAS 870487-09-5) and phenyl (9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17-difluoro-3,11- dimercapto-3,11-dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6- yl)(phenoxycarbonyl)carbamate diTEA salt (100 mg; 87 µmol; Compound 3.12) in DMF (8 mL) and the reaction mixture was stirred for 6 h at r.t. The reaction mixture was evaporated. After that, the crude was treated with 0.5 M HCl in methanol (8 mL) for 16 h at r.t. and evaporated. The product was purified by reverse phase chromatography (Method P6) and lyophilized from dioxane / water (1:1) to yield 51 mg (48 %) of 4-((S)-2-((S)-2-amino-3-methylbutanamido)-5-ureidopentanamido)benzyl (9- ((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17-difluoro-3,11-dimercapto-3,11-dioxido-8-(6-oxo-1,6- dihydro-9H-purin-9-yl)decahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6-yl)carbamate TFA salt. UPLC-MS (Method A1): Rt = 1.81 min; m / z 1113.5 [M-H]-. ESI-HRMS calculated for C40H51O14N14F2P2S2(M+H)+1115.25884, found 1115.25895. Step 2: 2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetic acid (3.6 mg; 22 µmol) and HATU (8.4 mg; 22 µmol) in DMF (1 mL) were stirred for 30 minutes at r.t. After that, 4-((S)-2-((S)-2-amino-3- methylbutanamido)-5-ureidopentanamido)benzyl (9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-16,17- difluoro-3,11-dimercapto-3,11-dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9- methanofuro[3,2-m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-15-yl)-9H-purin-6- yl)carbamate TFA salt (27 mg; 22 µmol) and DIPEA (15.4 µL; 88 µmol) in DMF (5 mL) were added, and the reaction mixture was stirred for 1 h at r.t. The product was purified by reverse phase chromatography (Method P4) and lyophilized from dioxane / water (1:1) to yield 14 mg (47 %) of Compound 3.13. UPLC-MS (Method A1): Rt = 1.91 min; m / z 1250.6 [M-H]-. ESI-HRMS calculated for C46H52O17N15F2P2S2(M-H)- 1250.25558, found 1250.25464. Table 11.1H,31P and19F NMR data of Compound 3.13 in DMSO-d6. Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b P‐P‐ H‐2,8 CHa‐O CHb‐O Hpx 6.10 5.46 5.31 4.62 4.27 3.91 ‐‐ ‐‐ 8.09 d d dddd dd dq m dq (3.8); (8.6) (25.4; (54.0; (25.4; (11.6; 8.36 s 8.6; 3.8) 2.3; 2.4; 12.1; 2.3; 2.4; 3.8) 2.3) 2.4) A 6.46 5.88 5.13 4.34 4.21 3.87 4.16 4.07 8.67 s; dd ddd ddd m ddd ddd dd dd 8.48 s (18.6; (51.8; (24.8; (11.6; (11.6; (14.0; (14.0; 0.9) 3.8; 8.5; 5.6; 4.4; 2.0) 5.0) 0.9) 3.8) 4.0) 2.3) Linker: Mal‐Gly: 7.08 s (CH=), 4.13 s (N‐CH2); Val: 8.25 d (NH), 4.25 dd (N‐CH), 1.98 m (CH), 0.86 d and 0.82 d (2x CH3); Cit: 8.25 d (NH), 4.38 ddd (N‐CH), 1.70 m and 1.60 m (CH2), 1.44 m and 1.37 m (CH2), 3.03 dt and 2.94 dt (N‐CH2); PAB: 10.03 bs (NH), 7.61 m (2x ArH), 7.40 m (2x ArH), 5.17 s (O‐CH2). 31P 57.36, 79.57. 19F ‐191.69, ‐198.91. Table 12.13C NMR data of Compound 3.13 in DMSO-d6. Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 Hpx 83.54 74.00 92.18 81.56 64.48 ‐‐ 146.39 149.22 124.09 156.74 138.55 (3.2) (185.3; (23.2; 4.5) 11.0) A 86.20 91.77 76.15 78.87 63.13 68.37 152.11 151.18 123.52 149.95 141.66 (33.7) (187.1) (11.0) (123.0) Linker: Mal‐Gly: 170.88 (C=O), 135.03 (CH=), 39.70 (N‐CH2), 166.24 (C=O); Val: 170.97 (C=O), 57.66 (N‐CH), 31.15 (CH), 19.31 and 18.14 (2x CH3); Cit: 170.76 (C=O), 53.38 (N‐CH), 29.36 (CH2), 26.99 (CH2), 38.80 (N‐CH2), 159.10 (C=O); PAB: 139.00 (ArC), 119.12 (2x ArCH), 129.02 (2x ArCH), 131.11 (ArC), 66.40 (O‐CH2), SE: 152.27 (C=O). The compounds listed in the table below were prepared following an analogous procedure to the one above using commercially available or described starting materials (use of appropriate reagents and purification methods known to the skilled in the art): Cmpd Structure, reaction conditions and characterization Starting materials: Compound 3.12 and BOC‐ValAlaPAB (CAS 1884577‐99‐4). UPLC‐MS (Method A1): Rt = 2.05 min; m / z 1164.5 [M‐H]‐. ESI‐HRMS calculated for C43H45O16N13F2P2S2 (M‐2H)2‐ z=2 581.60014, found 581.60024. NMR Tables 13‐14. Starting materials: Compound 3.12 and Compound 1.4. UPLC‐MS (Method A1): Rt = 1.94 min; m / z 1587.7 [M+H]+. ESI‐HRMS calculated for C61H81O24N16F2P2S2 (M‐H)‐ 1585.44998, found 1585.44922. NMR Tables 13‐14. Starting materials: Compound 3.12 and Compound 1.7. UPLC‐MS (Method A1): Rt = 2.09 min; m / z 1285.5 [M‐H]‐. ESI‐HRMS calculated for C46H51O17N15ClF2P2S2 (M‐H)‐ 1284.21661, found 1284.21534. NMR Tables 13‐14. Starting materials: Compound 3.12 and Compound 1.8. UPLC‐MS (Method A1): Rt = 1.93 min; m / z 1269.2 [M‐H]‐. ESI‐HRMS calculated for C46H51O17N15F3P2S2 (M‐H)‐ 1268.24616, found 1268.24521. NMR Tables 13‐14. 3.18 Starting materials: Compound 3.12 and Compound 1.9. UPLC‐MS (Method A1): Rt = 1.89 min; m / z 1269.8 [M‐H]‐. ESI‐HRMS calculated for C46H51O17N15F3P2S2 (M‐H)‐ 1268.24616, found 1268.24533. NMR Tables 13‐14. Table 13.1H,31P and19F NMR data of Compounds 3.14-3.18 in DMSO-d6. P‐ P‐ Cmpd Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b CHa‐ CHb‐ H‐2,8 O O 4.59 dq 5.45 dddd 5.35 dd 8.09 d 6.08 d (27.2; 4.17 Hpx (25.0; 8.6; (54.0; 3.85 m ‐‐ ‐‐ (3.8); (8.6) 2.3; 2.3; m 12.0; 3.8) 3.8) 8.36 s 2.3) 5.22 3.96 6.44 d 5.87 dd ddd 4.16 4.15 dd 8.66 s; 3.14 A 4.29 m 3.85 m (19.3) (52.0; 3.8) (25.0; m m (14.0; 8.47 s 8.5; 3.8) 3.0) Linker: Mal Gly: 7.04 s (CH=), 4.12 s (N‐CH2); Val: 8.26 d (NH), 4.17 dd (N‐CH), 1.96 m (CH), 0.86 d and 0.82 d (2x CH3); Ala: 8.29 d (NH), 4.36 p (N‐CH), 1.30 d (CH3); PAB: 9.97 bs (NH), 7.57 m (2x ArH), 7.38 m (2x ArH), 5.15 s (O‐CH2). 31P 57.03, 77.15. 19F ‐192.24, ‐198.18. 4.62 dq 3.92 dq 5.46 dddd 5.31 dd 8.09 d 6.11d (27.5; 4.29 (11.6; Hpx (25.3; 8.4; (51.4; ‐‐ ‐‐ (3.8); (8.4) 2.3; 2.3; m 2.3; 2.3; 12.0; 3.9) 3.9) 8.35 s 2.3) 2.3) 5.12 4.17 4.08 6.46 d 5.89 dd ddd 4.21 dd dd 8.67 s; A 4.34 m 3.88 m 3.15 (18.7) (52.0; 3.8) (24.8; m (14.0; (14.0; 8.47 s 8.5; 3.8) 1.7) 5.2) Linker: Mal‐Gly: 7.08 s (CH=), 4.01 s (N‐CH2); PEG: 8.22 t (NH), 3.20 q (N‐CH2); 3.40 t (O‐CH2); 3.48 – 3.51 m (10x O‐CH2), 3.60 m (O‐CH2), 2.48 and 2.39 (N‐CH2); Val: 7.86 d (NH), 4.23 dd (N‐CH), 1.97 m (CH), 0.86 d and 0.83 d (2x CH3); Cit: 8.11 d (NH), 4.39 ddd (N‐CH), 1.70 m and 1.59 m (CH2), 1.44 m and 1.36 m (CH2), 3.03 m and 2.94 m (N‐CH2); PAB: 10.01 bs (NH), 7.62 m (2x ArH), 7.40 m (2x ArH), 5.16 s (O‐CH2). 31P 57.67, 79.88. 19F ‐191.69, ‐198.83. 5.31 4.63 dq 8.095 5.46 dddd 6.11 d bdd (27.4; 4.28 d Hpx (25.3; 8.6; (8.6) (53.0; 2.3; 2.3; m 3.91 m ‐‐ ‐‐ (3.8); 12.2; 4.0) 4.0) 2.3) 8.35 s 6.46 5.13 4.17 4.08 5.89 ddd dd ddd 4.21 dd dd 8.19 s; 3.16 A (51.9; 3.9; 4.35 m 3.885 m (18.8; (24.8; m (14.0; (14.0; 8.26 s 0.8) 0.8) 8.6; 3.9) 2.0) 5.4) Linker: Mal‐Gly: 7.08 s (CH=), 4.13 s (N‐CH2‐CO); Val: 8.26 d (NH), 4.25 dd (N‐CH), 1.98 m (CH), 0.86 d and 0.825 d (2x CH3); Cit: 8.30 d (NH), 4.35 m (N‐CH), 1.70 m and 1.605 m (CH2), 1.46 m and 1.365 m (CH2), 3.025 dt and 2.95 dt (N‐CH2); PAB‐2‐Cl: 10.23 s (NH), 7.905 d (ArH), 7.60 d (ArH), 7.48 dd (ArH), 5.24 s (O‐CH2). Hpx N1‐H 12.43 bd (3.8). 31P 57.75, 79.88. 19F ‐191.71, ‐198.76. 5.465 4.63 dq 5.31 dd 8.10 d 6.12 d dddd (27.5; 4.30 Hpx (53.9; 3.92 m ‐‐ ‐‐ (3.8); (8.6) (25.1; 8.6; 2.3; 2.3; m 4.2) 8.35 s 12.1; 4.2) 2.3) 6.56 5.11 4.215 3.895 4.17 4.09 5.89 ddd 4.34 dm dd ddd dd ddd dd dd 8.67 s; 3.17 A (51.9; 3.7; (8.7;4.8; (19.0; (24.9; (11.5; (11.5; (13.8; (13.8; 8.46 s 0.7) 4.6) 0.7) 8.7; 3.7) 4.8) 4.6; 2.3) 2.0) 5.7) Linker: Mal‐Gly: 7.08 s (CH=), 4.13 s (N‐CH2); Val: 8.25 d (NH), 4.25 dd (N‐CH), 1.98 m (CH), 0.86 d and 0.82 d (2x CH3); Cit: 8.29 d (NH), 4.36 m (N‐CH), 1.70 m and 1.60 m (CH2), 1.44 m and 1.37 m (CH2), 3.03 m and 2.945 m (N‐CH2); PAB‐2‐F: 10.26 s (NH), 7.645 dd (ArH), 7.51 t (ArH), 7.33 dd (ArH), 5.205 s (O‐CH2). Hpx N1‐H 12.43 d (3.8). 31P 57.99, 80.22. 19F ‐191.70, ‐198.72. 5.46 dddd 8.095 5.31 dd 4.63 dt 6.12 d (25.1; 4.295 d Hpx (53.8; (27.5; (8.5) 12.3; 8.5; m 3.92 m ‐‐ ‐‐ (3.8); 4.1) 2.3; 2.3) 4.1) 8.35 s 5.12 4.17 4.09 6.46 d 5.89 dd ddd 4.22 dd dd 8.68 s; A 4.34 um 3.89 m 3.18 (18.9) (51.8; 3.7) (24.9; m (14.0; (14.0; 8.48 s 8.6; 3.7) 1.8) 5.4) Linker: Mal‐Gly: 7.08 s (CH=), 4.14 d and 4.105 d (N‐CH2); Val: 8.255 d (NH), 4.26 dd (N‐ CH), 1.97 m (CH), 0.84 d and 0.81 d (2x CH3); Cit: 8.30 d (NH), 4.515 m (N‐CH), 1.72 m and 1.60 m (CH2), 1.45 m and 1.40 m (CH2), 2.985 m (N‐CH2); PAB‐3‐F: 9.79 bs (NH), 7.86 t (ArH), 7.405 dd (ArH), 7.255 dd (ArH), 5.195 s (O‐CH2). Hpx N1‐H 12.43 d (3.8). 31P 57.97, 80.13. 19F ‐191.68, ‐198.75. Table 14.13C NMR data of Compounds 3.14-3.18 in DMSO-d6. Cmpd Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 Hpx 83.54 74.06 92.55 81.88 64.78 ‐‐ 146.66 149.47 124.16 156.98 138.65 (3.2) (14.8; (183.2) (23.2; 8.2) 9.5) 3.14 A 86.46 92.04 76.52 79.24 63.28 68.22 152.34 150.08 123.44 151.34 142.02 (34.2) (186.7) (16.3; (11.4) (119.3) 6.2) Linker: Mal‐Gly: 171.12 (C=O), 135.22 (CH=), 39.90 (N‐CH2), 166.64 (C=O); Val: 171.02 (C=O), 58.07 (N‐CH), 31.19 (CH), 19.47 and 18.40 (2x CH3); Ala: 171.59 (C=O), 49.57 (N‐CH), 18.12 (CH3); PAB: 139.18 (ArC), 119.41 (2x ArCH), 129.22 (2x ArCH), 131.36 (ArC), 66.63 (O‐CH2), SE: 152.45 (C=O). Hpx 83.55 74.05 92.11 81.57 64.45 ‐‐ 146.40 149.21 124.11 156.73 138.52 (14.4; (183.9; (24.1; 8.8) 3.8) 10.4) A 86.25 91.72 76.29 78.80 63.18 68.42 152.09 151.16 123.52 149.94 141.68 (34.4) (187.1) (13.2; (10.5) (121.9) 3.15 8.8) Linker: Mal‐Gly: 170.77 (C=O), 135.03 (CH=), 39.76 (N‐CH2), 166.30 (C=O); PEG: 38.96 (N‐CH2), 69.06, 69.94(6), 69.87(2), 69.78, 69.64 and 67.10 (12x O‐CH2), 36.09 (CH2), 170.45 (C=O); Val: 171.32 (C=O), 57.62 (N‐CH), 30.78 (CH), 19.36 and 18.27 (2x CH3); Cit: 170.85 (C=O), 53.26 (N‐ CH), 29.46 (CH2), 26.95 (CH2), 38.79 (N‐CH2), 159.08 (C=O); PAB: 138.98 (ArC), 119.12 (2x ArCH), 129.01 (2x ArCH), 131.12 (ArC), 66.39 (O‐CH2), SE: 152.26 (C=O). Hpx 83.53 74.09 92.13 81.58 64.43 ‐‐ 146.11 149.22 124.11 156.75 138.51 (184.6) (23.4; 10.6) A 86.27 91.75 76.33 78.81 63.20 68.42 152.13 151.19 123.53 149.86 141.76 3.16 (186.8) (11.3) (121.6) Linker: Mal‐Gly: 170.89 (C=O), 135.03 (CH=), 39.70 (N‐CH2), 166.30 (C=O), Val: 171.06 (C=O); 57.66 (N‐CH), 31.13 (CH), 19.30 and 18.15 (2x CH3); Cit: 171.21 (C=O), 53.54 (N‐CH), 29.16 (CH2), 26.97 (CH2), 38.77 (N‐CH2), 159.11 (C=O); PAB‐2‐Cl: 140.29 (ArC), 119.30 (ArCH), 117.82 (ArCH), 131.02 (ArCH). 