Multifunctional molecules binding to TCR and uses thereof
Multifunctional molecules targeting Nectin-4 and TCRβV redirect T cells for cancer immunotherapy, addressing the limitations of CD3 epsilon-targeting molecules by controlling T cell activation and reducing cytokine storms, thereby enhancing anti-tumor efficacy.
Patent Information
- Application Number
- PCT/US2025/025263
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-04-17
- Filing Date
- 2025-04-17
- Publication Date
- 2025-10-23
AI Technical Summary
Current molecules targeting the CD3 epsilon subunit of the T cell receptor for cancer immunotherapy cause T cell dysfunction, cytokine storms, and neurotoxicity due to non-physiological massive activation of T cells, necessitating improved T cell receptor-binding molecules.
Development of multifunctional molecules comprising a tumor-associated antigen binding moiety, a co-stimulatory receptor-binding moiety, and a TCRβV-binding moiety, specifically targeting Nectin-4 and TCRβV, to redirect T cells for cancer immunotherapy.
The multifunctional molecules effectively redirect T cells to tumor sites with controlled activation, reducing cytokine storms and neurotoxicity, enhancing anti-tumor efficacy while minimizing off-target effects.
Smart Images

Figure US2025025263_23102025_PF_FP_ABST
Abstract
Description
WSGR Docket No.53676-772.601 MULTIFUNCTIONAL MOLECULES BINDING TO TCR AND USES THEREOF CROSS REFERENCE
[0001] This application claims the benefit of U.S. Provisional Application No. 63 / 635,318, filed onApril 17, 2024, which is incorporated herein by reference in its entirety. BACKGROUND
[0002] Currently available molecules designed to redirect T cells to promote tumor cell lysis for cancerimmunotherapy typically target the CD3 epsilon (CD3e) subunit of the T cell receptor (TCR). However, there are limitations to this approach. Previous studies have shown that, e.g., low doses of anti-CD3e monoclonal antibody (mAb) can cause T cell dysfunction and exert immunosuppressive effects. In addition, anti-CD3e mAbs bind to all T cells and thus activate a large number of T cells. Such non- physiological massive activation of T cells by these anti-CD3e mAbs can result in the production of proinflammatory cytokines such as IFN-gamma, IL-1-beta, IL-6, IL-10 and TNF-alpha, causing a “cytokine storm” known as the cytokine release syndrome (CRS), which is also associated with neurotoxicity (NT). Thus, there is a need for improved T cell receptor-binding molecules that redirect T cells for cancer immunotherapy. SUMMARY
[0003] In an aspect, provided herein is, inter alia, a multifunctional molecule comprising:(a) a tumor-associated antigen binding moiety, wherein the tumor-associated antigen binding moiety comprises a Nectin-4 binding moiety; (b) a molecule that binds to a co-stimulatory receptor of a T cell; and (c) a TCRβV-binding moiety. INCORPORATION BY REFERENCE
[0004] All publications, patents, and patent applications mentioned in this specification are hereinincorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. BRIEF DESCRIPTION OF THE DRAWINGS
[0005] The novel features of the disclosure are set forth with particularity in the appended claims. Abetter understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings of which:
[0006] FIG. 1A shows an exemplary embodiment of multifunctional molecules, e.g., multifunctionalmolecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 chimeric (e.g., 1.5, 46 or 746 nM). FIG.1B shows an exemplary embodiment of multifunctional molecules, e.g., multifunctional moleculesWSGR Docket No.53676-772.601 comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, wherein the multifunctional molecule comprise two Nectin-4-binding moieties, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 chimeric (e.g., 1.5, 46 or 746 nM). FIG.1C shows a matrix of exemplary multifunctional molecules, e.g., multifunctional molecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 chimeric (e.g., 1.5, 46 or 746 nM). FIG.1D shows a matrix of exemplary embodiment of multifunctional molecules, e.g., multifunctional molecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, wherein the multifunctional molecule comprise two Nectin-4-binding moieties, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 chimeric (e.g., 1.5, 46 or 746 nM).
[0007] FIG. 2A shows FACS plots showing binding of BNM0618, BOM0102, BOM0103, BNM0620,BOM0107, BOM0108, which are exemplary embodiments of multifunctional molecules as provided herein, to A549, BxPC3, MCF7, and T47D. FIG.2B depicts EC50 of BNM0618, BOM0102, BOMO103, BNM0620, BOM0107, BOM0108 to tumor cells expressing different levels of Nectin-4 expression.
[0008] FIG. 3A shows an example of an experimental schema for assessing cytotoxicity of exemplaryembodiments of multifunctional molecules as provided herein. FIG.3B shows in vitro cytotoxicity of A549, MCF7, and T47D cells with BNM0618, BOM0102, BOM0103, BNM0620, BOM0107, BOM0108, BOM0104, BOM0105, BOM0106, BOM0109, BOM0110, BOM0111, or RSV controls (BLM0141, BOM0159).
[0009] FIG. 4A shows an example of an experimental schema for assessing T-cell activation andcytotoxicity phenotype of exemplary embodiments of multifunctional molecules as provided herein (BNM0618). FIG.4B shows T-cell activation (%CD25 of CD8 T cells) with treatment of BNM0618, and with or without co-culture with T47D cells. FIG.4C shows cytotoxicity phenotype (%GzB of CD8 T cells and %107a of CD8 T cells) with treatment of BNM0618, and with or without co-culture with T47D cells.
[0010] FIG. 5A shows anti-tumor activity of exemplary embodiments of multifunctional molecules asprovided herein in MC38 model in cohort 1 of Jh C57BL / 6 mice. FIG.5B shows anti-tumor activity of exemplary embodiments of multifunctional molecules as provided herein in MC38 model in cohort 2 of Jh C57BL / 6 mice.
[0011] FIG. 6A shows an exemplary embodiment of multifunctional molecules, e.g., multifunctionalmolecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 humanized / optimized (e.g., 1.5, 46 or 746 nM). FIG.6B shows an exemplary embodiment of multifunctional molecules, e.g., multifunctional molecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or aWSGR Docket No.53676-772.601 functional fragment or functional variant thereof as described herein, wherein the multifunctional molecule comprise two Nectin-4-binding moieties, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 humanized / optimized (e.g., 1.5, 46 or 746 nM). FIG.6C shows shows a matrix of exemplary multifunctional molecules, e.g., multifunctional molecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 humanized / optimized (e.g., 1.5, 46 or 746 nM). FIG.6D shows shows a matrix of exemplary embodiment of multifunctional molecules, e.g., multifunctional molecules comprising a Nectin-4-binding moiety, a TCRβV-binding moiety, and at least one cytokine molecule or a functional fragment or functional variant thereof as described herein, wherein the multifunctional molecule comprise two Nectin-4-binding moieties, with different affinities for Vβ6 / 10 (e.g., 1 or 42 nM) and for Nectin-4 humanized / optimized (e.g., 1.5, 46 or 746 nM or 1.5 nM, 30 nM and 540 nM).
[0012] FIG. 7 shows in vitro cytotoxicity of OVCAR3 and MCF7 cells with BOM0564, BOM0566,BPM008, BOM0579, BOM0581, BPM0010, BOM567, BOM0569, BPM009, BOM0582, BOM0584, BPM0011, or RSV controls (BLM0141, BOM0159).
[0013] FIG. 8 shows dosing schedule and mean tumor volume upon treatment with BKM0307,BNM0094, BNM0092, BNM0104, BJM0869, or sequential treatment of BKM0307, followed by BNM0104, BJM0869, or BNM0092.
[0014] FIG. 9 shows dosing schedule and mean tumor volume upon treatment with BKM0307,BNM0094, BNM0092, BNM0104, BJM0869, or alternate dosing of BKM0307, followed by BNM0104, BJM0869, or BNM0092.
[0015] FIG. 10 shows dosing schedule and mean tumor volume upon treatment with BKM0307,BNM0094, BNM0092, BNM0104, or BNM0276, or co-dosing of BKM0307and BNM0092.
[0016] FIG. 11 shows dosing schedule and mean tumor volume upon treatment with BKM0307,BNM0094, BNM0092, BNM0104, or BNM0276, or alternate dosing of BKM0307, followed by BNM0104 or BNM0276. DETAILED DESCRIPTION DEFINITION
[0017] Certain specific details of this description are set forth in order to provide a thoroughunderstanding of various embodiments. However, one skilled in the art will understand that the present disclosure may be practiced without these details. In other instances, well-known structures have not been shown or described in detail to avoid unnecessarily obscuring descriptions of the embodiments.
[0018] Unless the context requires otherwise, throughout the specification and claims which follow, theword “comprise” and variations thereof, such as, “comprises” and “comprising” are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed disclosure.
[0019] As used in this specification and the appended claims, the singular forms “a,” “an,” and “the”include plural referents unless the content clearly dictates otherwise. The use of the words “a” or “an”WSGR Docket No.53676-772.601 when used in conjunction with the term “comprising” herein may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.”
[0020] It should also be noted that the term “or” is generally employed in its sense including “and / or”unless the content clearly dictates otherwise.
[0021] Unless otherwise defined, all technical and scientific terms used herein have the same meaningas commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below.
[0022] The term “about” when referring to a measurable value such as an amount, a temporal duration,and the like, is meant to encompass variations of ±20% or in some instances ±10%, or in some instances ±5%, or in some instances ±1%, or in some instances ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods. As used herein, “about” and “approximately” generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given range of values.
[0023] The term “acquire” or “acquiring” as the terms are used herein, refer to obtaining possession of aphysical entity (e.g., a sample, a polypeptide, a nucleic acid, or a sequence), or a value, e.g., a numerical value, by “directly acquiring” or “indirectly acquiring” the physical entity or value. “Directly acquiring” means performing a process (e.g., performing a synthetic or analytical method) to obtain the physical entity or value. “Indirectly acquiring” refers to receiving the physical entity or value from another party or source (e.g., a third party laboratory that directly acquired the physical entity or value). Directly acquiring a physical entity includes performing a process that includes a physical change in a physical substance, e.g., a starting material. Directly acquiring a value includes performing a process that includes a physical change in a sample or another substance, e.g., performing an analytical process which includes a physical change in a substance, e.g., a sample.