132.87 (ArC), 128.22 (ArC), 63.80 (O‐CH2), 152.01 (C=O). Hpx 83.56 74.12 92.06 81.56 64.42 ‐‐ 146.42 148.21 124.14 156.74 138.52 (3.3) (14.8; (184.8; (23.8; (11.2 8.9) 4.2) 10.6) ) A 86.31 91.72 76.36 78.73 63.24 68.45 152.09 151.20 123.61 149.86 141.73 (33.9) (186.9) (15.3; (11.5) (122.2) 3.17 8.8) Linker: Mal‐Gly: 170.88 (C=O), 135.02 (CH=), 39.67 (N‐CH2), 166.28 (C=O); Val: 171.06 (C=O), 57.65 (N‐CH), 31.13 (CH), 19.29 and 18.14 (2x CH3); Cit: 171.22 (C=O), 53.49 (N‐CH), 29.16 (CH2), 26.98 (CH2), 38.71 (N‐CH2), 159.13 (C=O); PAB‐2‐F: 141.04 (ArC), 114.86 (ArCH), 105.90 (ArCH), 131.66 (ArCH). 160.68 (ArC), 117.56 (ArC), 60.56 (O‐CH2), 152.11 (C=O). Hpx 83.55 74.17 92.09 81.57 64.45 ‐‐ 146.42 149.21 124.12 156.74 138.49 (3.0) (15.6; (184.4; (23.4; 9.0) 3.5) 9.9) A 86.30 91.73 76.34 78.75 63.24 68.45 152.12 151.15 123.41 149.87 141.74 (33.9) (187.4) (15.1; (11.0) (127.6) 3.18 8.5) Linker: Mal‐Gly: 170.88 (C=O), 135.02 (CH=), 39.69 (N‐CH2), 166.14 (C=O); Val: 171.07 (C=O), 57.53 (N‐CH), 31.19 (CH), 19.27 and 18.10 (2x CH3); Cit: 171.15 (C=O), 53.06 (N‐CH), 29.23 (CH2), 26.84 (CH2), 38.90 (N‐CH2), 159.01 (C=O); PAB‐3‐F: 125.68 (ArC), 153.49 (ArC), 115.07 (ArCH), 123.82 (ArCH), 123.92 (ArCH), 133.92 (ArC), 65.54 (O‐CH2), 152.04 (C=O). Example 3.19 (Comparative compound) (2S)-N-((2S)-1-((4-((((6R,8R,9S,13aR,15R,16R,16aR,17R)-15-(6-amino-9H-purin-9-yl)-16,17- difluoro-3-mercapto-3,11-dioxido-8-(6-oxo-1,6-dihydro-9H-purin-9-yl)decahydro-6,9- methanofuro[3,2-m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-11- yl)thio)methyl)phenyl)amino)-1-oxopropan-2-yl)-2-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1- yl)acetamido)-3-methylbutanamide (3.19) Step 1: Mal-Gly-Val-Ala-PAB-I (13.5 mg; 25 µmol; Compound 1.10) was added to a solution of 9-((6R,8R,9S,13aR,15R,16R,16aR,17R)-15-(6-amino-9H-purin-9-yl)-16,17-difluoro-3,11- dimercapto-3,11-dioxidodecahydro-6,9-methanofuro[3,2- m][1,3,6,9,12]pentaoxa[2,10]diphosphacyclopentadecin-8-yl)-1,9-dihydro-6H-purin-6-one diTEA salt (40 mg; 44 µmol; Compound 2.2) in DMSO (5 mL) and the reaction mixture was stirred for 3 h at 30oC. The reaction mixture was directly loaded on C18 column. The product was purified by reverse phase chromatography (Method P4) as HPLC faster eluting Compound 3.19 followed by other products. The produt was lyophilized from dioxane / water (1:1) to yield 5 mg (16 %) of Compound 3.19. UPLC-MS (Method A1): Rt = 2.30 min; m / z 1122.3 [M+H]+. ESI-HRMS calculated for C42H46O14N13F2P2S2(M-H)- 1120.21774, found 1120.21716. Table 15.1H,31P and19F NMR data of Compound 3.19 in DMSO-d6. P‐ P‐ Unit H‐1’ H‐2’ H‐3’ H‐4’ H‐5’a H‐5’b CHa‐ CHb‐ H‐2,8 O O 5.79 dddd 5.41 dd 8.11 d 6.24 d 4.72 dm 4.28 Hpx (24.1; 10.0; (53.8; 3.945 m ‐‐ ‐‐ (3.8); (8.4) (27.0) m 8.4; 4.0) 4.0) 8.50 s 6.34 5.92 ddd 5.205 dd 4.16 4.03 4.03 8.27 s; A (51.6; 4.0; dm 4.16 m 3.96 m (19.4; m m m 8.33 s 1.1) (21.8) 1.1) Linker: Mal‐Gly: 7.08 s (CH=), 4.13 s (N‐CH2); Val: 8.25 d (NH), 4.21 dd (N‐CH), 1.955 m (CH), 0.865 d and 0.82 d (2x CH3); Ala: 8.29 d (NH), 4.37 p (N‐CH), 1.28 d (CH3); PAB: 9.94 d (NH), 7.50 m (2x ArH), 7.23 m (2x ArH), 4.03 m (S‐CH2). 31P 48.16, 28.62. 19F ‐193.12, ‐198.27. Table 16.13C NMR data of Compounds 3.19 in DMSO-d6. Unit C‐1’ C‐2’ C‐3’ C‐4’ C‐5’ P‐CH2‐ O C‐2 C‐4 C‐5 C‐6 C‐8 Hpx 83.31 75.95 91.60 82.41 64.00 ‐‐ 146.57 149.11 124.30 156.58 138.38 (14.6; (183.4) (9.4) 8.0) A 86.57 92.17 78.43 78.43 65.60 69.26 151.20 148.63 119.14 n.d. 140.00 (34.6) (187.2) (123.1) Linker: Mal‐Gly: 170.87 (C=O), 35.02 (CH=), 39.66 (N‐CH2), 166.72 (C=O); Val: 170.72 (C=O), 57.70 (N‐CH), 31.08 (CH), 19.27 and 18.23 (2x CH3); Ala: 171.24 (C=O), 49.24 (N‐CH), 17.99 (CH3); PAB: 138.74 (ArC), 119.30 (2x ArCH), 129.42 (2x ArCH), 131.51 (ArC), 34.34 (S‐CH2). Example 4 Activity of cyclic dinucleotides in 293T reporter assay. Methods Digitonin Assay with 293T Reporter Cells. The generation of 293T reporter cells stably expressing different STING protein haplotypes (WT, HAQ, REF, AQ, or Q) was described previously (Novotna et al, J. Med. Chem.2019,62, 10676). The cells were seeded at a density of 250000 cells per cm2into 96 well white poly(D-lysine) coated plates in 100 μL of DMEM with high glucose supplemented with 10% heat inactivated FBS. Next day, the medium was removed, and compounds were added in 3-fold serial dilutions in a digitonin buffer containing 50 mM HEPES (pH 7.0), 100 mM KCl, 3 mM MgCl2, 0.1 mM DTT, 85 mM sucrose, 0.2% (w / w) BSA, 1 mM ATP, 0.1 mM GTP, and 10 μg / mL digitonin A. After 30 min incubation at 37 °C with 5% CO2, the digitonin buffer was removed, cells were washed once with 100 μL of the cultivation medium, and 100 μL of fresh medium was added to each well. The plates with cells were further incubated for 5 h at 37 °C with 5% CO2. Thereafter, 50 μL of the medium was removed, and 30 μL of Bright-Glo Luciferase Assay System reagent was added to each well. Luminescence was measured on Spark (TECAN, Grödig, Austria), and GraphPad Prism (La Jolla, USA) was used to calculate the 50% effective concentration (EC50) from an 8- point dose−response curve. Nonlinear regression curve fit with standard slope was used for EC50value calculations. The EC50value represents CDN concentration that gives half-maximal response of firefly luciferase in the 293T reporter assay. Results It has been previously reported that not all cyclic dinucleotides (CDNs) exhibit equipotent activity against all STING haplotypes present in humans (Yi et al, PLoS One (2013), 8 (10), e77846CODEN). To evaluate this phenomenon, we investigated the activity of 2'3' CDNs in a 293T cell line expressing the five major STING haplotypes. In the assay we used the detergent digitonin A to permeabilize cellular membranes. This approach ensures that the uptake of negatively charged CDNs into cells is not a limiting factor in STING activation, thereby allowing us to characterize the inherent potency of cyclic dinucleotides. 2’3’ cyclic dinucleotides containing both adenosine nucleobases (Compounds 2.4, 2.5, 2.6, 2.7) had potent activity against WT, HAQ and AQ STING haplotypes, but were much less active against REF haplotype. Considering the synthesis of CDN conjugates, it is beneficial to minimize the number of reactive groups on CDNs. To achieve this, we synthesized CDN 2.1, 2.2, and 2.3, utilizing hypoxanthine and adenine as nucleobases. Notably, compounds 2.2 and 2.3 demonstrated excellent activity against all STING haplotypes, including REF haplotype which is found in 13% of humans (Yi et al; PLoS One, 2013, 8: e77846). It is advantageous for CDNs to activate all STING haplotypes because this will avoid the need for genotyping patients and allow for targeting a broader population of patients with CDN therapy. As a result of their promising performance, these compounds 2.2 and 2.3 have were chosen for further evaluation in the context of CDN conjugate synthesis (Table 17). Table 17. 293T STING DIGITONIN reporter assay EC50(μM) Cmpd WT HAQ REF AQ Q 2.4 0.02 0.08 3 0.11 0.28 2.5 11.2 >45 >45 14.2 >45 2.6 0.4 0.6 13.4 0.6 10.0 2.7 0.6 0.6 15.2 0.5 14.8 2.3 0.02 0.02 0.06 0.04 0.05 2.1 0.03 0.18 0.14 0.18 0.35 2.2 0.02 0.02 0.05 0.03 0.08 Example 5 Cloning, expression, preparation of antibody-CDN conjugates and their characterization Example 5.1 Cloning of monoclonal antibodies Sequences of Light (L) chain and Heavy (H) chains of anti-Her2 monoclonal antibody (mAb) Trastuzumab, anti-TROP2 mAb Sacituzumab, anti FOLR1 mAb Farletuzumab and isotype anti-HBsAg mAb Libivirumab were obtained from https: / / www.imgt.org / . Protein sequences were translated into DNA using https: / / www.bioinformatics.org / sms2 / rev_trans.html. HindIII cloning site, Kozak’s sequence, secretion signals (L chain and H chain specific) were cloned to 5’ end and two stop codons (usually Ochre and Opal), XhoI cloning site at 3’ end of the open reading frames for L and H chains. HindIII and XhoI restriction sites were selected for unique cloning of DNA cassettes into pTT5 vector. DNA cassette was subjected to the codon optimization for expression in HEK 293 cells except of the selected regions at 5’ and 3’ end (cloning sites, Kozak’s sequence, stop codons). DNA sequences were synthetically prepared by ThermoFisher (Czech Republic). In some cases, cysteine (Cys) mutations were introduced engineered into heavy and / or light chains by the site directed mutagenesis. SEQ ID NO: 1, mAb1: Trastuzumab (anti Her2 mAb) heavy chain with engineered E152C and S375C (EU numbering) GAAGTGCAGCTGGTGGAAAGCGGCGGCGGCCTGGTGCAGCCGGGCGGCAGCCTGCGCCT GAGCTGCGCGGCGAGCGGCTTTAACATTAAAGATACCTATATTCATTGGGTGCGCCAGGC GCCGGGCAAAGGCCTGGAATGGGTGGCGCGCATTTATCCGACCAACGGCTATACCCGCTA TGCGGATAGCGTGAAAGGCCGCTTTACCATTAGCGCGGATACCAGCAAAAACACCGCGT ATCTGCAGATGAACAGCCTGCGCGCGGAAGATACCGCGGTGTATTATTGCAGCCGCTGGG GCGGCGATGGCTTTTATGCGATGGATTATTGGGGCCAGGGCACCCTGGTGACCGTGAGCA GCGCGAGCACCAAAGGCCCGAGCGTGTTTCCGCTGGCGCCGAGCAGCAAAAGCACCAGC GGCGGCACCGCGGCGCTGGGCTGCCTGGTCAAGGACTATTTTCCGTGTCCGGTGACCGTG AGCTGGAACAGCGGCGCGCTGACCAGCGGCGTGCATACCTTTCCGGCGGTGCTGCAGAG CAGCGGCCTGTATAGCCTGAGCAGCGTGGTGACCGTGCCGAGCAGCAGCCTGGGCACCC AGACCTATATTTGCAACGTGAACCATAAACCGAGCAACACCAAAGTGGATAAAAAAGTG GAACCGAAAAGCTGCGATAAAACCCATACCTGCCCGCCGTGCCCGGCGCCGGAACTGCT GGGCGGCCCGAGCGTGTTTCTGTTTCCGCCGAAACCGAAAGATACCCTGATGATTAGCCG CACCCCGGAAGTGACCTGCGTGGTGGTGGATGTGAGCCATGAAGATCCGGAAGTGAAAT TTAACTGGTATGTGGATGGCGTGGAAGTGCATAACGCGAAAACCAAACCGCGCGAAGAA CAGTATAACAGCACCTATCGCGTGGTGAGCGTGCTGACCGTGCTGCATCAGGATTGGCTG AACGGCAAAGAATATAAATGCAAAGTGAGCAACAAAGCGCTGCCGGCGCCGATTGAAAA AACCATTAGCAAAGCGAAAGGCCAGCCGCGCGAACCGCAGGTGTATACCCTGCCGCCGA GCCGCGAAGAAATGACCAAAAACCAGGTGAGCCTGACCTGCCTGGTGAAAGGCTTTTAT CCGTGCGATATTGCGGTGGAATGGGAAAGCAACGGCCAGCCGGAAAACAACTATAAAAC CACCCCGCCGGTGCTGGATAGCGATGGCAGCTTTTTTCTGTATAGCAAACTGACCGTGGA TAAAAGCCGCTGGCAGCAGGGCAACGTGTTTAGCTGCAGCGTGATGCATGAAGCGCTGC ATAACCATTATACCCAGAAAAGCCTGAGCCTGAGCCCGGGCAAA SEQ ID NO: 2, mAb1: Trastuzumab (anti Her2 mAb) light chain GCTTCCACCATGTCTGTGCCTACACAGGTGCTGGGACTGCTGCTGCTGTGGCTGACAGAT GCCAGATGCGACATCCAGATGACACAGAGCCCTAGCAGCCTGTCTGCCAGCGTGGGAGA CAGAGTGACCATCACCTGTAGAGCCAGCCAGGACGTGAACACAGCCGTGGCTTGGTATC AGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATCTACAGCGCCAGCTTTCTGTACAGCG GCGTGCCCAGCAGATTCAGCGGCTCTAGAAGCGGCACCGACTTCACCCTGACCATAAGCA GTCTGCAGCCCGAGGACTTCGCCACCTACTACTGTCAGCAGCACTACACCACACCTCCAA CCTTTGGCCAGGGCACCAAGGTGGAAATCAAGCGGACAGTGGCCGCTCCTAGCGTGTTCA TCTTTCCACCTAGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGTGCCTGCTGA ACAACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGAGC GGCAATAGCCAAGAGAGCGTGACCGAGCAGGACAGCAAGGACTCTACCTACAGCCTGAG CAGCACCCTGACACTGAGCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAG TGACCCACCAGGGCCTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAGTGCTGAT AGCTCGAG SEQ ID NO: 3, mAb2: Trastuzumab (anti Her2 mAb) heavy chain GAAGTGCAGCTGGTGGAAAGCGGCGGCGGCCTGGTGCAGCCGGGCGGCAGCCTGCGCCT GAGCTGCGCGGCGAGCGGCTTTAACATTAAAGATACCTATATTCATTGGGTGCGCCAGGC GCCGGGCAAAGGCCTGGAATGGGTGGCGCGCATTTATCCGACCAACGGCTATACCCGCTA TGCGGATAGCGTGAAAGGCCGCTTTACCATTAGCGCGGATACCAGCAAAAACACCGCGT ATCTGCAGATGAACAGCCTGCGCGCGGAAGATACCGCGGTGTATTATTGCAGCCGCTGGG GCGGCGATGGCTTTTATGCGATGGATTATTGGGGCCAGGGCACCCTGGTGACCGTGAGCA GCGCGAGCACCAAAGGCCCGAGCGTGTTTCCGCTGGCGCCGAGCAGCAAAAGCACCAGC GGCGGCACCGCGGCGCTGGGCTGCCTGGTCAAGGACTATTTTCCGGAGCCGGTGACCGTG AGCTGGAACAGCGGCGCGCTGACCAGCGGCGTGCATACCTTTCCGGCGGTGCTGCAGAG CAGCGGCCTGTATAGCCTGAGCAGCGTGGTGACCGTGCCGAGCAGCAGCCTGGGCACCC AGACCTATATTTGCAACGTGAACCATAAACCGAGCAACACCAAAGTGGATAAAAAAGTG GAACCGAAAAGCTGCGATAAAACCCATACCTGCCCGCCGTGCCCGGCGCCGGAACTGCT GGGCGGCCCGAGCGTGTTTCTGTTTCCGCCGAAACCGAAAGATACCCTGATGATTAGCCG CACCCCGGAAGTGACCTGCGTGGTGGTGGATGTGAGCCATGAAGATCCGGAAGTGAAAT TTAACTGGTATGTGGATGGCGTGGAAGTGCATAACGCGAAAACCAAACCGCGCGAAGAA CAGTATAACAGCACCTATCGCGTGGTGAGCGTGCTGACCGTGCTGCATCAGGATTGGCTG AACGGCAAAGAATATAAATGCAAAGTGAGCAACAAAGCGCTGCCGGCGCCGATTGAAAA AACCATTAGCAAAGCGAAAGGCCAGCCGCGCGAACCGCAGGTGTATACCCTGCCGCCGA GCCGCGAAGAAATGACCAAAAACCAGGTGAGCCTGACCTGCCTGGTGAAAGGCTTTTAT CCGAGCGATATTGCGGTGGAATGGGAAAGCAACGGCCAGCCGGAAAACAACTATAAAAC CACCCCGCCGGTGCTGGATAGCGATGGCAGCTTTTTTCTGTATAGCAAACTGACCGTGGA TAAAAGCCGCTGGCAGCAGGGCAACGTGTTTAGCTGCAGCGTGATGCATGAAGCGCTGC ATAACCATTATACCCAGAAAAGCCTGAGCCTGAGCCCGGGCAAA SEQ ID NO: 4, mAb2: Trastuzumab (anti Her2 mAb) light chain GCTTCCACCATGTCTGTGCCTACACAGGTGCTGGGACTGCTGCTGCTGTGGCTGACAGAT GCCAGATGCGACATCCAGATGACACAGAGCCCTAGCAGCCTGTCTGCCAGCGTGGGAGA CAGAGTGACCATCACCTGTAGAGCCAGCCAGGACGTGAACACAGCCGTGGCTTGGTATC AGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATCTACAGCGCCAGCTTTCTGTACAGCG GCGTGCCCAGCAGATTCAGCGGCTCTAGAAGCGGCACCGACTTCACCCTGACCATAAGCA GTCTGCAGCCCGAGGACTTCGCCACCTACTACTGTCAGCAGCACTACACCACACCTCCAA CCTTTGGCCAGGGCACCAAGGTGGAAATCAAGCGGACAGTGGCCGCTCCTAGCGTGTTCA TCTTTCCACCTAGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGTGCCTGCTGA ACAACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGAGC GGCAATAGCCAAGAGAGCGTGACCGAGCAGGACAGCAAGGACTCTACCTACAGCCTGAG CAGCACCCTGACACTGAGCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAG TGACCCACCAGGGCCTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAGTGCTGAT AGCTCGAG SEQ ID NO: 5, mAb3: Trastuzumab (anti Her2 mAb) heavy chain with engineered S375C (EU numbering) GAAGTGCAGCTGGTGGAAAGCGGCGGCGGCCTGGTGCAGCCGGGCGGCAGCCTGCGCCT GAGCTGCGCGGCGAGCGGCTTTAACATTAAAGATACCTATATTCATTGGGTGCGCCAGGC GCCGGGCAAAGGCCTGGAATGGGTGGCGCGCATTTATCCGACCAACGGCTATACCCGCTA TGCGGATAGCGTGAAAGGCCGCTTTACCATTAGCGCGGATACCAGCAAAAACACCGCGT ATCTGCAGATGAACAGCCTGCGCGCGGAAGATACCGCGGTGTATTATTGCAGCCGCTGGG GCGGCGATGGCTTTTATGCGATGGATTATTGGGGCCAGGGCACCCTGGTGACCGTGAGCA GCGCGAGCACCAAAGGCCCGAGCGTGTTTCCGCTGGCGCCGAGCAGCAAAAGCACCAGC GGCGGCACCGCGGCGCTGGGCTGCCTGGTCAAGGACTATTTTCCGGAGCCGGTGACCGTG AGCTGGAACAGCGGCGCGCTGACCAGCGGCGTGCATACCTTTCCGGCGGTGCTGCAGAG CAGCGGCCTGTATAGCCTGAGCAGCGTGGTGACCGTGCCGAGCAGCAGCCTGGGCACCC AGACCTATATTTGCAACGTGAACCATAAACCGAGCAACACCAAAGTGGATAAAAAAGTG GAACCGAAAAGCTGCGATAAAACCCATACCTGCCCGCCGTGCCCGGCGCCGGAACTGCT GGGCGGCCCGAGCGTGTTTCTGTTTCCGCCGAAACCGAAAGATACCCTGATGATTAGCCG CACCCCGGAAGTGACCTGCGTGGTGGTGGATGTGAGCCATGAAGATCCGGAAGTGAAAT TTAACTGGTATGTGGATGGCGTGGAAGTGCATAACGCGAAAACCAAACCGCGCGAAGAA CAGTATAACAGCACCTATCGCGTGGTGAGCGTGCTGACCGTGCTGCATCAGGATTGGCTG AACGGCAAAGAATATAAATGCAAAGTGAGCAACAAAGCGCTGCCGGCGCCGATTGAAAA AACCATTAGCAAAGCGAAAGGCCAGCCGCGCGAACCGCAGGTGTATACCCTGCCGCCGA GCCGCGAAGAAATGACCAAAAACCAGGTGAGCCTGACCTGCCTGGTGAAAGGCTTTTAT CCGTGCGATATTGCGGTGGAATGGGAAAGCAACGGCCAGCCGGAAAACAACTATAAAAC CACCCCGCCGGTGCTGGATAGCGATGGCAGCTTTTTTCTGTATAGCAAACTGACCGTGGA TAAAAGCCGCTGGCAGCAGGGCAACGTGTTTAGCTGCAGCGTGATGCATGAAGCGCTGC ATAACCATTATACCCAGAAAAGCCTGAGCCTGAGCCCGGGCAAA SEQ ID NO: 6, mAb3: Trastuzumab (anti Her2 mAb) light chain with engineered V110C (EU numbering) AAGCTTCCACCATGTCTGTGCCTACACAGGTGCTGGGACTGCTGCTGCTGTGGCTGACAG ATGCCAGATGCGACATCCAGATGACACAGAGCCCTAGCAGCCTGTCTGCCAGCGTGGGA GACAGAGTGACCATCACCTGTAGAGCCAGCCAGGACGTGAACACAGCCGTGGCTTGGTA TCAGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATCTACAGCGCCAGCTTTCTGTACAG CGGCGTGCCCAGCAGATTCAGCGGCTCTAGAAGCGGCACCGACTTCACCCTGACCATAAG CAGTCTGCAGCCCGAGGACTTCGCCACCTACTACTGTCAGCAGCACTACACCACACCTCC AACCTTTGGCCAGGGCACCAAGGTGGAAATCAAGCGGACATGCGCCGCTCCTAGCGTGTT CATCTTTCCACCTAGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGTGCCTGCT GAACAACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGA GCGGCAATAGCCAAGAGAGCGTGACCGAGCAGGACAGCAAGGACTCTACCTACAGCCTG AGCAGCACCCTGACACTGAGCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGA AGTGACCCACCAGGGCCTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAGTGCTG ATAGCTCGAG SEQ ID NO: 7, mAb4: Sacituzumab (anti TROP2 mAb) heavy chain CAGGTTCAGCTGCAGCAGTCTGGCAGCGAGCTGAAGAAACCTGGCGCCTCTGTGAAGGT GTCCTGCAAGGCCAGCGGCTACACCTTTACCAACTACGGCATGAACTGGGTCAAGCAGGC CCCTGGACAGGGCCTGAAATGGATGGGCTGGATCAACACCTACACCGGCGAGCCCACCT ACACAGACGACTTCAAGGGCAGATTCGCCTTCAGCCTGGACACCTCTGTGTCCACAGCCT ACCTGCAGATCAGCAGCCTGAAGGCCGATGATACCGCCGTGTACTTCTGTGCCAGAGGCG GCTTTGGCAGCAGCTACTGGTACTTCGATGTGTGGGGCCAGGGCAGCCTGGTCACAGTTA GCTCTGCCTCTACAAAGGGCCCCAGCGTGTTCCCTCTGGCTCCTAGCAGCAAGTCTACAA GCGGAGGAACAGCCGCTCTGGGCTGCCTCGTGAAGGATTACTTTCCCGAGCCTGTGACCG TGTCCTGGAATTCTGGCGCTCTGACAAGCGGCGTGCACACCTTTCCAGCTGTGCTGCAAA GCAGCGGCCTGTACTCTCTGAGCAGCGTCGTGACAGTGCCTAGCAGCTCTCTGGGCACCC AGACCTACATCTGCAATGTGAACCACAAGCCTAGCAACACCAAGGTGGACAAGAGAGTG GAACCCAAGAGCTGCGACAAGACCCACACCTGTCCTCCATGTCCTGCTCCAGAACTGCTC GGCGGACCTTCCGTGTTTCTGTTCCCTCCAAAGCCTAAGGACACCCTGATGATCAGCAGA ACCCCTGAAGTGACCTGCGTGGTGGTGGATGTGTCCCACGAGGATCCCGAAGTGAAGTTC AATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGAACA GTACAACAGCACCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAA CGGCAAAGAGTACAAGTGCAAGGTGTCCAACAAGGCTCTGCCCGCTCCTATCGAGAAAA CCATCAGCAAGGCCAAGGGCCAGCCTAGGGAACCCCAGGTTTACACACTGCCTCCAAGC CGGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTCAAGGGCTTCTACCCT TCCGATATCGCCGTGGAATGGGAGAGCAATGGCCAGCCTGAGAACAACTACAAGACAAC CCCTCCTGTGCTGGACAGCGACGGCTCATTCTTCCTGTACAGCAAGCTGACAGTGGACAA GTCCAGATGGCAGCAGGGCAACGTGTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAA CCACTACACCCAGAAGTCCCTGAGCCTGTCTCCTGGCAAG SEQ ID NO: 8, mAb4: Sacituzumab (anti TROP2 mAb) light chain GACATCCAGCTGACACAGAGCCCTAGCAGCCTGTCTGCCTCTGTGGGCGACAGAGTGTCC ATCACATGCAAGGCCAGCCAGGACGTGTCAATTGCCGTGGCCTGGTATCAGCAGAAGCCT GGCAAAGCCCCTAAGCTGCTGATCTACAGCGCCAGCTACAGATACACCGGCGTGCCCGAT AGATTTTCCGGCTCTGGCAGCGGCACCGACTTCACCCTGACCATATCTAGCCTGCAGCCT GAGGACTTCGCCGTGTACTACTGCCAGCAGCACTACATCACCCCTCTGACCTTTGGAGCC GGCACCAAGGTGGAAATCAAGCGGACAGTGGCCGCTCCTAGCGTGTTCATCTTTCCACCT AGCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGTGCCTGCTGAACAACTTCTAC CCCAGAGAAGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGAGCGGCAATAGCCA AGAGAGCGTGACCGAGCAGGACAGCAAGGACTCTACCTACTCTCTGAGCAGCACCCTGA CACTGAGCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAG GGCCTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAGTGC SEQ ID NO: 9, mAb5: Sacituzumab (anti TROP2 mAb) heavy chain with engineered S375C (EU numbering) CAGGTTCAGCTGCAGCAGTCTGGCAGCGAGCTGAAGAAACCTGGCGCCTCTGTGAAGGT GTCCTGCAAGGCCAGCGGCTACACCTTTACCAACTACGGCATGAACTGGGTCAAGCAGGC CCCTGGACAGGGCCTGAAATGGATGGGCTGGATCAACACCTACACCGGCGAGCCCACCT ACACAGACGACTTCAAGGGCAGATTCGCCTTCAGCCTGGACACCTCTGTGTCCACAGCCT ACCTGCAGATCAGCAGCCTGAAGGCCGATGATACCGCCGTGTACTTCTGTGCCAGAGGCG GCTTTGGCAGCAGCTACTGGTACTTCGATGTGTGGGGCCAGGGCAGCCTGGTCACAGTTA GCTCTGCCTCTACAAAGGGCCCCAGCGTTTTCCCACTGGCTCCTAGCAGCAAGAGCACAA GCGGAGGAACAGCTGCTCTGGGCTGCCTGGTCAAGGACTATTTCCCCGAGCCTGTGACCG TGTCCTGGAACTCTGGCGCTCTGACTTCTGGCGTGCACACCTTTCCAGCCGTGCTGCAAAG CAGCGGCCTGTACTCTCTGAGCAGCGTCGTGACAGTGCCAAGCTCTAGCCTGGGCACCCA GACCTACATCTGCAATGTGAACCACAAGCCTAGCAACACCAAGGTGGACAAGAAGGTGG AACCCAAGAGCTGCGACAAGACCCACACCTGTCCTCCATGTCCTGCTCCAGAACTGCTCG GCGGACCTTCCGTGTTTCTGTTCCCTCCAAAGCCTAAGGACACCCTGATGATCAGCAGAA CCCCTGAAGTGACCTGCGTGGTGGTGGATGTGTCCCACGAGGATCCCGAAGTGAAGTTCA ATTGGTACGTGGACGGCGTCGAGGTGCACAACGCCAAGACAAAGCCCAGAGAGGAACAG TACAACAGCACCTACAGAGTGGTGTCCGTGCTGACAGTGCTGCACCAGGATTGGCTGAAC GGCAAAGAGTACAAGTGCAAGGTGTCCAACAAGGCCCTGCCTGCTCCTATCGAGAAAAC CATCAGCAAGGCCAAGGGCCAGCCTAGAGAACCCCAGGTGTACACACTGCCTCCAAGCC GGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTCGTGAAGGGCTTCTACCCCT GCGACATTGCCGTGGAATGGGAGAGCAATGGACAGCCCGAGAACAACTACAAGACAACC CCTCCTGTGCTGGACAGCGACGGCTCATTCTTCCTGTACAGCAAGCTGACCGTGGACAAG TCCAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAA CCACTACACCCAGAAGTCCCTGTCTCTGAGCCCCGGCAAG SEQ ID NO: 10, mAb5: Sacituzumab (anti TROP2 mAb) light chain with engineered V110C (EU numbering) GACATCCAGCTGACACAGAGCCCTAGCAGCCTGTCTGCCTCTGTGGGCGACAGAGTGTCC ATCACATGCAAGGCCAGCCAGGACGTGTCAATTGCCGTGGCCTGGTATCAGCAGAAGCCT GGCAAAGCCCCTAAGCTGCTGATCTACAGCGCCAGCTACAGATACACCGGCGTGCCCGAT AGATTTTCCGGCTCTGGCAGCGGCACCGACTTCACCCTGACCATATCTAGCCTGCAGCCT GAGGACTTCGCCGTGTACTACTGCCAGCAGCACTACATCACCCCTCTGACCTTTGGAGCC GGCACCAAGGTGGAAATCAAGCGGACATGTGCTGCCCCTAGCGTGTTCATCTTCCCACCT TCCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGTGCCTGCTGAACAACTTCTAC CCCAGAGAAGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGAGCGGCAATAGCCA AGAGAGCGTGACCGAGCAGGACAGCAAGGACTCTACCTACTCTCTGAGCAGCACCCTGA CACTGAGCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAG GGCCTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAGTGC SEQ ID NO: 11, mAb6: Farletuzumab (anti FOLR1 mAb) heavy chain with engineered E152C and S375C (EU numbering) GAAGTGCAGCTGGTTGAATCTGGTGGCGGAGTGGTGCAGCCTGGCAGATCTCTGAGACTG AGCTGTAGCGCCAGCGGCTTCACCTTTTCTGGCTACGGCCTGAGCTGGGTCCGACAGGCT CCTGGAAAAGGCCTGGAATGGGTCGCCATGATCAGCAGCGGCGGCAGCTACACCTACTA CGCCGATTCTGTGAAGGGCAGATTCGCCATCAGCCGGGACAACGCCAAGAATACCCTGTT CCTGCAGATGGACAGCCTGCGGCCTGAAGATACCGGCGTGTACTTCTGTGCCAGACACGG CGACGACCCTGCTTGGTTTGCTTATTGGGGCCAGGGCACCCCTGTGACAGTGTCTAGCGC CTCTACAAAGGGCCCCAGCGTTTTCCCACTGGCTCCTAGCAGCAAGAGCACCTCTGGTGG AACAGCCGCTCTGGGCTGTCTGGTCAAGGACTACTTCCCCTGTCCAGTGACCGTGTCCTG GAATTCTGGCGCCCTGACATCTGGCGTGCACACCTTTCCAGCTGTGCTGCAGTCTAGCGG CCTGTACTCTCTGAGCAGCGTGGTCACAGTGCCAAGCTCTAGCCTGGGCACCCAGACCTA CATCTGCAATGTGAACCACAAGCCTAGCAACACCAAGGTGGACAAGAAGGTGGAACCCA AGAGCTGCGACAAGACCCACACCTGTCCTCCATGTCCTGCTCCAGAACTGCTCGGCGGAC CTTCCGTGTTTCTGTTCCCTCCAAAGCCTAAGGACACCCTGATGATCTCCAGAACACCCGA AGTGACCTGCGTGGTGGTGGATGTGTCTCACGAGGACCCTGAAGTGAAGTTCAATTGGTA CGTGGACGGCGTCGAGGTGCACAATGCCAAGACCAAGCCTAGAGAGGAACAGTACAACA GCACCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAAG AGTACAAGTGCAAGGTGTCCAACAAGGCCCTGCCTGCTCCTATCGAGAAAACCATCAGCA