[0024] “Antibody molecule” as used herein refers to a protein, e.g., an immunoglobulin chain orfragment thereof, comprising at least one immunoglobulin variable domain structure and / or sequence. An antibody molecule encompasses antibodies (e.g., full-length antibodies) and antibody fragments. In some embodiments, an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain. For example, a full-length antibody is an immunoglobulin (Ig) molecule (e.g., an IgG antibody) that is naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes). In embodiments, an antibody molecule refers to an immunologically active, antigen-binding portion of an immunoglobulin molecule, such as an antibody fragment. An antibody fragment, e.g., functional fragment, is a portion of an antibody, e.g., Fab, Fab′, F(ab′)2, F(ab)2, variable fragment (Fv), domain antibody (dAb), or single chain variable fragment (scFv). A functional antibody fragment binds to the same antigen as that recognized by the intact (e.g., full-length) antibody. The terms “antibody fragment” or “functional fragment” also include isolated fragments consisting of the variable regions, such as the “Fv” fragments consisting of the variableWSGR Docket No.53676-772.601 regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker (“scFv proteins”). In some embodiments, an antibody fragment does not include portions of antibodies without antigen binding activity, such as Fc fragments or single amino acid residues. Exemplary antibody molecules include full length antibodies and antibody fragments, e.g., dAb (domain antibody), single chain, Fab, Fab’, and F(ab’)2 fragments, and single chain variable fragments (scFvs). In some embodiments, the antibody molecule is an antibody mimetic. In some embodiments, the antibody molecule is, or comprises, an antibody-like framework or scaffold, such as, fibronectins, ankyrin repeats (e.g., designed ankyrin repeat proteins (DARPins)), avimers, affibody affinity ligands, anticalins, or affilin molecules.
[0025] The term “human-like antibody molecule” as used herein refers to a humanized antibodymolecule, human antibody molecule or an antibody molecule having at least 95% sequence identity with a non-murine germline framework region, e.g., FR1, FR2, FR3 and / or FR4. In some embodiments, the human-like antibody molecule comprises a framework region having at least 95% sequence identity to a human germline framework region, e.g., a FR1, FR2, FR3 and / or FR4 of a human germline framework region. In some embodiments, the human-like antibody molecule is a recombinant antibody. In some embodiments, the human-like antibody molecule is a humanized antibody molecule. In some embodiments, the human-like antibody molecule is human antibody molecule. In some embodiments, the human-like antibody molecule is a phage display or a yeast display antibody molecule. In some embodiments, the human-like antibody molecule is a chimeric antibody molecule. In some embodiments, the human-like antibody molecule is a CDR grafted antibody molecule.
[0026] As used herein, an “immunoglobulin variable domain sequence” refers to an amino acidsequence which can form the structure of an immunoglobulin variable domain. For example, the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain. For example, the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
[0027] In embodiments, an antibody molecule is monospecific, e.g., it comprises binding specificity fora single epitope. In some embodiments, an antibody molecule is multispecific, e.g., it comprises a plurality of immunoglobulin variable domain sequences, where a first immunoglobulin variable domain sequence has binding specificity for a first epitope and a second immunoglobulin variable domain sequence has binding specificity for a second epitope. In some embodiments, an antibody molecule is a bispecific antibody molecule. “Bispecific antibody molecule” as used herein refers to an antibody molecule that has specificity for more than one (e.g., two, three, four, or more) epitope and / or antigen.
[0028] “Antigen” (Ag) as used herein refers to a molecule that can provoke an immune response, e.g.,involving activation of certain immune cells and / or antibody generation. Any macromolecule, including almost all proteins or peptides, can be an antigen. Antigens can also be derived from genomic recombinant or DNA. For example, any DNA comprising a nucleotide sequence or a partial nucleotide sequence that encodes a protein capable of eliciting an immune response encodes an “antigen.” In embodiments, an antigen does not need to be encoded solely by a full length nucleotide sequence of aWSGR Docket No.53676-772.601 gene, nor does an antigen need to be encoded by a gene at all. In embodiments, an antigen can be synthesized or can be derived from a biological sample, e.g., a tissue sample, a tumor sample, a cell, or a fluid with other biological components. As used, herein a “tumor antigen” or interchangeably, a “cancer antigen” includes any molecule present on, or associated with, a cancer, e.g., a cancer cell or a tumor microenvironment that can provoke an immune response. As used, herein an “immune cell antigen” includes any molecule present on, or associated with, an immune cell that can provoke an immune response.
[0029] The “antigen-binding site,” or “binding portion” of an antibody molecule refers to the part of anantibody molecule, e.g., an immunoglobulin (Ig) molecule, that participates in antigen binding. In embodiments, the antigen binding site is formed by amino acid residues of the variable (V) regions of the heavy (H) and light (L) chains. Three highly divergent stretches within the variable regions of the heavy and light chains, referred to as hypervariable regions, are disposed between more conserved flanking stretches called “framework regions,” (FRs). FRs are amino acid sequences that are naturally found between, and adjacent to, hypervariable regions in immunoglobulins. In embodiments, in an antibody molecule, the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface, which is complementary to the three-dimensional surface of a bound antigen. The three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.” The framework region and CDRs have been defined and described, e.g., in Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242, and Chothia, C. et al. (1987) J. Mol. Biol.196:901-917. Each variable chain (e.g., variable heavy chain and variable light chain) is typically made up of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the amino acid order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
[0030] As used herein, an “immune cell” refers to any of various cells that function in the immunesystem, e.g., to protect against agents of infection and foreign matter. In embodiments, this term includes leukocytes, e.g., neutrophils, eosinophils, basophils, lymphocytes, and monocytes. Innate leukocytes include phagocytes (e.g., macrophages, neutrophils, and dendritic cells), mast cells, eosinophils, basophils, and natural killer cells. Innate leukocytes identify and eliminate pathogens, either by attacking larger pathogens through contact or by engulfing and then killing microorganisms, and are mediators in the activation of an adaptive immune response. The cells of the adaptive immune system are special types of leukocytes, called lymphocytes. B cells and T cells are important types of lymphocytes and are derived from hematopoietic stem cells in the bone marrow. B cells are involved in the humoral immune response, whereas T cells are involved in cell-mediated immune response. The term “immune cell” includes immune effector cells.
[0031] “Immune effector cell,” as that term is used herein, refers to a cell that is involved in an immuneresponse, e.g., in the promotion of an immune effector response. Examples of immune effector cellsWSGR Docket No.53676-772.601 include, but are not limited to, T cells, e.g., alpha / beta T cells and gamma / delta T cells, B cells, natural killer (NK) cells, natural killer T (NK T) cells, and mast cells.
[0032] The term “effector function” or “effector response” refers to a specialized function of a cell.Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
[0033] The terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeablyherein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. The polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
[0034] The terms “nucleic acid,” “nucleic acid sequence,” “nucleotide sequence,” or “polynucleotidesequence,” and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. The polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non- coding (antisense) strand. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. The nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
[0035] The term “isolated,” as used herein, refers to material that is removed from its original or nativeenvironment (e.g., the natural environment if it is naturally occurring). For example, a naturally- occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated. Such polynucleotides could be part of a vector and / or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature. An isolated polynucleotide (ribonucleic acid (RNA), deoxyribonucleic acid (DNA)), or polypeptide is free of the genes / nucleic acids or sequences / amino acids that flank it in its naturally-occurring state.
[0036] The compositions and methods of the present invention encompass polypeptides and nucleicacids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 80%, 85%, 90%, 95% identical or higher to the sequence specified. In the context of an amino acid sequence, the term “substantially identical” is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and / or common functionalWSGR Docket No.53676-772.601 activity. For example, amino acid sequences that contain a common structural domain having at least about 80%, 85%, 90%.91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 99%, 99.5%, 99.9%, or 100% sequence identity to a reference sequence, e.g., a sequence provided herein. In the context of nucleotide sequence, the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity. For example, nucleotide sequences having at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 99%, 99.5%, 99.9%, or 100% sequence identity to a reference sequence, e.g., a sequence provided herein.
[0037] The term “variant” refers to a polypeptide that has a substantially identical amino acid sequenceto a reference amino acid sequence, or is encoded by a substantially identical nucleotide sequence. In some embodiments, the variant is a functional variant. In some embodiments, a TCRβV variant can bind to TCRα and form a TCR α:β complex.
[0038] The term “functional variant” refers to a polypeptide that has a substantially identical amino acidsequence to a reference amino acid sequence, or is encoded by a substantially identical nucleotide sequence, and is capable of having one or more activities of the reference amino acid sequence.
[0039] Calculations of homology or sequence identity between sequences (the terms are usedinterchangeably herein) are performed as follows. To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”).
[0040] The percent identity between the two sequences is a function of the number of identical positionsshared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol.48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http: / / www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, theWSGR Docket No.53676-772.601 percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http: / / www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred set of parameters (and the one that should be used unless otherwise specified) are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
[0041] The percent identity between two amino acid or nucleotide sequences can be determined usingthe algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score = 100, wordlength = 12 to obtain nucleotide sequences homologous to a nucleic acid molecule of the invention. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res.25:3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.
[0042] It is understood that the molecules of the present invention may have additional conservative ornon-essential amino acid substitutions, which do not have a substantial effect on their functions.
[0043] The term “amino acid” is intended to embrace all molecules, whether natural or synthetic, whichinclude both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids. Exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing. As used herein the term “amino acid” includes both the D- or L- optical isomers and peptidomimetics.
[0044] A “conservative amino acid substitution” is one in which the amino acid residue is replaced withan amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0045] As used herein, the term “molecule” as used in, e.g., antibody molecule, cytokine molecule,receptor molecule, includes full-length, naturally-occurring molecules, as well as variants, e.g., functional variants (e.g., truncations, fragments, mutated (e.g., substantially similar sequences) or derivatized formWSGR Docket No.53676-772.601 thereof), so long as at least one function and / or activity of the unmodified (e.g., naturally-occurring) molecule remains.
[0046] As used herein, the term “mutation” refers to an alteration in the nucleotide sequence of thegenome of an organism, virus, or extrachromosomal DNA. In some embodiments, the mutation may be a large-scale mutation, such as amplifications (or gene duplications) or repetitions of a chromosomal segment, deletions of large chromosomal regions, chromosomal rearrangements (e.g., chromosomal translocations, chromosomal inversions, non-homologous chromosomal crossover, and interstitial deletions), and loss of heterozygosity. In some embodiments, the mutation may be a small-scale mutation, such as insertions, deletions, and substitution mutations. As used herein, the term “substitution mutation” refers to the transition that exchange a single nucleotide for another.
[0047] “Interleukin-2” also known as IL2, IL-2, IL 2, TCGF, lymphokine, and interleukin 2, as referredto herein, includes any of the recombinant or naturally-occurring forms of IL-2 or variants or homologs thereof that have or maintain IL-2 activity (e.g., at least 40% 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity). In some aspects, the variants or homologs have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g., a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring IL-2. In some embodiments, IL-2 is substantially identical to the protein identified by the UniProt reference number P60568 or a variant or homolog having substantial identity thereto.
[0048] The term “triple negative breast cancer,” as used herein, refers to the breast cancer of whichcancer cells do not have estrogen or progesterone receptors (ER or PR) and also do not make any or too much of the HER2 protein.
[0049] The term “co-stimulatory receptor,” as used herein, refers to the cell surface molecules that canpositively induce a secondary signal to fully activate T cells with TCR signaling and cytokine stimulation. In some embodiments, exemplary co-stimulatory receptors include, but are not limited to, CD2, CD27, CD28, ICOS (CD278), 4-1BB (CD137), OX40 (CD134), CD40, CD40L, Toll-like receptors (TLRs), or any combination thereof. Anti-TCRβV antibodies Human T cell receptor (TCR) complex
[0050] TCR is a disulfide-linked membrane-anchored heterodimeric protein normally consisting of thehighly variable alpha (α) and beta (β) chains expressed as part of a complex with the invariant CD3 chain molecules. TCR on αβ T cells is formed by a heterodimer of one alpha chain and one beta chain. Each alpha or beta chain consists of a constant domain and a highly variable domain classified as the Immunoglobulin superfamily (IgSF) fold. The TCRβV chains can be further classified into 30 subfamilies (TRBV1-30). Despite their high structural and functional homology, the amino acid sequence homology in the TRBV genes is very low. Only 4 amino acids out of approximately 95 are identical while 10 additional amino acids are conserved among all subfamilies (see, an alignment of TCRBVWSGR Docket No.53676-772.601 amino acid sequences in Table 9). Nevertheless, TCRs formed between alpha and beta chains of highly diverse sequences show a remarkable structural homology (FIGS.25A and 25B) and elicit a similar function, e.g., activation of T cells.
[0051] T cell receptors (TCR) can be found on the surface of T cells. TCRs recognize antigens, e.g.,peptides, presented on, e.g., bound to, major histocompatibility complex (MHC) molecules on the surface of cells, e.g., antigen-presenting cells. TCRs are heterodimeric molecules and can comprise an alpha chain, a beta chain, a gamma chain or a delta chain. TCRs comprising an alpha chain and a beta chain are also referred to as TCRαβ. The TCR beta chain consists of the following regions (also known as segments): variable (V), diversity (D), joining (J) and constant (C) (see Mayer G. and Nyland J. (2010) Chapter 10: Major Histocompatibility Complex and T-cell Receptors-Role in Immune Responses. In: Microbiology and Immunology on-line, University of South Carolina School of Medicine). The TCR alpha chain consists of V, J and C regions. The rearrangement of the T-cell receptor (TCR) through somatic recombination of V (variable), D (diversity), J (joining), and C (constant) regions is a defining event in the development and maturation of a T cell. TCR gene rearrangement takes place in the thymus.
[0052] TCRs can comprise a receptor complex, known as the TCR complex, which comprises a TCRheterodimer comprising of an alpha chain and a beta chain, and dimeric signaling molecules, e.g., CD3 co-receptors, e.g., CD3δ / ε, and / or CD3γ / ε.
[0053] As used herein, the term “T cell receptor beta variable chain” or “TCRβV,” refers to anextracellular region of the T cell receptor beta chain which comprises the antigen recognition domain of the T cell receptor. The term TCRβV includes isoforms, mammalian, e.g., human TCRβV, species homologs of human and analogs comprising at least one common epitope with TCRβV. Human TCRβV comprises a gene family comprising subfamilies including, but not limited to: a TCRβ V6 subfamily, a TCRβ V10 subfamily, a TCRβ V12 subfamily, a TCRβ V5 subfamily, a TCRβ V7 subfamily, a TCRβ V11 subfamily, a TCRβ V14 subfamily, a TCRβ V16 subfamily, a TCRβ V18 subfamily, a TCRβ V9 subfamily, a TCRβ V13 subfamily, a TCRβ V4 subfamily, a TCRβ V3 subfamily, a TCRβ V2 subfamily, a TCRβ V15 subfamily, a TCRβ V30 subfamily, a TCRβ V19 subfamily, a TCRβ V27 subfamily, a TCRβ V28 subfamily, a TCRβ V24 subfamily, a TCRβ V20 subfamily, TCRβ V25 subfamily, a TCRβ V29 subfamily, a TCRβ V1 subfamily, a TCRβ V17 subfamily, a TCRβ V21 subfamily, a TCRβ V23 subfamily, or a TCRβ V26 subfamily, as well as family members of said subfamilies, and variants thereof (e.g., a structural or functional variant thereof). In some embodiments, the TCRβ V6 subfamily comprises: TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6-2*01, TCRβ V6-3*01 or TCRβ V6-1*01. In some embodiments, TCRβV comprises TCRβ V6-5*01, or a variant thereof, e.g., a variant having 85%, 90%, 95%, 99% or more identity the naturally-occurring sequence. TCRβ V6-5*01 is also known as TRBV65; TCRBV6S5; TCRBV13S1, or TCRβ V13.1. The amino acid sequence of TCRβ V6-5*01, e.g., human TCRβ V6-5*01, is known in that art, e.g., as provided by IMGT ID L36092. In some embodiments, TCRβ V6-5*01 is encoded by the nucleic acid sequence of SEQ ID NO: 43, or a sequence having 85%, 90%, 95%, 99% orWSGR Docket No.53676-772.601 more identity thereof. In some embodiments, TCRβ V6-5*01 comprises the amino acid sequence of SEQ ID NO: 44, or a sequence having 85%, 90%, 95%, 99% or more identity thereof. SEQ ID NO: 43 ATGAGCATCGGCCTCCTGTGCTGTGCAGCCTTGTCTCTCCTGTGGGCAGGTCCAGTGAATGC TGGTGTCACTCAGACCCCAAAATTCCAGGTCCTGAAGACAGGACAGAGCATGACACTGCAG TGTGCCCAGGATATGAACCATGAATACATGTCCTGGTATCGACAAGACCCAGGCATGGGGC TGAGGCTGATTCATTACTCAGTTGGTGCTGGTATCACTGACCAAGGAGAAGTCCCCAATGGC TACAATGTCTCCAGATCAACCACAGAGGATTTCCCGCTCAGGCTGCTGTCGGCTGCTCCCTC CCAGACATCTGTGTACTTCTGTGCCAGCAGTTACTC SEQ ID NO: 44 MSIGLLCCAALSLLWAGPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMG LRLIHY-SVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY TCR beta V (TCRβV)
[0054] Diversity in the immune system enables protection against a huge array of pathogens. Since thegermline genome is limited in size, diversity is achieved not only by the process of V(D)J recombination but also by junctional (junctions between V-D and D-J segments) deletion of nucleotides and addition of pseudo-random, non-templated nucleotides. The TCR beta gene undergoes gene arrangement to generate diversity.
[0055] The TCR V beta repertoire varies between individuals and populations because of, e.g., 7frequently occurring inactivating polymorphisms in functional gene segments and a large insertion / deletion-related polymorphism encompassing 2 V beta gene segments.
[0056] Provided herein are, inter alia, antibody molecules and fragments thereof, that bind, e.g.,specifically bind, to a human TCR beta V chain (TCRβV), e.g., a TCRβV gene family (also referred to as a group), e.g., a TCRβV subfamily (also referred to as a subgroup), e.g., as described herein. TCR beta V families and subfamilies are known in the art, e.g., as described in Yassai et al., (2009) Immunogenetics61(7)pp:493-502; Wei S. and Concannon P. (1994) Human Immunology 41(3) pp: 201-206. Theantibodies described herein can be recombinant antibodies, e.g., recombinant non-murine antibodies, e.g., recombinant human or humanized antibodies.
[0057] The terms TCRBV, TCRVB, TRBV, TCRβV, TCRVβ or TRβV are used interchangeably hereinand refer to a TCR beta V chain, e.g., as described herein.
[0058] In some embodiments, provided herein is an anti-TCRβV antibody molecule that binds to humanTCRβV, e.g., a TCRβV family, e.g., gene family or a variant thereof. In some embodiments a TCRBV gene family comprises one or more subfamilies, e.g., as described herein, e.g., in FIG.4, Table 8A or Table 8B. In some embodiments, the TCRβV gene family comprises: a TCRβ V6 subfamily, a TCRβ V10 subfamily, a TCRβ V12 subfamily, a TCRβ V5 subfamily, a TCRβ V7 subfamily, a TCRβ V11 subfamily, a TCRβ V14 subfamily, a TCRβ V16 subfamily, a TCRβ V18 subfamily, a TCRβ V9 subfamily, a TCRβ V13 subfamily, a TCRβ V4 subfamily, a TCRβ V3 subfamily, a TCRβ V2 subfamily,WSGR Docket No.53676-772.601 a TCRβ V15 subfamily, a TCRβ V30 subfamily, a TCRβ V19 subfamily, a TCRβ V27 subfamily, a TCRβ V28 subfamily, a TCRβ V24 subfamily, a TCRβ V20 subfamily, TCRβ V25 subfamily, a TCRβ V29 subfamily, a TCRβ V1 subfamily, a TCRβ V17 subfamily, a TCRβ V21 subfamily, a TCRβ V23 subfamily, or a TCRβ V26 subfamily.
[0059] In some embodiments, TCRβ V6 subfamily is also known as TCRβ V13.1. In someembodiments, the TCRβ V6 subfamily comprises: TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6-2*01, TCRβ V6-3*01 or TCRβ V6-1*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-4*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-4*02, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-9*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-8*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-5*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-6*02, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-6*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-2*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-3*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-1*01, or a variant thereof.
[0060] In some embodiments, TCRβ V6 comprises TCRβ V6-5*01, or a variant thereof. In someembodiments, TCRβ V6, e.g., TCRβ V6-5*01, is recognized, e.g., bound, by SEQ ID NO: 1 and / or SEQ ID NO: 2. In some embodiments, TCRβ V6, e.g., TCRβ V6-5*01, is recognized, e.g., bound, by SEQ ID NO: 9 and / or SEQ ID NO: 10. In some embodiments, TCRβ V6 is recognized, e.g., bound, by SEQ ID NO: 9 and / or SEQ ID NO: 11.