AGGCCAAGGGCCAGCCTAGGGAACCCCAGGTTTACACACTGCCTCCAAGCCGGGAAGAG ATGACCAAGAACCAGGTGTCCCTGACCTGCCTCGTGAAGGGCTTCTACCCCTGCGACATT GCCGTGGAATGGGAGAGCAATGGCCAGCCTGAGAACAACTACAAGACAACCCCTCCTGT GCTGGACTCCGACGGCTCATTCTTCCTGTACAGCAAGCTGACAGTGGACAAGTCCAGATG GCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTACA CCCAGAAGTCCCTGAGCCTGTCTCCTGGCAAG SEQ ID NO: 12, mAb6: Farletuzumab (anti FOLR1 mAb) light chain GACATCCAGCTGACACAGAGCCCTAGCAGCCTGTCTGCCTCTGTGGGCGACAGAGTGACC ATCACCTGTAGCGTGTCCAGCAGCATCAGCAGCAACAACCTGCACTGGTATCAGCAGAAG CCCGGCAAGGCCCCTAAGCCTTGGATCTACGGCACAAGCAATCTGGCCAGCGGCGTGCCA AGCAGATTTTCTGGCTCTGGCAGCGGCACCGACTACACCTTCACCATATCTAGCCTGCAG CCTGAGGATATCGCCACCTACTACTGCCAGCAGTGGTCTAGCTACCCCTACATGTACACC TTCGGCCAGGGCACCAAGGTGGAAATCAAGAGAACAGTGGCCGCTCCTAGCGTGTTCATC TTCCCACCTTCCGACGAGCAGCTGAAGTCTGGCACAGCCTCTGTCGTGTGCCTGCTGAAC AACTTCTACCCCAGAGAAGCCAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGAGCGG CAATAGCCAAGAGAGCGTGACCGAGCAGGACAGCAAGGACTCTACCTACTCTCTGAGCA GCACCCTGACACTGAGCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTG ACCCACCAGGGCCTTTCTAGCCCTGTGACCAAGAGCTTCAACCGGGGCGAGTGC Example 5.2 Expression and purification of monoclonal antibodies HEK293-E WCB cells (National Research Council Canada) were cultured to a density of 1.5x106cells / ml in 140 ml of CD293 medium supplemented with 4 mM L-Glutamine and 25 μg / ml G418. A day prior to transfection, the cell culture was centrifuged and washed with Freestyle 293 medium. The cells were resuspended in 200 ml of fresh Freestyle 293 medium at a concentration of 1x106cells / ml and transferred into a 1L spinner flask. On the day of transfection, 400 μl of Lipofectamine 2000 in 10 ml of OptiMEM medium was prepared and allowed to incubate at room temperature for 2-5 minutes. In parallel, 140 μg of the expression pTT5 plasmid encoding the light chain and 60 μg of the expression pTT5 plasmid encoding the heavy chain were diluted in 10 ml of OptiMEM medium. This mixture was combined with the Lipofectamine 2000 solution in OptiMEM medium. The resulting mixture was incubated for 5-10 minutes at room temperature and then added to the cell culture. After four hours, 200 ml of Freestyle 293 medium was added to the cells. The cells were subsequently cultured for 10-14 days while monitoring the cell number and viability. To maintain the culture, fresh Freestyle 293 medium was added multiple times. The medium volume on the day of harvest ranged from 800-1000 ml. Cells were separated by centrifugation, and EDTA-free protease inhibitors (Roche) were added to the medium. This medium was then dialyzed against PBS buffer at pH 7.4. The medium containing the monoclonal antibody (mAb) was loaded onto a HiPrep rProtein A column (5 ml, GE Healthcare) pre- equilibrated with PBS at pH 7.4. The column was washed with 10 column volumes (CV) of PBS buffer at pH 7.4, and the mAb was eluted using 0.1 M citrate buffer at pH 3.0. Following pH adjustment to a range of 7-8 using 1 M Tris at pH 8.0, the mAbs were dialyzed against PBS buffer at pH 7.4, sterile- filtered, and stored at -80°C SEQ ID NO: 13, mAb1: Trastuzumab (anti Her2 mAb) heavy chain with engineered E152C and S375C (EU numbering) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYAD SVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK SEQ ID NO: 14, mAb1: Trastuzumab (anti Her2 mAb) light chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 15, mAb2: Trastuzumab (anti Her2 mAb) heavy chain EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYAD SVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK SEQ ID NO: 16, mAb2: Trastuzumab (anti Her2 mAb) light chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 17, mAb3: Trastuzumab (anti Her2 mAb) heavy chain with engineered S375C (EU numbering) EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYAD SVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK SEQ ID NO: 18, mAb3: Trastuzumab (anti Her2 mAb) light chain with engineered V110C (EU numbering) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTCAAPSVFIFPPSDEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSXPVTKSFNRGEC SEQ ID NO: 19, mAb4: Sacituzumab (anti TROP2 mAb) heavy chain QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPT YTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK SEQ ID NO: 20, mAb4: Sacituzumab (anti TROP2 mAb) light chain DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFS GSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAAPSVFIFPPSDEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 21, mAb5: Sacituzumab (anti TROP2 mAb) heavy chain with engineered S375C (EU numbering) QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPT YTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK SEQ ID NO: 22, mAb5: Sacituzumab (anti TROP2 mAb) light chain with engineered V110C (EU numbering) DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFS GSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTCAAPSVFIFPPSDEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 23, mAb6: Farletuzumab (anti FOLR1 mAb) heavy chain with engineered E152C and S375C (EU numbering) EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYYA DSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCARHGDDPAWFAYWGQGTPVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK SEQ ID NO: 24, mAb6: Farletuzumab (anti FOLR1 mAb) light chain DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVPSRFS GSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 25, isotype mAb: Libivirumab (anti HBsAg mAb) - heavy chain with engineered E152C and S375C (EU numbering) QVQLVESGGGVVRPGRSLRLSCAASGFAFSDYSINWVRQAPGKGLEWVAIISYDGRITYYRDS VKGRFTISRDDSKNTLYLQMNSLRTEDTAVYYCARQYYDFWSGSSVGRNYDGMDVWGLGT TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 26, isotype mAb: Libivirumab (anti HBsAg mAb) - light chain DIVMTQSPLSLSVTPGEPASISCRSSQSLLHRSGNNYLDWYLQKPGHSPQLLIYVGSNRASGVP DRFSGSGSGTEYTLKISRVEAEDVGVYYCMQALQTPRTFGQGTKLEIKRTVAAPSVFIFPPSDE QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKAD YEKHKVYACEVTHQGLSSPVTKSFNRGEC Example 5.3 Preparation of antibody CDN conjugates involving anti-Her2 (mAb1, mAb3), anti- TROP2 (mAb5), anti-FOLR1 mAb (mAb6) and anti-HBsAg mAb (isotype mAb) with engineered Cysteine (Cys) mutations Because engineered Cys residues in antibodies expressed in mammalian cells are modified by adducts (disulfides) such as glutathione (GSH) and / or cysteine during biosynthesis, the modified Cys as initially expressed are unreactive to thiol reactive reagents with maleimido group. To conjugate engineered Cys residues, glutathione or cysteine adducts need to be removed by reducing disulfides, which generally entails reducing all disulfides in the antibody. Monoclonal antibody (7-10 mg / ml) in PBS buffer containing 2mM EDTA were reduced overnight with 150-fold molar excess of DTT. Next day, the antibody was diluted with 15 volumes of 20 mM succinate buffer pH 5 and DTT was removed on cation exchanger GE HiTrap SP HP column (5mL) equilibrated in 20 mM succinate buffer pH 5. The column was washed with 10 column volumes of equilibration buffer and antibody was eluted with 50 mM Tris pH 7.5 containing 0.15 M NaCl. Antibody was re-oxidized by adding 15 equivalents of dehydroascorbic acid (DHAA) with re-oxidation being monitored by LC on Agilent, PLRP-S 1000A 8µM 150x2.1mm column. The antibody was loaded on the size exclusion GE HiLoad 26 / 60 Superdex 200 pg column equilibrated in PBS with 2 mM EDTA buffer to remove DHAA. Reduced-oxidized mAb were next incubated with 8 molar protein equivalents of a CDN conjugate for 3 hours at room temperature. The conjugation was quenched by adding 8 equivalents of Cys and ADC was further purified using SEC Superdex 200 Increase 10 / 300 GL equilibrated in PBS buffer. Antibody CDN conjugates were profiled by MS and analytical SEC as described below. Drug antibody ratio (DAR) ranged between 3.5 to 3.9. Example 5.4 Generation of anti-HER2 and anti-TROP2 antibody CDN conjugates through partial reduction of native disulfide bonds of non-engineered anti-HER2 (mAb2) and anti-TROP2 (mAb4) monoclonal antibodies The compounds of the invention can also be conjugated to native cysteine residues of non-engineered antibodies using a procedure that involves partial reduction of the antibodies (Doronina, S. O. et al„ Nat. Biotechnol.21, 778-784, 2003). Interchain disulfides bonds of anti-HER2 mAb2 and anti-TROP2 mAb4 (at a concentration of 7-10 mg / ml) were first partially reduced in PBS pH 7.4 containing 2 mM EDTA by adding 2-8 equivalents of TCEP and incubating the mixture at 37°C for 2 hours. Next, the antibody reacted for two hours at RT with 8 equivalents of a CDN-conjugate. The conjugation was quenched with 8 equivalents of Cys and ADC was purified using SEC Superdex 200 Increase 10 / 300 GL equilibrated in PBS buffer. Antibody CDN conjugates were profiled by MS and analytical SEC as described below. Drug antibody ratios for different ADC are shown in Tables 18 and 19. Example 5.5 Characterization of the anti-HER2, anti-TROP2, anti-FOLR1 and anti-HBsAg antibody CDN-conjugates Antibody CDN-conjugates were analyzed to determine the extent of conjugation. A compound-to- antibody ratio was extrapolated from LC-MS data for reduced samples. LC-MS allows quantitation of the average number of molecules of linker-payload attached to an antibody in a conjugate sample. Mass spectral data enables identification of the component species in the mixture, e.g., LC, LC+1, LC+2, HC, HC+1, HC+2, etc. From the average loading on the LC and HC chains, the average compound to antibody ratio can be calculated for an antibody conjugate. A compound-to-antibody ratio for a given conjugate sample represents the average number of compound (linker-payload) molecules attached to a tetrameric antibody containing two light chains and two heavy chains. The samples were reduced with 40 mM TCEP or 5.5 mM DTT, injected onto a MassPREP Micro Desalting column (20 μm, 5-mm by 2.1-mm ID, Waters) equilibrated in 0.1% formic acid (FA) in H2O and eluted by a fast gradient (4min) to 0.1% FA in acetonitrile. The separation was carried out by AQUITY UPLC I-Class system (Waters) and was on-line coupled to Mass Spectrometer Synapt G2 (Waters) to acquire mass spectra using electrospray ionization in positive mode. The TOF mass range was set from m / z 500 to 4000. The raw spectrum was subtracted and deconvoluted (MaxEnt 1, Waters) to produce the final spectrum. Conjugates were profiled using analytical size-exclusion chromatography on Superdex 200 equilibrated in PBS pH7.4; aggregation was analyzed based on analytical size exclusion chromatography. Example 6 In vivo testing of anti-HER2 mAb1 conjugated with compounds 3.4 or 3.11 in Her2 expressing HCC1954 breast tumor xenograft model Methods Compounds 3.4 and 3.11 were attached to engineered C152 and C375 on the heavy chain of anti-Her2 mAb1. For in vivo testing in the Her2 expressing HCC1954 breast cancer xenograft mouse model, female SCID-beige mice at 8 to 12 weeks of age (purchased from Charles River Lab) were used for implantation. HCC1954 cells (obtained from ATCC) were cultured in RPMI medium supplemented with 10% fetal bovine serum at 37°C in a humidified incubator with 5% CO2.On the day of implantation, 1 x 107HCC1954 cells were re-suspended in 100^L RPMI1640 serum free media containing 50% Matrigel and implanted subcutaneously in the right flank. After implant, tumors were measured by caliper and mice were weighed two times per week once tumors were palpable. Tumor volumes were calculated from caliper measurements using formula (L x W2) / 2. Animals were pair matched when tumor reached volume 100 - 150 mm³ (designated as day 1). Two i.v. injections were performed on day 1 and 8 (D1 and D8) of 5mg / kg of anti-Her2 mAb1-3.4 (DAR 3.9), 5mg / kg mAb1-3.11 (DAR 3.9), 5mg / kg isotype mAb-3.4 (DAR 3.9), 5mg / kg anti-Her2 mAb1 or PBS vehicle. Results HCC1954 breast tumor xenograft mice were treated intravenously with two doses (on day one and eight) of anti-HER2 mAb1-3.4 and mAb1-3.11 conjugate, unconjugated mAb1, and isotype mAb-3.4 (6 mice per group). Treatment with anti-HER2 mAb1-3.4 led to complete regression of human HCC1954 xenograft tumors (Fig.1). Tumor regression was not observed in mice treated with isotype control mAb- 3.4 or un-conjugated mAb1 (Fig.1). Surprisingly, anti-HER2 mAb1-3.11 exhibited only a partial tumor growth inhibition even though the payload CDN 2.3 present in compound 3.11 had similar potency in STING 293 digitonin reporter assay as payload CDN 2.2 present in compound 3.4 (Table 17). The treatments were well tolerated by all animals. These data demonstrate unexpected advantage of CDN payload 2.2 over 2.3 and its ability to induce tumor regression in HER2-expressing HCC1954 breast tumor xenografts when conjugated to anti- HER2 mAb1 using compound 3.4. Notably, the isotype control mAb-3.4 showed no activity, underscoring the specificity of the treatment. Example 7 Effect of intratumoral injection of the compound 2.2 on tumor growth, induction of tumor specific CD8 T cells and immunological memory The CT26 mouse colon carcinoma cell line was obtained from American Type Culture Collection (ATCC®, CRL-2638). The cells were cultured in RPMI-1640 medium containing 10% fetal bovine serum, 2 mM glutamine, 100 units / mL penicillin G sodium, and 100 μg / mL streptomycin sulfate at 37oC in a humidified incubator with 5% CO2. On the day of tumor implantation in ten-week-old female BALB / c mice (Charles River Laboratories), CT26 cells harvested during the exponential growth phase were resuspended in phosphate-buffered saline (PBS) at a concentration of 1 x 107cells / mL. Tumors were initiated by subcutaneous implantation of 1 x 106CT26 cells (in a 0.1 mL suspension) into the right flank of each test animal. Tumor dimensions were measured in two directions, and tumor volumes were calculated using the formula (L x W2) / 2. Animals were pair matched when tumor reached volume 100 - 150 mm³ (designated as day 1) and injected intratumorally (i.t.) on day 1, 4 and 8 with 5mg / kg or 1.5mg / kg Compound 2.2 or PBS in total volume 20 µL. The induction of tumor specific AH1+ CD8 T cells was monitored in response to Compound 2.2 treatment. Blood immune cells were collected on day 14 and red blood cells were lysed using red blood cell lysis buffer. Immune cells were immunophenotyped using viability dye (Zombie NIR Fixable Viability Kit, BioLegend) and monoclonal antibodies: BUV395 rat anti-mouse CD19, BUV395 hamster anti-mouse CD49b, APC hamster anti-mouse CD3, BV605 rat anti-mouse CD4, BV510 rat anti-mouse CD8, (all BD Biosciences). Specific staining using MHC-I dextramer: PE labelled AH1 peptide (SPSYVYHQF, Immudex) was performed according to the manufacturer’s recommendation. Specific and control samples of unstained cells, positive control for dead cells (cells in PBS incubated for 10 min at 65 °C and further stained with a live / dead marker), fluorescence minus one (FMO) and isotype controls (ISO) were prepared. Samples were measured immediately without a fixation step in a single tube format using BD LSRFortessa flow cytometer (BD Biosciences) in 250 µl of FC buffer (PBS containing 5% FBS). Data was acquired using FACS Diva software (version 8.0.1, BD Biosciences). Debris was excluded by forward and side scatter gating followed by doublet and dead cell exclusion. The population of interest was gated as AH1+ CD8+ T cells, specifically CD19- CD49b- CD3+ CD4- CD8+ AH1+ cells. The data were analyzed using FlowJo software (version 10, BD Biosciences) and expressed as a frequency (%) of parent population, i.e. CD3+ T cells. Induction of antitumoral immunologic memory was monitored using ten animals from above mentioned 1.5mg / kg CT26 efficacy study which were tumor free on day 65. The animals were split equally into two groups (five animals per group) and treated intraperitoneally with 0.4 mL (250 ^g / mL in PBS) of isotype mAb (BXC-BP0090, BioXCell) or anti CD8 T cell mAb (BXC-BP0061, BioXCell) four and three days before and three days after 1 x 106CT26 cells (in a 0.1 mL suspension) were implanted into the left flank of animals (day when cell were implanted is designated as day 1). Efficiency of CD8 T cell depletion was monitored by flow-cytometry on day 3 post first i.p. of mAbs. In parallel, naïve Balb / c mice were implanted with the same number of cells into the left flank. Tumors were measured in two dimensions and tumor volumes were calculated from caliper measurements using formula (L x W2) / 2 to monitor growth. Results Twelve and ten out twelve tumor bearing animals treated intratumorally with 5mg / kg or 1.5mg / kg Compound 2.2 were tumor free on day 65 post first application of the compound (Fig 2). This contrasted with all animals treated with vehicle succumbing to the disease by day 40. Animals treated with Compound 2.2 also had statistically significantly increased frequency of tumor specific CD8 T cell recognizing AH1 peptide presented on MHC-1 compared to the vehicle arm (Fig 2). Finally, when the animals previously cured in the efficacy study were rechallenged with CT26 cells, they rejected the implants if they were pretreated with the isotype mAb. Conversely, the kinetics of CT26 tumor growth in the cured animals in which CD8 T-cells were depleted were comparable to that of naive animals (Fig. 2). This data indicated that animals cured with Compound 2.2 developed CD8 T cell dependent adaptive antitumoral immunity. All together the presented data show that Compound 2.2 can induce robust antitumoral effect and antitumoral adaptive immunity in vivo when applied i.t. Example 8 In vitro and in vivo stability of antibody-CDN conjugates In vitro plasma stability of ADC was performed by spiking mouse plasma with antibody-CDN conjugates (final concentration 100µg / mL). Samples were incubated in a 37°C incubator with 5% CO2, aliquots were taken at various time points and stored frozen for analysis. Pharmacokinetics and pharmacodynamics of the antibody-CDN conjugates were studied following i.v. injection of 1 to 5 mg / kg ADCs into Balb / c, SCID Beige or CD1 mice. Serum samples were taken at various time points and stored frozen for analysis. Plasma levels of cytokines were determined using ProcartaPlex Immunoassays following manufacture’s protocol and measured on MagPix instrument. The total level of the human antibodies or antibody conjugates in plasma samples was measured by immunoassays. The capture was performed with F(ab')2-Goat anti-Human IgG Fc (Invitrogen cat # A24478) and detection with goat anti Human IgG F(ab) FITC (Invitrogen cat # 31628). Payload CDN 2.2 retention on mAbs was studied by LC-MS. Briefly, 25µL of plasma samples were incubated with biotinylated anti-human Fcγ fragment mAb (final concetration 0.18mg / mL, Jackson ImmunoResearch cat # 109-065-098) for 30 min and then mixed with 30 ^L Dynabead MyOne Streptavidin T1 (Invitrogen cat # 65604D) and 70 ^L PBS. After 1 hour incubation, the beads were separated on a magnet, washed with PBS containing 0.05% Tween20, PBS and water, and ADCs were eluted in the presence of 0.2% of formic acid in water. Eluate was neutralized by adding ammonium formate (400mM final concentration) and ADCs were reduced with TCEP (40mM final concentration) for 30 minutes at room temperature. Samples were then measured by LC-MS and analyzed for compound-to-antibody ratio as described above. Pharmacokinetics of Compound 2.2 applied I.V. at dose 5mg / kg was determined in Balb / c mice. Plasma samples were precipitated with methanol (final concetration 70%) spiked with internal standard, the precipited proteins were removed by centrigugation and supernatant was evaporated. The analytes were dissolved in 100 µL of 10 mM CH3COONH4by vortexing for 5 min. Compound 2.2 along with the corresponding internal standard were separated and detected using a liquid chromatograph Exion LC AD with tandem mass spectrometer QTrap 6500+ (both Sciex) equipped with a separation column Acquity BEH C181.7 µm, 50 × 2.1 mm, as well as a guard column 1.7 µm C18, 5 × 2.1 mm (both Waters). The mobile phase (A) used for separation consisted of 10 mM CH3COONH4in deionized water, while mobile phase (B) was composed of 10 mM CH3COONH4in methanol. The separation was carried out by using the following gradient: 0 – 2 min of 5% B, 2 – 10 min of 90% B, 10 – 15 min of 90% B, 15 – 15.1 min of 5% B, and 15.1 – 20 min of 5% B with a flow rate of 0.2 mL / min. Analytes were monitored through their specific multiple reaction monitoring (MRM) transitions by utilizing electrospray ionization (ESI) in a positive mode with the following parameters: 50 msec dwell time, entrance potential 10 V, ion source temperature 350°C, ion spray voltage 5.5 kV, curtain gas (40 psi), GS1 gas (50 psi), and GS2 gas (50 psi). Quantification of Compound 2.2 was conducted using a weighted calibration curve (1 / x²) with a structurally similar internal standard. Results Various antibody CDN conjugates were prepared by attaching compounds to anti Her2 mAb2 via interchain cysteines as described above and their retention on mAb2 was assessed in mouse plasma in vitro. Anti Her2 mAb2-3.4, mAb2-3.6, mAb2-3.5 had moderate retention of the CDN warhead compound 2.2 (T1 / 27-8 days). Importantly, compound 3.19, in which the linker is attached to the warhead CDN 2.2 via sulfur, was quite unstable (T1 / 24 days) when attached to mAb2. On the contrary, attachment of compounds 3.3, 3.7, and 3.8 to anti Her2 mAb2 was stable over period up to 15 days (Fig. 3, Table 18). In conclusion, it is disadvantegous to perfom attachment of the warhead CDN 2.2 and the linker via thiophosphate group. Table 18 Compound Monoclonal Drug Antibody HCC1954 Her2+ 293T Mouse plasma antibody ratio (DAR) IP10 EC50EC50(μM) T½(days) (μM) 3.4 anti Her2 mA2 4.5 0.008 0.019 7 3.5 anti Her2 mA2 4.9 0.018 0.02 8 3.6 anti Her2 mA2 5.6 0.05 0.02 7 3.3 anti Her2 mA2 3.7 0.009 0.013 >15 3.7 anti Her2 mA2 4 0.007 0.014 >15 3.8 anti Her2 mA2 4 0.012 0.018 >15 3.19 anti Her2 mA2 2.5 0.002 0.002 4 None anti Her2 mA2 - inactive inactive - 3.4 isotype mAb 4.0 >1 >1 - 3.3 isotype mAb 4.0 >1 >1 - Compounds 3.3, 3.13, 3.16, 3.17, and 3.18 were also attached to engineered light chain V110C and heavy chain S375C cysteines of anti TROP2 targeted mAb5. As shown in Table 19 and Figure 4, with exemption of compound 3.13 all compounds had an excellent retention on anti-TROP2 mAb5. Unexpectedly, substitution of para-amino benzyl group of compound 3.13 with 2-F, 2-Cl, and 3-F groups resulted in improved plasma stability of antibody-CDN conjugates (compounds 3.16, 3.17, and 3.18). Table 19 Compound Monoclonal Drug Antibody HCC1954 TROP2+ Mouse plasma antibody Ratio IP10 EC50293T T½(days) (μM) EC50(μM) 3.3 anti TROP2 3.7 0.008 0.008 >15 mA5 3.13 anti TROP2 3.3 0.002 0.003 9.6 mA5 3.16 anti TROP2 3.3 0.005 0.004 >15 mA5 3.17 anti TROP2 3.6 0.008 0.003 >15 mA5 3.18 anti TROP2 3.6 0.006 0.002 >15 mA5 None anti TROP2 - inactive inactive - mA5 3.3 isotype mAb 3.8 >1 >1 - 3.13 isotype mAb 3.8 >1 >1 - 2.2 Warhead CDN - 1.7 0.7 - In vivo studies on payload CDN retention (Compound 2.2) were conducted in SCID Beige mice for anti-HER2 mAb2-3.4 (DAR 4.6) and anti-HER2 mAb2-3.3 (DAR 4.5) and in CD-1 nude mice for anti- TROP2 mAb5-3.3 (DAR 3.8) and anti-TROP2 mAb5-3.13 (DAR 3.8). These animals received a single intravenous bolus injection of antibody-CDN conjugates at doses of 1.5 mg / kg (mAb5-3.13) and 5 mg / kg (mAb2-3.4, mAb2-3.3, mAb5-3.3), respectively. Blood samples were collected from the treated animals at various time points, and plasma was stored frozen for subsequent analysis. Warhead CDN 2.2 retention on anti-HER2 mAb2 and anti-TROP2 mAb5 was quantified using immunoprecipitation and mass spectrometry analysis, as described above. The half-life for the warhead retention with compound 3.3 attached to both monoclonal antibodies exceeded 10 days. In line with impaired stability observed in mouse plasma in vitro (Table 18 and 19), compound 3.4 attached to anti-HER2 mAb2 had a half-life of approximately 3.7 days, while compound 3.13 conjugated to anti-TROP2 mAb5 exhibited a half-life of approximately 12 days (Fig. 5). Lastly, we evaluated the pharmacokinetics of Compound 2.2 in Balb / c mice treated with 5mg / kg i.v (Fig 5). Compound 2.2 exhibited efficient clearance with a half-life of less than 10 minutes, highlighting the advantage of conjugating Compound 2.2 to a monoclonal antibody via a linker for improved pharmacokinetics. Example 9 Activation of the STING pathway in HCC1954 and 293T STING reporter cells with antibody-CDN conjugates HCC1954 and 293T reporter cells were cultured as previously described. HCC1954 cells, which naturally express both Her2 and TROP2, were seeded into collagen-coated 96-well plates at a density of 0.5x106cells / ml (100 µl / well) in RPMI medium supplemented with 10% FBS and Penicillin / Streptomycin. The following day, the medium was completely removed, and serial dilutions of mAb2-CDN and mAb5-CDN conjugates in medium were added to the wells. Levels of the STING- dependent cytokine IP10 (CXCL10) induction were determined in the medium using ProcartaPlex Immunoassays after 24 hours of incubation following the manufacturer's protocol and measured on a MagPix instrument. GraphPad Prism (La Jolla, USA) was utilized to calculate the 50% effective concentration (EC50) from a 6-point dose-response curve. Nonlinear regression curve fitting was applied for EC50value calculations. The EC50value represents the concentration of the payload CDN 2.2 conjugated to anti-Her2 mAb2 or anti-TROP2 mAb5 that results in half-maximal levels of IP-10. Twenty million 293T WT STING reporter cells were seeded into two T150 flasks, each containing 30 mL of DMEM with high glucose supplemented with 10% heat-inactivated FBS. One flask was designated for transfected cells, and the other served as a non-transfected control. After 24 hours, the cell culture medium was replaced with 27 mL of fresh media. For the transfection process, a transfection mixture was prepared for each T150 flask. In one tube, 1500 μL of OptiMedium was combined with 40 μg of Her2 or TROP2 expression plasmid and 45 μL of Reagent P3000. In another tube, 1500 μL of OptiMedium was mixed with 45 μL of Lipofectamine 3000. The contents of these two tubes were then combined, and after a 10-minute incubation, the mixture was added to the cells. After 24 hours, the cell culture medium was aspirated, and the cells were washed with PBS and detached using trypsin-EDTA. Following trypsin inactivation with medium, the cells were centrifuged at 200g for 5 minutes. A total of 0.1 million cells were collected for control flow cytometry to confirm TROP2 or Her2 expression. For the antibody-CDN conjugate experiments, 25,000 cells in 50 μL were seeded into half-area 96-well plates coated with poly-lysine-D and incubated overnight. The next morning, the cell culture medium was aspirated, and the Her2 or TROP2 expressing cells were treated with 30 μL of serially diluted anti- Her2 mAb2-CDN-conjugates or anti-TROP2 mAb5-CDN conjugates, respectively. Furthermore, cells were also treated with compound 2.2, isotype mAb-CDN conjugates, or unconjugated mAb2 or mAb5. After 7-hour incubation, 20 μL of medium and 30 μL of BrightGlo per well were added, and the plates were placed on an orbital shaker (500 RPM, room temperature) for 5 minutes. A 50 μL mixture was transferred to white 96-well plates, and luminescence was measured using a TECAN reader. EC50values were calculated from an 8-point dose-response curve using GraphPad Prism (La Jolla, USA) with nonlinear regression curve fitting. The EC50represents the concentration of the payload CDN 2.2 conjugated to anti-Her2 mAb2 or anti-TROP2 mAb5 that results in half-maximal levels of luminescence. Results As evident from Table 18 and 19, the anti-HER2 and anti-TROP2 antibody-CDN conjugates effectively elicited the expression of the STING-dependent cytokine IP-10 in HCC1954 cells. Notably, the attachment of the warhead CDN compound 2.2 to both mAb2 and mAb5 resulted in a nearly three- order-of-magnitude reduction in the EC50values compared to cells treated with free compound 2.2. Similarly, in 293T STING reporter cells transiently expressing either TROP2 or HER2, mAb2 and mAb5 CDN conjugates exhibited significantly lower EC50values than the warhead CDN compound 2.2. It's important to emphasize that isotype ADCs or unconjugated mAb2 or mAb5 failed to induce IP-10 or luciferase in these assays (Table 18 and 19). In summary, these findings strongly underscore the advantages of conjugating the disclosed CDN compound 2.2 to tumor-targeted monoclonal antibodies. Moreover, they demonstrate that compound 2.2 and its conjugates, when attached to tumor-targeted mAbs, induce a STING adaptor protein- dependent response, and stimulate the production of STING-dependent cytokine IP10. Example 10 Comparative analysis of in vivo plasma cytokine induction by anti-Her2 mAb2 conjugated with compound 3.3 at the inter-chain Cys sites vs. anti-HER2 mAb3 conjugated with compound 3.3 at engineered light chain C110 and heavy chain C375 sites Compound 3.3 was conjugated to the engineered light chain C110 and heavy chain C375 of anti-Her2 mAb (mAb3) as described above (mAb3-3.3). Furthermore, the compound was also conjugated to anti- Her2 mAb (mAb2) via inter-chain Cys (mAb2-3.3). A single intravenous injection of 5 mg / kg mAb2- 3.3 (DAR 3.8) and 5 mg / kg mAb3-3.3 (DAR 3.6) was administered to Balb / C mice via tail vein injection. Blood samples were collected from the injected animals at 2, 4, 8, and 20 hours post-injection, and plasma cytokines were measured using multiplex ELISA (Luminex). Results Mice injected with anti-Her2 mAb2-3.3, in which conjugation was done via inter-chain Cys, induced higher levels of plasma cytokines (Fig. 6). Surprisingly, the peak levels of cytokines induced by anti- Her2 mAb3-3.3 in which conjugation was performed to engineered Cys were significantly lower. It can be advantageous to have an antibody-CDN conjugate that induces lower plasma levels of cytokines, as high levels of circulating cytokines can potentially lead to a severe inflammatory response, causing damage to tissues and organs, and possibly leading to multiple organ failure and death (Tisoncik et al; Microbiol. Mol. Biol. Rev.2012, 76:16) Therefore, it is beneficial to conjugate warhead CDN compound 2.2 to the engineered light chain 110 and heavy chain 375 cysteines. Example 11 Comparative analysis of in vivo plasma cytokine induction by anti-TROP2 mAb4 conjugated with Compound 3.3 at the inter-chain Cys sites vs. anti-TROP2 mAb5 conjugated with Compound 3.3 at engineered light chain C110 and heavy chain C375 sites Compound 3.3 was conjugated to anti-TROP2 mAb4 via inter-chain Cys and to the engineered light chain C110 and heavy chain C375 of anti-TROP2 mAb5, as described above. A single intravenous injection of 5mg / kg anti-TROP2 mAb4-3.3 (DAR 3.8), 5mg / kg anti-TROP2 mAb5-3.3 (DAR 3.8), 5mg / kg unconjugated anti-TROP2 mAb5, and 1.7mg / kg warhead CDN compound 2.2 were administered to Balb / C mice via