[0061] In some embodiments, TCRβ V10 subfamily is also known as TCRβ V12. In someembodiments, the TCRβ V10 subfamily comprises: TCRβ V10-1*01, TCRβ V10-1*02, TCRβ V10-3*01 or TCRβ V10-2*01, or a variant thereof.
[0062] In some embodiments, TCRβ V12 subfamily is also known as TCRβ V8.1. In someembodiments, the TCRβ V12 subfamily comprises: TCRβ V12-4*01, TCRβ V12-3*01, or TCRβ V12- 5*01, or a variant thereof. In some embodiments, TCRβ V12 is recognized, e.g., bound, by SEQ ID NO: 15 and / or SEQ ID NO: 16. In some embodiments, TCRβ V12 is recognized, e.g., bound, by any one of SEQ ID NOs 23-25, and / or any one of SEQ ID NO: 26-30.
[0063] In some embodiments, the TCRβ V5 subfamily is chosen from: TCRβ V5-5*01, TCRβ V5-6*01,TCRβ V5-4*01, TCRβ V5-8*01, TCRβ V5-1*01, or a variant thereof.
[0064] In some embodiments, the TCRβ V7 subfamily comprises TCRβ V7-7*01, TCRβ V7-6*01,TCRβ V7 -8*02, TCRβ V7 -4*01, TCRβ V7-2*02, TCRβ V7-2*03, TCRβ V7-2*01, TCRβ V7-3*01, TCRβ V7-9*03, or TCRβ V7-9*01, or a variant thereof.
[0065] In some embodiments, the TCRβ V11 subfamily comprises: TCRβ V11-1*01, TCRβ V11-2*01or TCRβ V11-3*01, or a variant thereof. In some embodiments, the TCRβ V14 subfamily comprises TCRβ V14*01, or a variant thereof. In some embodiments, the TCRβ V16 subfamily comprises TCRβ V16*01, or a variant thereof. In some embodiments, the TCRβ V18 subfamily comprises TCRβ V18*01,WSGR Docket No.53676-772.601 or a variant thereof. In some embodiments, the TCRβ V9 subfamily comprises TCRβ V9*01 or TCRβ V9*02, or a variant thereof. In some embodiments, the TCRβ V13 subfamily comprises TCRβ V13*01, or a variant thereof. In some embodiments, the TCRβ V4 subfamily comprises TCRβ V4-2*01, TCRβ V4-3*01, or TCRβ V4-1*01, or a variant thereof. In some embodiments, the TCRβ V3 subfamily comprises TCRβ V3-1*01, or a variant thereof. In some embodiments, the TCRβ V2 subfamily comprises TCRβ V2*01, or a variant thereof. In some embodiments, the TCRβ V15 subfamily comprises TCRβ V15*01, or a variant thereof. In some embodiments, the TCRβ V30 subfamily comprises TCRβ V30*01, or TCRβ V30*02, or a variant thereof. In some embodiments, the TCRβ V19 subfamily comprises TCRβ V19*01, or TCRβ V19*02, or a variant thereof. In some embodiments, the TCRβ V27 subfamily comprises TCRβ V27*01, or a variant thereof. In some embodiments, the TCRβ V28 subfamily comprises TCRβ V28*01, or a variant thereof. In some embodiments, the TCRβ V24 subfamily comprises TCRβ V24-1*01, or a variant thereof. In some embodiments, the TCRβ V20 subfamily comprises TCRβ V20-1*01, or TCRβ V20-1*02, or a variant thereof. In some embodiments, the TCRβ V25 subfamily comprises TCRβ V25-1*01, or a variant thereof. In some embodiments, the TCRβ V29 subfamily comprises TCRβ V29-1*01, or a variant thereof.
[0066] Exemplary amino acid sequences for TCRβV subfamily members can be found on theImMunoGeneTics Information System website: http: / / www.imgt.org / , or in a similar resource. Anti-TCRβV antibodies
[0067] Current bispecific constructs designed to redirect T cells to promote tumor cell lysis for cancerimmunotherapy typically utilize antibody fragments (Fab, scFv, VH, single domain antibody, etc.) that are derived from monoclonal antibodies (mAb) directed against the CD3e subunit of the T cell receptor (TCR). However, there are limitations to this approach which may prevent the full realization of the therapeutic potential for such bispecific constructs. Previous studies have shown that even low “activating” doses of anti-CD3e mAb can cause long-term T cell dysfunction and exert immunosuppressive effects. In addition, anti-CD3e mAbs have been associated with side effects that result from massive T cell activation. The large number of activated T cells secrete substantial amounts of cytokines, the most important of which is Interferon gamma (IFNγ). This excess amount of IFNγ in turn activates macrophages which then overproduce proinflammatory cytokines such as IL-1beta, IL-6, IL-10 and TNF-alpha, causing a “cytokine storm” known as the cytokine release syndrome (CRS) (Shimabukuro-Vornhagen et al., J Immunother Cancer.2018 Jun 15;6(1):56, herein incorporated by reference in its entirety). Thus, the need exists for developing antibodies that are capable of binding and activating only a subset of effector T cells, e.g., to re-duce the CRS and / or neurotoxicity (NT).
[0068] Described herein are molecules targeting the TCRβV chain of TCR and methods thereof.Without wishing to be bound by theory, such molecules are capable of binding, activating, and / or expanding only a subset of T cells, avoiding or reducing CRS and / or NT and minimizing potential immunosuppressive effects of anti-CD3 mAbs.
[0069] Described herein is a class of antibodies, i.e., anti-TCRβV antibody molecules as describedherein, which despite having low sequence similarity (e.g., low sequence identity among the differentWSGR Docket No.53676-772.601 antibody molecules that recognize different TCRβV subfamilies), recognize a structurally conserved, yet sequence-wise variable, region, e.g., domain, on the TCRβV protein (as denoted by the circled area in FIG.25A) and have a similar function (e.g., activation of T cells and a similar cytokine profile as described herein). Thus, the anti-TCRβV antibody molecules as described herein share a structure- function relationship.
[0070] Without wishing to be bound by theory, in some embodiments, the anti-TCRβV antibodymolecules as described herein bind to an outward facing epitope of a TCRβV protein when it is in a complex with a TCRalpha protein, e.g., as denoted by the circled area in FIG.25A. In some embodiments, the anti-TCRβV antibody molecules as described herein recognize (e.g., bind to), a domain (e.g., an epitope) on the TCRβV protein that is: (1) structurally conserved among different TCRβV subfamilies; and (2) has minimal sequence identity among the different TCRβV subfamilies. As shown in Table 9, TCRβV proteins from the different TCRBV subfamilies share minimal sequence similarity. However, as shown in FIG.25A-25B, TCRβV proteins which have minimal sequence similarity, share a similar 3D conformation and structure.
[0071] The alignment of TCRBV amino acid sequences in Table 9 underscores the diversity of TCRsequences. In particular, the TRBV sequences from different subfamilies are considerably different from each other.
[0072] In some embodiments, the anti-TCRβV antibody molecules as described herein do not recognize,e.g., bind to, an interface of a TCRβV:TCRalpha complex. In some embodiments, the anti-TCRβV antibody molecules as described herein do not recognize, e.g., bind to, a constant region of a TCRβV protein. An exemplary antibody that binds to a constant region of a TCRBV region is JOVI.1 as de- scribed in Viney et al., (Hybridoma.1992 Dec;11(6):701-13). In some embodiments, the anti-TCRβV antibody molecules as described herein do not recognize, e.g., bind to, one or more (e.g., all) of a complementarity determining region (e.g., CDR1, CDR2 and / or CDR3) of a TCRβV protein.
[0073] Provided herein are, inter alia, antibody molecules directed to the variable chain of the betasubunit of TCR (TCRβV) which bind and, e.g., activate a subset of T cells. The anti-TCRβV antibody molecules as described herein result in lesser or no production of cytokines associated with CRS, e.g., IL- 6, IL-1beta, IL-10 and TNF alpha; and enhanced and / or delayed production of IL-2 and IFNγ. In some embodiments, the anti-TCRβV antibodies as described herein have a cytokine profile, e.g., as described herein, which differs from a cytokine profile of a T cell engager that binds to a receptor or molecule other than a TCRβV region (“a non-TCRβV-binding T cell engager”). In some embodiments, the non-TCRβV- binding T cell engager comprises an antibody that binds to a CD3 molecule (e.g., CD3 epsilon (CD3e) molecule). In some embodiments, the non-TCRβV-binding T cell engager is an OKT3 antibody or an SP34-2 antibody.
[0074] In some embodiments, the anti-TCRβV antibodies as described herein result in expansion ofTCRβV+ T cells, e.g., a subset of memory effector T cells known as TEMRA. Without wishing to be bound by theory, it is believed that in some embodiments, TEMRA cells can promote tumor cell lysis but not CRS. Accordingly, provided herein are methods of making said anti-TCRβV antibody molecules andWSGR Docket No.53676-772.601 uses thereof. Also described herein are multispecific molecules, e.g., bispecific molecules comprising said anti-TCRβV antibody molecules. In some embodiments, compositions comprising anti-TCRβV antibody molecules of the present disclosure, can be used, e.g., to: (1) activate and redirect T cells to promote tumor cell lysis for cancer immuno-therapy; and / or (2) expand TCRβV+ T cells. In some embodiments, compositions comprising anti-TCRβV antibody molecules as described herein limit the harmful side-effects of CRS and / or NT, e.g., CRS and / or NT associated with anti-CD3e targeting.
[0075] In some embodiments, the anti-TCRβV antibody molecule binds to one or more of TRBV2,TRBV3-1, TRBV4-1, TRBV4-2, TRBV4-3, TRBV5-1, TRBV5-4, TRBV5-5, TRBV5-6, TRBV5-8, TRBV6-1, TRBV6-2, TRBV6-3, TRBV6-4, TRBV6-5, TRBV6-6, TRBV6-8, TRBV6-9, TRBV7-2, TRBV7-3, TRBV7-4, TRBV7-6, TRBV7-7, TRBV7-8, TRBV7-9, TRBV9, TRBV10-1, TRBV10-2, TRBV10-3, TRBV11-1, TRBV11-2, TRBV11-3, TRBV12-3, TRBV12-4, TRBV12-5, TRBV13, TRBV14, TRBV15, TRBV16, TRBV18, TRBV19, TRBV20-1, TRBV24-1, TRBV25-1, TRBV27, TRBV28, TRBV29-1 and TRBV30. In some embodiments, the anti-TCRβV antibody molecule binds to one or more of TRBV6-1, TRBV6-2, TRBV6-3, TRBV6-4, TRBV6-5, TRBV6-6, TRBV6-8 and TRBV6-9. In some embodiments, the anti-TCRβV antibody molecule is an anti-TRBV2, anti-TRBV3-1, anti-TRBV4-1, anti-TRBV4-2, anti-TRBV4-3, anti-TRBV5-1, anti-TRBV5-4, anti-TRBV5-5, anti- TRBV5-6, anti-TRBV5-8, anti-TRBV6-1, anti-TRBV6-2, anti-TRBV6-3, anti-TRBV6-4, anti-TRBV6-5, anti-TRBV6-6, anti-TRBV6-8, anti-TRBV6-9, anti-TRBV7-2, anti-TRBV7-3, anti-TRBV7-4, anti- TRBV7-6, anti-TRBV7-7, anti-TRBV7-8, anti-TRBV7-9, anti-TRBV9, anti-TRBV10-1, anti-TRBV10- 2, anti-TRBV10-3, anti-TRBV11-1, anti-TRBV11-2, anti-TRBV11-3, anti-TRBV12-3, anti-TRBV12-4, anti-TRBV12-5, anti-TRBV13, anti-TRBV14, anti-TRBV15, anti-TRBV16, anti-TRBV18, anti- TRBV19, anti-TRBV20-1, anti-TRBV24-1, anti-TRBV25-1, anti-TRBV27, anti-TRBV28, anti- TRBV29-1, or anti-TRBV30. Exemplary anti-TCRβV antibody molecules and the corresponding TCRβV subfamilies recognized by said anti-TCRβV antibody molecules are disclosed in Table 10A.
[0076] In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV2,TRBV3-1, TRBV4-1, TRBV4-2, TRBV4-3, TRBV5-1, TRBV5-4, TRBV5-5, TRBV5-6, TRBV5-8, TRBV6-1, TRBV6-2, TRBV6-3, TRBV6-4, TRBV6-5, TRBV6-6, TRBV6-8, TRBV6-9, TRBV7-2, TRBV7-3, TRBV7-4, TRBV7-6, TRBV7-7, TRBV7-8, TRBV7-9, TRBV9, TRBV10-1, TRBV10-2, TRBV10-3, TRBV11-1, TRBV11-2, TRBV11-3, TRBV12-3, TRBV12-4, TRBV12-5, TRBV13, TRBV14, TRBV15, TRBV16, TRBV18, TRBV19, TRBV20-1, TRBV24-1, TRBV25-1, TRBV27, TRBV28, TRBV29-1 or TRBV30. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-1. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-2. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-3. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-4. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-5. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-6. In some embodiments, the anti- TCRβV antibody molecule binds specifically to TRBV6-8. In some embodiments, the anti-TCRβV antibody molecule binds specifically to TRBV6-9.WSGR Docket No.53676-772.601
[0077] In some embodiments, the anti-TCRβV antibody molecule does not bind to TCRβ V12, or bindsto TCRβ V12 with an affinity and / or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and / or binding specificity of the 16G8 murine antibody or a humanized version thereof as de-scribed in US Patent 5,861,155.
[0078] In some embodiments, the anti-TCRβV antibody molecule binds to TCRβ V12 with an affinityand / or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and / or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
[0079] In some embodiments, the anti-TCRβV antibody molecule binds to a TCRβV region other thanTCRβ V12 (e.g., TCRβV region as described herein, e.g., TCRβ V6 subfamily (e.g., TCRβ V6-5*01) with an affinity and / or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and / or binding specificity of the 16G8 murine antibody or a humanized version thereof as de-scribed in US Patent 5,861,155.
[0080] In some embodiments, the anti-TCRβV antibody molecule does not comprise the CDRs of theAntibody B murine antibody.
[0081] In some embodiments, the anti-TCRβV antibody molecule does not bind to TCRβ V5-5*01 orTCRβ V5-1*01, or binds to TCRβ V5-5*01 or TCRβ V5-1*01 with an affinity and / or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and / or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
[0082] In some embodiments, the anti-TCRβV antibody molecule binds to TCRβ V5-5*01 or TCRβ V5-1*01with an affinity and / or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and / or binding specificity of the TM23 murine antibody or a humanized version thereof as de-scribed in US Patent 5,861,155.
[0083] In some embodiments, the anti-TCRβV antibody molecule binds to a TCRβV region other thanTCRβ V5-5*01 or TCRβ V5-1*01 (e.g., TCRβV region as described herein, e.g., TCRβ V6 subfamily (e.g., TCRβ V6-5*01) with an affinity and / or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and / or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
[0084] In some embodiments, the anti-TCRβV antibody molecule does not comprise the CDRs of theTM23 murine antibody.
[0085] In some embodiments, the light or the heavy chain variable framework (e.g., the regionencompassing at least FR1, FR2, FR3, and optionally FR4) of the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or aWSGR Docket No.53676-772.601 human consensus sequence; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (c) a non-human framework (e.g., a rodent framework); or (d) a non-human framework that has been modified, e.g., to remove antigenic or cytotoxic determinants, e.g., deimmunized, or partially humanized. In some embodiments, the light or heavy chain variable framework region (particularly FR1, FR2 and / or FR3) includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VL or VH segment of a human germline gene.
[0086] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a heavy chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIG.2A, or in SEQ ID NO: 9.
[0087] Alternatively, or in combination with the heavy chain substitutions described herein, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises a light chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more amino acid changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIG.2B, or in SEQ ID NO: 10 or SEQ ID NO: 11.
[0088] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes one, two, three, or four heavy chain framework regions shown in FIG.2A, or a sequence substantially identical thereto.
[0089] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes one, two, three, or four light chain framework regions shown in FIG.2B, or a sequence substantially identical thereto.
[0090] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises the light chain framework region 1 of A-H.1 or A-H.2, e.g., as shown in FIG.2B.
[0091] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises the light chain framework region 2 of A-H.1 or A-H.2, e.g., as shown in FIG.2B.
[0092] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises the light chain framework region 3 of A-H.1 or A-H.2, e.g., as shown in FIG.2B.WSGR Docket No.53676-772.601
[0093] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises the light chain framework region 4 of A-H.1 or A-H.2, e.g., as shown in FIG.2B.
[0094] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a light chain variable domain comprising a framework region, e.g., framework region 1 (FR1), comprising a change, e.g., a substitution (e.g., a conservative substitution) at position 10 according to Kabat numbering. In some embodiments, the FR1 comprises a Phenylalanine at position 10, e.g., a Serine to Phenylalanine substitution. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0095] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a light chain variable domain comprising a framework region, e.g., framework region 2 (FR2), comprising a change, e.g., a substitution (e.g., a conservative substitution) at a position as described herein according to Kabat numbering. In some embodiments, FR2 comprises a Histidine at position 36, e.g., a substitution at position 36 according to Kabat numbering, e.g., a Tyrosine to Histidine substitution. In some embodiments, FR2 comprises an Alanine at position 46, e.g., a substitution at position 46 according to Kabat numbering, e.g., an Arginine to Alanine substitution. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0096] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a light chain variable domain comprising a framework region, e.g., framework region 3 (FR3), comprising a change, e.g., a substitution (e.g., a conservative substitution) at a position as described herein according to Kabat numbering. In some embodiments, FR3 comprises a Phenylalanine at position 87, e.g., a substitution at position 87 according to Kabat numbering, e.g., a Tyrosine to Phenylalanine substitution. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0097] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a light chain variable domain comprising: (a) a framework region 1 (FR1) comprising a Phenylalanine at position 10, e.g., a substitution at position 10 according to Kabat numbering, e.g., a Serine to Phenylalanine substitution; (b) a framework region 2 (FR2) comprising a Histidine at position 36, e.g., a substitution at position 36 according to Kabat numbering, e.g., a Tyrosine to Histidine substitution, and a Alanine at position 46, e.g., a substitution at position 46 according to Kabat numbering, e.g., a Arginine to Alanine substitution; and (c) a framework region 3 (FR3) comprising a Phenylalanine at position 87, e.g., a substitution at position 87 according to Kabat numbering, e.g., a Tyrosine to Phenylalanine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 10. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0098] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a light chain variable domain comprising: (a) a frameworkWSGR Docket No.53676-772.601 region 2 (FR2) comprising a Histidine at position 36, e.g., a substitution at position 36 according to Kabat numbering, e.g., a Tyrosine to Histidine substitution, and a Alanine at position 46, e.g., a substitution at position 46 according to Kabat numbering, e.g., a Arginine to Alanine substitution; and (b) a framework region 3 (FR3) comprising a Phenylalanine at position 87, e.g., a substitution at position 87 according to Kabat numbering, e.g., a Tyrosine to Phenylalanine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 11. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0099] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a light chain variable domain comprising: (a) a framework region 1 (FR1) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) positions as described herein according to Kabat numbering, ; (b) a framework region 2 (FR2) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) position as described herein according to Kabat numbering and (c) a framework region 3 (FR3) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) position as described herein according to Kabat numbering. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0100] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises the heavy chain framework region 1 of A-H.1 or A-H.2, e.g., as shown in FIG.2A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the heavy chain framework region 2 of A-H.1 or A- H.2, e.g., as shown in FIG.2A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti- TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the heavy chain framework region 3 of A-H.1 or A-H.2, e.g., as shown in FIG.2A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the heavy chain framework region 4 of A-H.1 or A-H.2, e.g., as shown in FIG. 2A.
[0101] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a heavy chain variable domain comprising a framework region, e.g., framework region 3 (FR3), comprising a change, e.g., a substitution (e.g., a conservative substitution) at a position as described herein according to Kabat numbering. In some embodiments, FR3 comprises a Threonine at position 73, e.g., a substitution at position 73 according to Kabat numbering, e.g., a Glutamic Acid to Threonine substitution. In some embodiments, FR3 comprises a Glycine at position 94, e.g., a substitution at position 94 according to Kabat numbering, e.g., an Arginine to Glycine substitution. In some embodiments, the substitution is relative to a human germline heavy chain framework region sequence.
[0102] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a heavy chain variable domain comprising a framework region 3 (FR3) comprising a Threonine at position 73, e.g., a substitution at position 73 according to Kabat numbering, e.g., a Glutamic Acid to Threonine substitution, and a Glycine at position 94, e.g., aWSGR Docket No.53676-772.601 substitution at position 94 according to Kabat numbering, e.g., a Arginine to Glycine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 10.