tail vein injection. Blood samples were collected from the injected animals at 2, 4, 8, and 20 hours post-injection, and plasma cytokines were measured using multiplex ELISA (Luminex). Results Mice injected with anti-TROP2 mAb4-3.3, where conjugation was done via inter-chain Cys, induced high levels of plasma cytokines (Fig. 7). Similarly, the payload CDN compound 2.2, injected at a dose that only weakly inhibited tumor growth (see Compound 2.2, Fig. 8), also induced high plasma levels of cytokines (Fig. 7). In contrast, the peak levels of cytokines induced by anti-TROP2 mAb5-3.3, with conjugation performed to engineered Cys, were significantly lower. Having an antibody-CDN conjugate that induces lower plasma levels of cytokines can be advantageous, as high levels of circulating cytokines can potentially lead to a severe inflammatory response, causing damage to tissues and organs, and possibly leading to multiple organ failure and death (Tisoncik et al; Microbiol. Mol. Biol. Rev.2012, 76:16). Therefore, it is beneficial to conjugate warhead CDN 2.2 to the engineered light chain 110 and heavy chain 375 cysteines. Example 12 Activity of anti-HER2 mAb3 conjugated with Compound 3.3 to light chain C110 and heavy chain C375 in Her2 expressing HCC1954 breast tumor xenograft model Compound 3.3 was conjugated to the engineered light chain C110 and heavy chain C375 of anti-Her2 mAb (mAb3), as described earlier. An animal study was conducted using a Her2-expressing HCC1954 breast cancer xenograft mouse model as described above. Animals were pair-matched when the tumor reached a volume of 100 - 150 mm³ (designated as day 1). For in vivo testing of the anti-Her2 mAb3- 3.3 (DAR 3.8), single intravenous doses of 2.5, 1, and 0.3 mg / kg were administered on day 1. Unconjugated mAb3 and isotype mAb-3.3 (DAR 3.8) were administered at a single intravenous dose of 2.5 mg / kg. The payload CDN compound 2.2 was tested using a single intravenous dose of 1.7 mg / kg. Results HCC1954 breast tumor xenograft mice treated intravenously with anti-HER2 mAb3-3.3, at doses of 2.5 and 1 mg / kg, achieved complete regression of HCC1954 tumors (Fig.8). Tumor growth inhibition was observed when a dose of 0.3 mg / kg of anti-Her2 mAb3-3.3 was used. In contrast, tumor regression was not observed in mice treated with 2.5 mg / kg of unconjugated mAb3 or isotype mAb-3.3 ADC (Fig. 8). Payload CDN compound 2.2, injected at a 40x higher dose than in the 2.5 mg / kg anti-Her2 mAb3-3.3 treatment, only triggered tumor growth inhibition. These data demonstrate that that conjugation of the warhead CDN 2.2 to tumor targeted mAb3 is highly advantegous and that tumor regression in HER2-expressing HCC1954 breast tumor xenografts can be achieved through treatment with anti-HER2 mAb3-3.3 when conjugation is performed with the light chain C110 and heavy chain C375. Example 13 Activity of anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 in TROP2 expressing HCC1954 breast tumor xenograft model Compound 3.3 was conjugated to the engineered light chain C110 and heavy chain C375 of anti-TROP2 mAb (mAb5), following the previously described method. An animal study was conducted using a TROP2-expressing HCC1954 breast cancer xenograft mouse model, with animals being pair-matched when the tumor reached a volume of 100 - 150 mm³ (designated as day 1). They were then injected with a single intravenous dose of 2.5 or 1 mg / kg of the anti-TROP2 mAb5-3.3 conjugate (DAR 3.6), 2.5 mg / kg of isotype mAb-3.3 conjugate (DAR 3.8), 5 mg / kg of mAb5, or PBS vehicle. Results As depicted in Fig. 9, the administration of 2.5 mg / kg of anti-TROP2 mAb5-3.3 resulted in tumor regression, and treatment with 1 mg / kg of anti-TROP2 mAb5-3.3 led to the tumor growth inhibition of human breast cancer tumors expressing TROP2. In contrast, unconjugated anti-TROP2 mAb5 and isotype mAb-3.3 had no discernible effect on tumor growth. These results demonstrate that tumor regression can be achieved in TROP2-expressing HCC1954 breast tumor xenografts through treatment with anti-TROP2 mAb5-VAP-2218 when conjugation is executed with light chain C110 and heavy chain C375. Example 14 Activity of anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 in TROP2 expressing Bx-PC3 prostate tumor xenograft model Compound 3.3 was conjugated to the engineered light chain C110 and heavy chain C375 of anti-TROP2 mAb (mAb5), following the previously described method. The Bx-PC3 human pancreatic carcinoma cell line was obtained from American Type Culture Collection (ATCC®, CRL-1687™) and maintained in RPMI-1640 medium containing 10% fetal bovine serum, 2 mM glutamine, 100 units / mL penicillin G sodium, 100 μg / mL streptomycin sulfate, 25 μg / mL gentamicin, 10 mM HEPES, 0.075% sodium bicarbonate, and 1 mM sodium pyruvate. The tumor cells were grown in tissue culture flasks in a humidified incubator set at 37oC and an atmosphere of 5% CO2and 95% air. On the day of tumor implantation to female CB.17 SCID mice (Charles River Laboratories), the Bx-PC3 cells were harvested during the exponential growth phase and resuspended in phosphate-buffered saline (PBS) and 50% Matrigel™ (BD Biosciences) mixture at 1 x 108cells / mL concentration. Tumors were initiated by subcutaneous implantation of 1 x 107Bx-PC3 cells (in a 0.1 mL suspension) into the right flank of each test animal. Tumors were measured in two dimensions and tumor volumes were calculated from caliper measurements using formula (L x W2) / 2. Animals were pair matched when tumor reached volume 100 - 150 mm³ (designated as day 1) and injected with a single I.V. dose of 5mg / kg of anti-TROP2 mAb5- 3.3 conjugate (DAR 3.6), 5mg / kg isotype mAb-3.3 conjugate (DAR 3.8), 5mg / kg mAb5 or PBS vehicle on day 1. Results As illustrated in Fig. 10, the administration of 5 mg / kg of anti-TROP2 mAb5-3.3 resulted in tumor regressions, while unconjugated anti-TROP2 mAb5 and isotype mAb-3.3 did not exhibit any impact on tumor growth. These findings indicate that tumor regression can be attained in TROP2-expressing Bx-PC3 pancreas tumor xenografts through treatment with anti-TROP2 mAb5-3.3 when conjugation is carried out using light chain C110 and heavy chain C375. Example 15 Activity of anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 in TROP2 expressing Colo205 colon tumor xenograft model Compound 3.3 was conjugated to the engineered light chain C110 and heavy chain C375 of anti-TROP2 mAb (mAb5), following the previously described method. The COLO-205 human colon adenocarcinoma cell line was obtained from American Type Culture Collection (ATCC®, CCL-222™) and maintained in RPMI-1640 medium containing 10% fetal bovine serum, 2 mM glutamine, 10 mM HEPES, 1 mM sodium pyruvate and 4.5g / L glucose. The tumor cells were grown in tissue culture flasks in a humidified incubator set at 37oC and an atmosphere of 5% CO2and 95% air. On the day of tumor implantation, the COLO205 cells were harvested during the exponential growth phase and resuspended in 50% Geltrex™ (ThermoFisher; A14132-02) prepared in Dulbecco’s Phosphate - Buffered Saline (DPBS) at 6 x 107cells / mL concentration. Tumors were initiated by subcutaneous implantation of 3 x 106COLO205 cells (in a 0.1 mL suspension) into the right flank of female CD-1 nude mice (CR - Crl:CD1-Foxn1nu). Tumors were measured in two dimensions and tumor volumes were calculated using formula (L x W2) / 2. Animals were pair matched when tumor volumes reached 80-140 mm3(designated as day 1) and injected with a single i.v. dose of 5mg / kg of anti-TROP2 mAb5-3.3 (DAR 3.6), 5mg / kg isotype mAb-VAP-3.3 (DAR 3.8), 5mg / kg mAb5 or PBS vehicle. Results As depicted in Fig. 11, the administration of 5 mg / kg of anti-TROP2 mAb5-3.3 resulted in tumor regressions, while unconjugated anti-TROP2 mAb5 and isotype mAb-3.3 did not exhibit any effect on tumor growth. These findings demonstrate that tumor regression can be achieved in TROP2-expressing Colo205 colon tumor xenografts through treatment with anti-TROP2 mAb5-3.3 when conjugation is performed using light chain C110 and heavy chain C375. Example 16 Intratumoral cytokines induced in TROP2 positive HCC1954 mouse model treated with anti-TROP2 mAb5 conjugated with Compound 3.3 to engineered light chain C110 and heavy chain C375 Compound 3.3 was conjugated to engineered light chain C110 and heavy chain C375 of anti-TROP2 mAb (mAb5) as described previously. For in vivo testing in the TROP2 expressing HCC1954 breast cancer xenograft mouse model, female CD-1 Nude (CR - Crl:CD1-Foxn1nu) immunodeficient outbred mice (Charles River Laboratories) at 9 to 10 weeks of age were used. HCC1954 cells (ATCC®, CRL- 2338™) were cultivated in RPMI-1640 medium containing 10% fetal bovine serum, 2 mM glutamine, 10 mM HEPES, 1 mM sodium pyruvate and 4.5g / L glucose. The cells were grown in a humidified incubator set at 37oC and an atmosphere of 5% CO2and 95% air. On the day of tumor implantation, the HCC1954 cells were harvested during the exponential growth and resuspended in 50% Geltrex™ (ThermoFisher; A14132-02) prepared in Dulbecco’s Phosphate - Buffered Saline (DPBS) at 1 x 107cells / mL. Tumors were initiated by subcutaneous implantation of 1 x 106HCC1954 cells (in a 0.1 mL suspension) into the right flank of each test animal. Tumors were measured in three dimensions using digital calipers to monitor growth. Animals were pair-matched when tumor volumes reached 80-140 mm3and injected with a single i.v. dose of 5mg / kg of anti-TROP2 mAb5-3.3 (DAR 3.6), 5mg / kg isotype mAb-3.3 (DAR 3.8), 5mg / kg mAb5 or PBS vehicle. Tumors were collected 20 h post i.v., and immediately stored in RNAprotect® Tissue Reagent (Qiagen) untill further processing. Tissue was homogenized using Polytron homogenizer (Kinematica) and total RNA was isolated using RNeasy Plus Mini Kit (Qiagen). Relative expression of mouse and human cytokines was measured by using Luna Universal One-Step RT-qPCR Kit (Promega) according to the manufacturer protocol. qRT-PCR was run on Light Cycler 480 II (Roche) with annealing time 60oC for all tested primers. Primer name sequence mInfb1 F AACTCCACCAGCAGACAGTG (SEQ ID NO: 27) mInfb1 R GGTACCTTTGCACCCTCCAG (SEQ ID NO: 28) mIl6 F GGAGGCTTAATTACACATGTTCTCTG (SEQ ID NO: 29) mIl6 R AAGTGCATCATCGTTGTTCATACA (SEQ ID NO: 30) mIP10 F GTC TGA GTG GGA CTC AAG (SEQ ID NO: 31) mIP10 RGCAGGGATGATTTCAAGC (SEQ ID NO: 32)mRantes