[0103] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises the heavy chain framework regions 1-4 of A-H.1 or A-H.2, e.g., SEQ ID NO: 9, or as shown in FIGS.2A and 2B. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the light chain framework regions 1-4 of A-H.1, e.g., SEQ ID NO: 10, or as shown in FIGS.2A and 2B. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the light chain framework regions 1-4 of A-H.2, e.g., SEQ ID NO: 11, or as shown in FIGS.2A and 2B. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti- TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the heavy chain framework regions 1-4 of A-H.1, e.g., SEQ ID NO: 9; and the light chain framework regions 1-4 of A-H.1, e.g., SEQ ID NO: 10, or as shown in FIGS.2A and 2B. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, comprises the heavy chain framework regions 1-4 of A-H.2, e.g., SEQ ID NO: 9; and the light chain framework regions 1-4 of A-H.2, e.g., SEQ ID NO: 11, or as shown in FIGS.2A and 2B.
[0104] In some embodiments, the heavy or light chain variable domain, or both, of the anti-TCRβVantibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, includes an amino acid sequence, which is substantially identical to an amino acid as described herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or which differs at least 1 or 5 residues, but less than 40, 30, 20, or 10 residues, from a variable region of an antibody described herein.
[0105] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises at least one, two, three, or four antigen-binding regions, e.g., variable regions, having an amino acid sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 1. In another embodiment, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule includes a VH and / or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in Table 1.
[0106] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 9, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 9; and / or a VL domain comprising theWSGR Docket No.53676-772.601 amino acid sequence of SEQ ID NO: 10, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 10.
[0107] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 9, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 9; and / or a VL domain comprising the amino acid sequence of SEQ ID NO: 11, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 11.
[0108] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab')2, Fv, single domain antibody, or a single chain Fv fragment (scFv)). In embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule is a monoclonal antibody or an antibody with single specificity. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti- TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, can also be a humanized, chimeric, camelid, shark, or an in vitro-generated antibody molecule. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, is a humanized antibody molecule. The heavy and light chains of the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, a VHH, or a camelid antibody).
[0109] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, is in the form of a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
[0110] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE. In some embodiments, the Fc region is chosen from the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4. In some embodiments, the Fc region is chosen from the heavy chain constant region of IgG1 or IgG2 (e.g., human IgG1, or IgG2). In some embodiments, the heavy chain constant region is human IgG1. In some embodiments, the Fc region comprises a Fc region variant, e.g., as described herein.
[0111] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa). In some embodiments, the constantWSGR Docket No.53676-772.601 region is altered, e.g., mutated, to modify the properties of the anti-TCRβV antibody molecule, e.g., anti- TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function). For example, the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) to alter Fc receptor binding (e.g., the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to E), 316 (H to K) and 317 (N to F) of SEQ ID NOs: 215, 216, 217 or 218), e.g., relative to human IgG1.
[0112] Antibody A-H.1 comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 3278 and a light chain comprising the amino acid sequence of SEQ ID NO: 72. Antibody A-H.2 comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 3278 and a light chain comprising the amino acid sequence of SEQ ID NO: 3279. Antibody A-H.68 comprises the amino acid sequence of SEQ ID NO: 1337, or a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9%, or 100% sequence identity thereto. Antibody A-H.69 comprises the amino acid sequence of SEQ ID NO: 1500, or a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9%, or 100% sequence identity thereto.
[0113] Additional exemplary humanized anti-TCRB V6 antibodies are provided in Table 1. In some embodiments, the anti-TCRβ V6 is antibody A, e.g., humanized antibody A (antibody A-H), as provided in Table 1. In some embodiments, the anti-TCRβV antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 1; and / or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 1, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9%, or 100% sequence identity thereto. In some embodiments, antibody A comprises a variable heavy chain (VH) and / or a variable light chain (VL) provided in Table 1, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9%, or 100% sequence identity thereto.
[0114] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a VH of A-H.1, A-H.2, A-H.3, A-H.4, A-H.5, A-H.6, A-H.7, A- H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A-H.19, A- H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A-H.31, A- H.32, A-H.33, A-H.34, A-H.35, A-H.36, A-H.37, A-H.38, A-H.39, A-H.40, A-H.1, A-H.42, A-H.43, A- H.44, A-H.45, A-H.46, A-H.47, A-H.48, A-H.49, A-H.50, A-H.51, A-H.52, A-H.53, A-H.54, A-H.55, A- H.56, A-H.57, A-H.58, A-H.59, A-H.60, A-H.61, A-H.62, A-H.63, A-H.64, A-H.65, A-H.66, A-H.67, A- H.68, A-H.69, A-H.70, A-H.71, A-H.72, A-H.73, A-H.74, A-H.75, A-H.76, A-H.77, A-H.78, A-H.79, A- H.80, A-H.81, A-H.82, A-H.83, A-H.84, or A-H.85, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0115] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a VL of A-H.1, A-H.2, A-H.3, A-H.4, A-H.5, A-H.6, A-H.7, A- H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A-H.19, A-WSGR Docket No.53676-772.601 H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A-H.31, A- H.32, A-H.33, A-H.34, A-H.35, A-H.36, A-H.37, A-H.38, A-H.39, A-H.40, A-H.1, A-H.42, A-H.43, A- H.44, A-H.45, A-H.46, A-H.47, A-H.48, A-H.49, A-H.50, A-H.51, A-H.52, A-H.53, A-H.54, A-H.55, A- H.56, A-H.57, A-H.58, A-H.59, A-H.60, A-H.61, A-H.62, A-H.63, A-H.64, A-H.65, A-H.66, A-H.67, A- H.68, A-H.69, A-H.70, A-H.71, A-H.72, A-H.73, A-H.74, A-H.75, A-H.76, A-H.77, A-H.78, A-H.79, A- H.80, A-H.81, A-H.82, A-H.83, A-H.84, or A-H.85, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0116] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a VH of A-H.1, A-H.2, A-H.3, A-H.4, A-H.5, A-H.6, A-H.7, A- H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A-H.19, A- H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A-H.31, A- H.32, A-H.33, A-H.34, A-H.35, A-H.36, A-H.37, A-H.38, A-H.39, A-H.40, A-H.1, A-H.42, A-H.43, A- H.44, A-H.45, A-H.46, A-H.47, A-H.48, A-H.49, A-H.50, A-H.51, A-H.52, A-H.53, A-H.54, A-H.55, A- H.56, A-H.57, A-H.58, A-H.59, A-H.60, A-H.61, A-H.62, A-H.63, A-H.64, A-H.65, A-H.66, A-H.67, A- H.68, A-H.69, A-H.70, A-H.71, A-H.72, A-H.73, A-H.74, A-H.75, A-H.76, A-H.77, A-H.78, A-H.79, A- H.80, A-H.81, A-H.82, A-H.83, A-H.84, or A-H.85, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto; and a VL of A-H.1, A-H.2, A-H.3, A-H.4, A-H.5, A-H.6, A-H.7, A-H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A- H.19, A-H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A- H.31, A-H.32, A-H.33, A-H.34, A-H.35, A-H.36, A-H.37, A-H.38, A-H.39, A-H.40, A-H.1, A-H.42, A- H.43, A-H.44, A-H.45, A-H.46, A-H.47, A-H.48, A-H.49, A-H.50, A-H.51, A-H.52, A-H.53, A-H.54, A- H.55, A-H.56, A-H.57, A-H.58, A-H.59, A-H.60, A-H.61, A-H.62, A-H.63, A-H.64, A-H.65, A-H.66, A- H.67, A-H.68, A-H.69, A-H.70, A-H.71, A-H.72, A-H.73, A-H.74, A-H.75, A-H.76, A-H.77, A-H.78, A- H.79, A-H.80, A-H.81, A-H.82, A-H.83, A-H.84, or A-H.85, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0117] Exemplary anti-TCRβV antibody molecules and the corresponding TCRβV subfamilies recognized by said anti-TCRβV antibody molecules are disclosed in Table 10A.
[0118] The various TCRβV subfamilies and / or subfamily members can be expressed at different levels in individuals, e.g., healthy individuals, as disclosed in Kitaura K. et al (2016), BMC Immunology vol 17: 38, the entire contents of which are hereby incorporated by reference. For example, TCRβ V6-5 is represented in approximately 3-6% healthy donors.
[0119] The representation of various TCRBV subfamilies and / or subfamily members can also be different in cancer cells. For example, TCRβV is present in about 3-6% of tumor infiltrating T cells irrespective of tumor type (see Li B. et al., Nature Genetics, 2016, vol:48(7):725-32 the entire contents of which are hereby incorporated by references). Li et al., also disclose that TCRβ V6-5 is present at a high frequency in tumor cells.WSGR Docket No.53676-772.601 Anti-TCRβ V6 antibodies
[0120] In one aspect, provided herein is an anti-TCRβV antibody molecule that binds to human TCRβV6, e.g., a TCRβ V6 subfamily comprising: TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6-2*01, TCRβ V6-3*01 or TCRβ V6-1*01. In some embodiments the TCRβ V6 subfamily comprises TCRβ V6-5*01 or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-4*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-4*02, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-9*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-8*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-5*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-6*02, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-6*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-2*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-3*01, or a variant thereof. In some embodiments, TCRβ V6 comprises TCRβ V6-1*01, or a variant thereof.
[0121] In some embodiments, TCRβ V6-5*01 is encoded by the nucleic acid sequence of SEQ ID NO:43, or a sequence having 85%, 90%, 95%, 99% or more identity thereof. In some embodiments, TCRβ V6-5*01 comprises the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence having 85%, 90%, 95%, 99% or more identity thereof.
[0122] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, is a non-murine antibody molecule, e.g., a human or humanized antibody molecule. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti- TCRβ V6-5*01) antibody molecule is a human antibody molecule. In some embodiments, the anti- TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule is a humanized antibody molecule.
[0123] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, is isolated or recombinant.
[0124] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises at least one antigen-binding region, e.g., a variable region or an antigen-binding fragment thereof, from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0125] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A- H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.WSGR Docket No.53676-772.601
[0126] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody molecule described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0127] In some embodiments, the anti-TCRβV antibody molecule comprises a heavy chain variableregion (VH) having a consensus sequence of SEQ ID NO: 231 or 3290.
[0128] SEQ ID NO: 231 - Consensus VH QVQLVQSGAEVKKPGSSVKVSCKASGH / T / G / YD / T / SFH / R / D / K / TL / D / K / T / NW / F / T / I / Y / GYIHWV RQAPGQGLEWMGR / WV / I / FF / S / YA / PGSGN / ST / V / Y / IK / RYNEKFKGRVTITADTSTSTAYMELSS LRSEDTAVYYCAG / VSY / IYSY / AD / GVLDYWGQGTTVTVSS
[0129] SEQ ID NO: 3290 - Consensus VH QVQLVQSGAEVKKPGSSVKVSCKASGX1X2FX3X4X5YIHWVRQAPGQGLEWMGX6X7X8X9GSGX10X11X12YNEKFKGRVTITADTSTSTAYMELSSLRSEDTAVYYCAX13SX14YSX15X16VLDYWGQGT TVTVSS, where-in: X1 is H or T or G or Y; X2 is D or T or S; X3 is H or R or D or K or T; X4 is L or D or K or T or N; X5 is W or F or T or I or Y or G; X6 is R or W; X7 is V or I or F; X8 is F or S or Y; X9 is A or P; X10 is N or S; X11 is T or V or Y or I; X12 is K or R; X13 is G or V; X14 is Y or I; X15 is Y or A; and X16 is D or G.
[0130] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A- H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0131] In some embodiments, the anti-TCRβV antibody molecule comprises a light chain variableregion (VL) having a consensus sequence of SEQ ID NO: 230 or 3289.
[0132] SEQ ID NO: 230 - Consensus VL DIQMTQSPSFLSASVGDRVTITCKASQNVG / E / A / DN / DR / KVAWY / HQQKPGKAPKALIYSSSHRY K / SGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQFKSYPLTFGQGTKLEIK
[0133] SEQ ID NO: 3289 - Consensus VL DIQMTQSPSFLSASVGDRVTITCKASQNVX1X2X3VAWX4QQKPGKAPKALIYSSSHRYX5GVPSRF SGSGSGTEFTLTISSLQPEDFATYFCQQFKSYPLTFGQGTKLEIK, wherein X1 is G, E, A or D; X2 is N or D; X3 is R or K; X4 is Y or H; and X5 is K or S
[0134] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, comprises a heavy chain constant region for an IgG4, e.g., a human IgG4. In still another embodiment, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1. InWSGR Docket No.53676-772.601 some embodiments, the heavy chain constant region comprises an amino sequence set forth in Table 3, 21, or 22, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
[0135] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes a kappa light chain constant region, e.g., a human kappa light chain constant region. In some embodiments, the light chain constant region comprises an amino sequence set forth in Table 3, 21, or 22, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
[0136] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region (VH) of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0137] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1. In some embodiments, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
[0138] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, or three complementarity determining regions (CDRs) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0139] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1. In some embodiments, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
[0140] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1. In some embodiments, one or more ofWSGR Docket No.53676-772.601 the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
[0141] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, molecule includes all six CDRs from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or closely related CDRs, e.g., CDRs which are identical or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions). In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, may include any CDR described herein.
[0142] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A- H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al. shown in Table 1.
[0143] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A- H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al. shown in Table 1.
[0144] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three orWSGR Docket No.53676-772.601 four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to Kabat et al. shown in Table 1.
[0145] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A- H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Kabat et al. shown in Table 1. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, may include any CDR described herein.
[0146] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, or three hypervariable loops that have the same canonical structures as the corresponding hypervariable loop of an antibody described herein, e.g., an antibody chosen from chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, e.g., the same canonical structures as at least loop 1 and / or loop 2 of the heavy and / or light chain variable domains of an antibody described herein. See, e.g., Chothia et al., (1992) J. Mol. Biol.227:799-817; Tomlinson et al., (1992) J. Mol. Biol.227:776-798 for descriptions of hypervariable loop canonical structures. These structures can be determined by inspection of the tables described in these references.
[0147] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule includes at least one, two, or three CDRs according to Chothia et al. (e.g., at least one, two, or three CDRs according to the Chothia definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or as described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al. shown in Table 1.
[0148] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule includes at least one, two, or three CDRs according to Chothia et al. (e.g., at least one, two, or three CDRs according to the Chothia definition as set out in Table 1) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A- H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three orWSGR Docket No.53676-772.601 four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al. shown in Table 1.
[0149] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes at least one, two, three, four, five, or six CDRs according to Chothia et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Chothia definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to Chothia et al. shown in Table 1.
[0150] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, includes all six CDRs according to Chothia et al. (e.g., all six CDRs according to the Chothia definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Chothia et al. shown in Table 1. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, may include any CDR described herein.
[0151] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, molecule includes a combination of CDRs or hypervariable loops defined according to Kabat et al., Chothia et al., by ImMunoGeneTics (IMGT) numbering system or as described in Table 1.
[0152] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions, or by ImMunoGeneTics (IMGT) numbering system.
[0153] In some embodiments, a combined CDR as set out in Table 1 is a CDR that comprises a KabatCDR and a Chothia CDR.
[0154] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule, molecule includes a combination of CDRs or hypervariable loops identified as combined CDRs in Table 1. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6-5*01) antibody molecule, can contain any combination of CDRs or hypervariable loops according the “combined” CDRs are described in Table 1.WSGR Docket No.53676-772.601
[0155] In some embodiments, e.g., an embodiment comprising a variable region, a CDR (e.g., acombined CDR, Chothia CDR or Kabat CDR, or by ImMunoGeneTics (IMGT) numbering system), or other sequence referred to herein, e.g., in Table 1, the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, a bivalent antibody molecule, a biparatopic antibody molecule, or an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody. In certain embodiments the antibody molecule comprises a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
[0156] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule includes: (i) one, two or all of a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11, and / or (ii) one, two or all of a heavy chain complementarity determining region 1 (HC CDR1), heavy chain complementarity determining region 2 (HC CDR2), and a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 1 or SEQ ID NO: 9.
[0157] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 of SEQ ID NO: 2, and a HC CDR1, HC CDR2, and HC CDR3 of SEQ ID NO: 1.
[0158] In some embodiments the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 of SEQ ID NO: 10, and a HC CDR1, HC CDR2, and HC CDR3 of SEQ ID NO: 9.
[0159] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 of SEQ ID NO: 11, and a HC CDR1, HC CDR2, and HC CDR3 of SEQ ID NO: 9.
[0160] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 6, a LC CDR2 amino acid sequence of SEQ ID NO: 7, or a LC CDR3 amino acid sequence of SEQ ID NO: 8; and / or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 3, a HC CDR2 amino acid sequence of SEQ ID NO: 4, or a HC CDR3 amino acid sequence of SEQ ID NO: 5.
[0161] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 6, a LC CDR2 amino acid sequence of SEQ ID NO: 7, or a LC CDR3 amino acid sequence of SEQ ID NO: 8; and / or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 3, a HC CDR2 amino acid sequence of SEQ ID NO: 4, or a HC CDR3 amino acid sequence of SEQ ID NO: 5.
[0162] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 51, a LC CDR2 amino acid sequence of SEQ ID NO: 52, or a LC CDR3 amino acid sequence of SEQ ID NO: 53;WSGR Docket No.53676-772.601 and / or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 45, a HC CDR2 amino acid sequence of SEQ ID NO: 46, or a HC CDR3 amino acid sequence of SEQ ID NO: 47.
[0163] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 51, a LC CDR2 amino acid sequence of SEQ ID NO: 52, or a LC CDR3 amino acid sequence of SEQ ID NO: 53; and / or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 45, a HC CDR2 amino acid sequence of SEQ ID NO: 46, or a HC CDR3 amino acid sequence of SEQ ID NO: 47.
[0164] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 54, a LC CDR2 amino acid sequence of SEQ ID NO: 55, or a LC CDR3 amino acid sequence of SEQ ID NO: 56; and / or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 48, a HC CDR2 amino acid sequence of SEQ ID NO: 49, or a HC CDR3 amino acid sequence of SEQ ID NO: 50.
[0165] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 54, a LC CDR2 amino acid sequence of SEQ ID NO: 55, or a LC CDR3 amino acid sequence of SEQ ID NO: 56; and / or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 48, a HC CDR2 amino acid sequence of SEQ ID NO: 49, or a HC CDR3 amino acid sequence of SEQ ID NO: 50.
[0166] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a VH and / or a VL of an antibody described in Table 1, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0167] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβV6-5*01) antibody molecule comprises a VH and a VL of an antibody described in Table 1, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0168] In some embodiments, an anti-TCRVb antibody as described herein has an antigen bindingdomain having a VL having a consensus sequence of SEQ ID NO: 230, wherein position 30 is G, E, A or D; position 31 is N or D; position 32 is R or K; position 36 is Y or H; and / or position 56 is K or S.
[0169] In some embodiments, an anti-TCRVb antibody as described herein has an antigen bindingdomain having a VH having a consensus sequence of SEQ ID NO: 231, wherein: position 27 is H or T or G or Y; position 28 is D or T or S; position 30 is H or R or D or K or T; position 31 is L or D or K or T or N; position 32 is W or F or T or I or Y or G; position 49 is R or W; position 50 is V or I or F; position 51 is F or S or Y; position 52 is A or P; position 56 is N or S; position 57 is T or V or Y or I; position 58 is K or R; position 97 is G or V; position 99 is Y or I; position 102 is Y or A; and / or position 103 is D or G.WSGR Docket No.53676-772.601 Anti-TCRβ V12 antibodies
[0170] In one aspect, provided herein is an anti-TCRβV antibody molecule that binds to human TCRβV12, e.g., a TCRβ V12 subfamily comprising: TCRβ V12-4*01, TCRβ V12-3*01 or TCRβ V12-5*01. In some embodiments the TCRβ V12 subfamily comprises TCRβ V12-4*01. In some embodiments the TCRβ V12 subfamily comprises TCRβ V12-3*01.
[0171] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, is a non-murine antibody molecule, e.g., a human or humanized antibody molecule. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule is a human antibody molecule. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule is a humanized antibody molecule.
[0172] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, is isolated or recombinant.