F CCCACGTCAAGGAGTATTTC (SEQ ID NO: 33) mRantes R ACCCTCTATCCTAGCTCATC (SEQ ID NO: 34) huRantes F CTGCTGCTTTGCCTACATTG (SEQ ID NO: 35) huRantes R TCCCGAACCCATTTCTTCTC (SEQ ID NO: 36) huIP10 F GAAGGGTGAGAAGAGATGTC (SEQ ID NO: 37) huIP10 R TAGGGAAGTGATGGGAGAG (SEQ ID NO: 38) Results HCC1954 breast tumor xenograft mice were treated intravenously with a single I.V. dose of 5mg / kg of anti-TROP2 mAb5-3.3 (DAR 3.6), 5mg / kg isotype mAb-3.3 (DAR 3.8), 5mg / kg mAb5 or vehicle. Treatment with anti-TROP2 mAb5-3.3 (Fig. 12) resulted in statistically significant overexpression of mouse INF^, IL6, RANTES and IP-10 and human IP10 and RANTES compared to controls. This data show that anti-TROP2 mAb5-3.3 can selectively deliver warhead CDN compound 2.2 to the tumor tissue. Moreover, they demonstrate that anti-TROP2 mAb5-3.3 induce a STING adaptor protein- dependent response, and stimulate the production of STING-dependent cytokines in vivo. Example 17 Activity of anti-HER2 mAb3 conjugated with Compound 3.13 to engineered light chain C110 and heavy chain C375 in Her2 expressing HCC1954 breast tumor xenograft model Compound 3.13 was conjugated to engineered light chain C110 and heavy chain C375 of anti-Her2 mAb (mAb3) as described above. For in vivo testing in the HCC1954 breast cancer xenograft mouse model, female SCID-beige mice at 8 to 12 weeks of age (purchased from Charles River Lab) were used for implantation. HCC1954 cells (obtained from ATCC) were cultured in RPMI medium supplemented with 10% fetal bovine serum at 37°C in a humidified incubator with 5% CO2. On the day of implantation, 1 x 107HCC1954 cells were re-suspended in 100^L RPMI1640 serum free media containing 50% Matrigel and implanted subcutaneously in the right flank. After implant, tumors were measured by caliper and mice were weighed two times per week once tumors were palpable. Tumors were measured in two dimensions and tumor volumes were calculated from caliper measurements using formula (L x W2) / 2. Animals were pair matched when tumor reached volume 100 - 150 mm³ (designated as day 1) and injected with single I.V dose 1, 0.4 and 0.2 mg / kg anti-Her2 mAb3-3.13 (DAR 3.8), 1mg / kg isotype mAb-3.13 (DAR 3.8), and PBS vehicle. Results Treatment with single dose 1, 0.4 and 0.2 mg / kg anti-Her2 mAb3-3.13 led to regression of human HCC1954 xenograft tumors (Fig.13). Tumor regression was not observed in mice treated with 1 mg / kg of isotype mAb-3.13 ADC (Fig.13). These data show that tumor regression can be achieved in Her2 expressing HCC1954 breast tumor xenograft by treatment with anti-Her2 mAb3-3.13. Surprisingly, mAb3-3.13 achieved tumor regression at dose 0.2mg / kg whereas mAb3-3.3 triggered only tumor growth inhibition at dose 0.3mg / kg (Fig 8) even though both conjugates contain the same warhead CDN 2.2. Therefore, it may be advantageous to exclude the self-immolative N-methylethanolamine part from the linker of the conjugate. Example 18 Activity of anti-TROP2 mAb5 conjugated with Compound 3.13 to engineered light chain C110 and heavy chain C375 in TROP2 expressing HCC1954 breast tumor xenograft model Compound 3.13 was conjugated to engineered light chain C110 and heavy chain C375 of anti-TROP2 mAb5 as described above. For in vivo testing in the HCC1954 breast cancer xenograft mouse model, female SCID-beige mice at 8 to 12 weeks of age (purchased from Charles River Lab) were used for implantation. HCC1954 cells (obtained from ATCC) were cultured in RPMI medium supplemented with 10% fetal bovine serum at 37°C in a humidified incubator with 5% CO2. On the day of implantation, 1 x 107HCC1954 cells were re-suspended in 100^L RPMI1640 serum free media containing 50% Matrigel and implanted subcutaneously in the right flank. After implant, tumors were measured by caliper and mice were weighed two times per week. Tumors were measured in two dimensions and tumor volumes were calculated from caliper measurements using formula (L x W2) / 2. Animals were pair matched when tumor reached volume 100 - 150 mm³ (designated as day 1) and injected with a single i.v. dose 1 and 0.4 mg / kg anti-TROP2 mAb5-3.13 (DAR 3.6), 5mg / kg unconjugated mAb5 or 1mg / kg isotype mAb-3.13 (DAR 3.8). Results As depicted in Fig.14, treatment with 1 and 0.4 mg / kg of anti-TROP2 mAb5-3.13 induced regressions of the human breast cancer tumors whereas un-conjugated anti-TROP2 mAb5 and isotype mAb-3.13 did not have any effect on tumor growth. Unexpectedly, 0.4 mg / kg of anti-TROP2 mAb5-3.13 had superior activity compared to 1 mg / kg of anti-TROP2 mAb5-3.3 in the same mouse model (Fig. 9 and 14) despite both conjugates containing the same warhead CDN compound 2.2. Therefore, it is advantageous to remove N-methylethanolamine from the linker of the conjugate. Example 19 Activity of anti-FOLR1 mAb6 conjugated with Compound 3.3 to engineered heavy chain C152 and C375 in FOLR1 expressing KB cervical tumor xenograft model Compound 3.3 was conjugated to the engineered heavy chain C152 and C375 of anti-FOLR1 mAb (mAb6), following the previously described method. The KB human cervical carcinoma cell line was obtained from American Type Culture Collection (ATCC®, CRL-3596™) and maintained in Eagle's Minimum Essential Medium containing 10% fetal bovine serum. The tumor cells were grown in tissue culture flasks in a humidified incubator set at 37oC and an atmosphere of 5% CO2and 95% air. On the day of tumor implantation, the KB cells were harvested during the exponential growth phase (60-70% confluency) and resuspended in 50% Geltrex™ (ThermoFisher; A14132-02) prepared in Dulbecco’s Phosphate - Buffered Saline (DPBS) at 3 x 107cells / mL concentration. Tumors were initiated by subcutaneous implantation of 3 x 106KB cells (in a 0.1 mL suspension) into the right flank of female CD-1 nude mice (CR - Crl:CD1-Foxn1nu). Tumors were measured in two dimensions and tumor volumes were calculated from caliper measurements using formula (L x W2) / 2. Animals were pair matched when tumor volumes reached 100-140 mm3(designated as day 1) and injected with three i.v. doses of 2.5mg / kg of anti-FOLR1 mAb6-3.3 (DAR 3.8), 2.5mg / kg isotype mAb-VAP-3.8 (DAR 3.8), 2.5mg / kg mAb6 or PBS vehicle on day 1, 8 and 15. Results As depicted in Fig. 15, the administration of 2.5 mg / kg of anti-FOLR1 mAb6-3.3 resulted in tumor growth inhibition, while unconjugated anti-FOLR1 mAb6 and isotype mAb-3.3 did not exhibit any effect on tumor growth. These findings demonstrate that tumor inhibition can be achieved in FOLR1-expressing KB tumor xenografts through treatment with anti-FOLR1 mAb6-3.3 when conjugation is performed using heavy chain chain C152 and C375.
Claims
CLAIMS 1. Compound of general formula I:wherein R is selected from H, ,; wherein R1 is selected from H, F, and Cl; R3 is selected from C1-C6alkyl, and amino acid side chains; -L- is selected from –C(O)- and –C(O)-O-CH2-CH2-N(CH3)-C(O)-; -K- is selected from -C(O)-(CH2)m-, -C(O)-(CH2CH2O)n-CH2CH2-, -C(O)-(CH2CH2O)n-CH2CH2NH- C(O)-(CH2)p-, -C(O)-(CH2)m-NH-C(O)-(CH2)p-, -C(O)-(CH2)m-N(CH3)-C(O)-(CH2)p-; wherein m=1-8, n=1-8, p=1-5; or a pharmaceutically acceptable salt or solvate or formulation thereof.
2. Compound according to claim 1, wherein R3 is selected from C1-C6alkyl, –(CH2)3-NH-C(O)-NH2.
3. Compound according to claim 1 or 2, wherein R1 is F or Cl.
4. Compound according to claim 1, which is a compound of formula II, or its pharmaceutically5. Compound according to claim 1 or 2 or 3, which is a compound of general formula III, or its pharmaceutically acceptable salt or solvate,6. Compound according to claim 1 or 2 or 3, which is a compound of general formula IV, V or VI, or its pharmaceutically acceptable salt or solvate or formulation, (VI).
7. Compound according to claim 1 or claim 6, wherein the antibody is a monoclonal antibody, and / or wherein the antibody is human or humanized.
8. Compound according to claim 1 or 6 or 7, wherein the antibody is bound via a cysteine residue.
9. Compound according to any one of claim 1, 6, 7 or 8, wherein the antibody is engineered to contain at least one cysteine in the heavy or light chain portion, preferably at positions 110 of light chain and / or 152 and / or 375 of heavy chain accoding to EU numbering.
10. Compound of any one of claims 1-4 or 6-9 for use in the treatment or prevention of cancer.
11. Compound for use according to claim 10, wherein the cancer is selected from solid tumors and lymphomas.
12. Compound for use according to claim 10, wherein the cancer is selected from adrenal cancer, bladder cancer, bone cancer, brain cancer, breast cancer, colon cancer, colorectal cancer, eye cancer, head-and- neck cancer, kidney cancer such as renal cell carcinoma, liver cancer, lung cancer such as non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer such as squamous cell carcinoma and melanoma, thyroid cancer, uterine cancer, vaginal cancer, and myeloma such as multiple myeloma.
13. Compound for use according to claim 10, wherein the cancer is selected from Burkitt’s lymphoma, Hodgkin’s lymphoma, non-Hodgkin’s lymphoma (NHL), indolent non-Hodgkin’s lymphoma (iNHL), refractory iNHL, multiple myeloma (MM), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), B-cell ALL, acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), myelodysplastic syndrome (MDS), myeloproliferative disease (MPD), mantle cell lymphoma (MCL), follicular lymphoma (FL), Waldestrom’s macroglobulinemia (WM), T-cell lymphoma, B-cell lymphoma, diffuse large B-cell lymphoma (DLBCL), and marginal zone lymphoma (MZL).
14. Compound for use according to any one of claims 10 to 13, wherein the compound is administered parenterally.
15. A pharmaceutical composition comprising at least one compound of formula I according to claim 1 or 2 or 3, preferably at least one compound of formula II according to claim 4 and / or at least one compound of formula IV, V and / or VI according to any one of claims 6 to 9, or a pharmaceutically acceptable salt, solvate or formulation thereof, and at least one pharmaceutically acceptable excipient.
Citation Information
Patent Citations
Cysteine engineered antibodies and conjugates
WO2006034488A2
2'3'-cyclic dinucleotides
WO2019193542A1
DC-sign antibody conjugates comprising sting agonists
WO2020092617A1
2'3'-cyclic dinucleotides and prodrugs thereof
WO2020178769A1
Extracellular vesicle conjugates and uses thereof
WO2020191377A1