[0173] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, comprises at least one antigen-binding region, e.g., a variable region or an antigen-binding fragment thereof, from an antibody described herein, e.g., an antibody described in Table 2, or encoded by a nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0174] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody as described in Table 2, or encoded by a nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0175] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody as described in Table 2, or encoded by a nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0176] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody as described in Table 2, or encoded by a nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0177] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, comprises a heavy chain constant region for an IgG4, e.g., a human IgG4. In still another embodiment, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule, includes a heavy chain constant region for an IgG1, e.g., a human IgG1. In some embodiments, the heavy chain constant region comprises an amino sequence set forth in Table 3, 21, or 22, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.WSGR Docket No.53676-772.601
[0178] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, includes a kappa light chain constant region, e.g., a human kappa light chain constant region. In some embodiments, the light chain constant region comprises an amino sequence set forth in Table 3, 21, or 22, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
[0179] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0180] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2. In some embodiments, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
[0181] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, includes at least one, two, or three complementarity determining regions (CDRs) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
[0182] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2. In some embodiments, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
[0183] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2. In some embodiments, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
[0184] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, molecule includes all six CDRs from an antibody described herein, e.g., an antibody asWSGR Docket No.53676-772.601 described in Table 2, or encoded by the nucleotide sequence in Table 2, or closely related CDRs, e.g., CDRs which are identical or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions). In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule, may include any CDR described herein.
[0185] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 2) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al. shown in Table 2.
[0186] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 2) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al. shown in Table 2.
[0187] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to Kabat et al. shown in Table 2.
[0188] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs accordingWSGR Docket No.53676-772.601 to Kabat et al. shown in Table 2. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti- TCRβ V12 antibody molecule may include any CDR described herein.
[0189] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the corresponding hypervariable loop of an antibody described herein, e.g., an antibody described in Table 2, e.g., the same canonical structures as at least loop 1 and / or loop 2 of the heavy and / or light chain variable domains of an antibody described herein. See, e.g., Chothia et al., (1992) J. Mol. Biol.227:799- 817; Tomlinson et al., (1992) J. Mol. Biol.227:776-798 for descriptions of hypervariable loop canonical structures. These structures can be determined by inspection of the tables described in these references.
[0190] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three CDRs according to Chothia et al. (e.g., at least one, two, or three CDRs according to the Chothia definition as set out in Table 2) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al. shown in Table 2.
[0191] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three CDRs according to Chothia et al. (e.g., at least one, two, or three CDRs according to the Chothia definition as set out in Table 2) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al. shown in Table 2.
[0192] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, three, four, five, or six CDRs according to Chothia et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Chothia definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to Chothia et al. shown in Table 2.
[0193] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes all six CDRs according to Chothia et al. (e.g., all six CDRs according to the Chothia definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; orWSGR Docket No.53676-772.601 encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Chothia et al. shown in Table 2. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti- TCRβ V12 antibody molecule may include any CDR described herein.
[0194] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three CDRs according to a combined CDR (e.g., at least one, two, or three CDRs according to the combined CDR definition as set out in Table 2) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to combined CDR shown in Table 2.
[0195] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, or three CDRs according to a combined CDR (e.g., at least one, two, or three CDRs according to the combined CDR definition as set out in Table 2) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to a combined CDR shown in Table 2.
[0196] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes at least one, two, three, four, five, or six CDRs according to a combined CDR. (e.g., at least one, two, three, four, five, or six CDRs according to the combined CDR definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to a combined CDR shown in Table 2.
[0197] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes all six CDRs according to a combined CDR (e.g., all six CDRs according to the combined CDR definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three orWSGR Docket No.53676-772.601 four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to a combined CDR shown in Table 2. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule may include any CDR described herein.
[0198] In some embodiments, a combined CDR as set out in Table 1 is a CDR that comprises a KabatCDR and a Chothia CDR or by ImMunoGeneTics (IMGT) numbering system.
[0199] In some embodiments, the anti-TCRβV antibody molecule, e e.g., anti-TCRβ V12 antibodymolecule, molecule includes a combination of CDRs or hypervariable loops identified as combined CDRs in Table 1. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule, can contain any combination of CDRs or hypervariable loops according the “combined” CDRs are described in Table 1.
[0200] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes a combination of CDRs or hypervariable loops defined according to the Kabat et al. and Chothia et al., by ImMunoGeneTics (IMGT) numbering system, or as described in Table 1.
[0201] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions, or by ImMunoGeneTics (IMGT) numbering system.
[0202] In some embodiments, e.g., an embodiment comprising a variable region, a CDR (e.g., acombined CDR, Chothia CDR or Kabat CDR, or by ImMunoGeneTics (IMGT) numbering system), or other sequence referred to herein, e.g., in Table 2, the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, a bivalent antibody molecule, a biparatopic antibody molecule, or an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody. In certain embodiments the antibody molecule comprises a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
[0203] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes: (i) one, two or all of a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 16, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30, and / or (ii) one, two or all of a heavy chain complementarity determining region 1 (HC CDR1), heavy chain complementarity determining region 2 (HC CDR2), and a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25.
[0204] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 20, a LC CDR2 amino acid sequence of SEQ ID NO: 21, or a LC CDR3 amino acid sequence of SEQ ID NO: 22; and / or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 17, a HC CDR2 amino acid sequence of SEQ ID NO: 18, or a HC CDR3 amino acid sequence of SEQ ID NO: 19.
[0205] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequenceWSGR Docket No.53676-772.601 of SEQ ID NO: 20, a LC CDR2 amino acid sequence of SEQ ID NO: 21, and a LC CDR3 amino acid sequence of SEQ ID NO: 2; and / or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 17, a HC CDR2 amino acid sequence of SEQ ID NO: 18, and a HC CDR3 amino acid sequence of SEQ ID NO: 19.
[0206] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 63, a LC CDR2 amino acid sequence of SEQ ID NO: 64, or a LC CDR3 amino acid sequence of SEQ ID NO: 65; and / or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 57, a HC CDR2 amino acid sequence of SEQ ID NO: 58, or a HC CDR3 amino acid sequence of SEQ ID NO: 59.
[0207] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 63, a LC CDR2 amino acid sequence of SEQ ID NO: 64, or a LC CDR3 amino acid sequence of SEQ ID NO: 65; and / or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 57, a HC CDR2 amino acid sequence of SEQ ID NO: 58, or a HC CDR3 amino acid sequence of SEQ ID NO: 59.
[0208] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 66, a LC CDR2 amino acid sequence of SEQ ID NO: 67, or a LC CDR3 amino acid sequence of SEQ ID NO: 68; and / or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 60, a HC CDR2 amino acid sequence of SEQ ID NO: 61, or a HC CDR3 amino acid sequence of SEQ ID NO: 62.
[0209] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 63, a LC CDR2 amino acid sequence of SEQ ID NO: 64, or a LC CDR3 amino acid sequence of SEQ ID NO: 65; and / or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 57, a HC CDR2 amino acid sequence of SEQ ID NO: 58, or a HC CDR3 amino acid sequence of SEQ ID NO: 59.
[0210] In some embodiments, the light or the heavy chain variable framework (e.g., the regionencompassing at least FR1, FR2, FR3, and optionally FR4) of the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (c) a non-human framework (e.g., a rodent framework); or (d) a non-human framework that has been modified, e.g., to remove antigenic or cytotoxic determinants, e.g., deimmunized, or partially humanized. In some embodiments, the light or heavy chain variableWSGR Docket No.53676-772.601 framework region (particularly FR1, FR2 and / or FR3) includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VL or VH segment of a human germline gene.
[0211] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule, comprises a heavy chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more changes, e.g., amino acid substitutions or deletions, from an amino acid sequence described in Table 2.e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIGS.3A and 3B, or in SEQ ID NOs: 23-25.
[0212] Alternatively, or in combination with the heavy chain substitutions described herein the anti- TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more amino acid changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of an antibody described herein .e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIGS.3A and 3B, or in SEQ ID NOs: 26-30.
[0213] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes one, two, three, or four heavy chain framework regions shown in FIG.3A, or a sequence substantially identical thereto.
[0214] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule includes one, two, three, or four light chain framework regions shown in FIG.3B, or a sequence substantially identical thereto. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the light chain framework region 1 e.g., as shown in FIG. 3B. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the light chain framework region 2 e.g., as shown in FIG.3B. In some embodiments, the anti- TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the light chain framework region 3, e.g., as shown in FIG.3B. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti- TCRβ V12 antibody molecule comprises the light chain framework region 4, e.g., as shown in FIG.3B.
[0215] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more, e.g., all, position as described herein according to Kabat numbering. In some embodiments, FR1 comprises an Aspartic Acid at position 1, e.g., a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution. In some embodiments, FR1 comprises an Asparagine at position 2, e.g., a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution. In some embodiments, FR1 comprises a Leucine at position 4, e.g., a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution.
[0216] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1),WSGR Docket No.53676-772.601 comprising a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution, a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution, and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution, and a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution. In some embodiments, the anti- TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution, and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution, and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0217] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more, e.g., all, position as described herein according to Kabat numbering. In some embodiments, FR3 comprises a Glycine at position 66, e.g., a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution. In some embodiments, FR3 comprises an Asparagine at position 69, e.g., a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution. In some embodiments, FR3 comprises a Tyrosine at position 71, e.g., a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution.
[0218] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution, and a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution.. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 66 according to Kabat numbering, e.g., Lysine to Glycine substitution, or a Serine to Glycine substitution, and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an AlanineWSGR Docket No.53676-772.601 to Tyrosine substitution. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution, a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0219] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising: a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Isoleucine to Asparagine substitution; and a framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 26. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0220] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 1 according to Kabat numbering, e.g., a Alanine to Aspartic Acid substitution, and a substitution at position 2 according to Kabat numbering, e.g., a Isoleucine to Asparagine substitution; and (b) a framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 27 In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0221] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Serine to Asparagine substitution; and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution; and (b) a framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 28 In some embodiments, the substitution is relative to a human germline light chain framework region sequence.WSGR Docket No.53676-772.601
[0222] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Serine to Asparagine substitution; and (b) a framework region 3 (FR3) comprising a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution; a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution; and a substitution at position 71 according to Kabat numbering, e.g., a Alanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 29. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0223] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution; and (b) a framework region 3 (FR3) comprising a substitution at position 66 according to Kabat numbering, e.g., a Serine to Glycine substitution; a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution; and a substitution at position 71 according to Kabat numbering, e.g., a Alanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 29. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0224] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises a light chain variable domain comprising: (a) a framework region 1 (FR1) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) positions as described herein according to Kabat numbering, and (b) a framework region 3 (FR3) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) position as described herein according to Kabat numbering. In some embodiments, the substitution is relative to a human germline light chain framework region sequence.
[0225] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises the heavy chain framework region 1, e.g., as shown in FIG.3A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the heavy chain framework region 2, e.g., as shown in FIG.3A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the heavy chain framework region 3, e.g., as shown in FIG.3A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the heavy chain framework region 4, e.g., as shown in FIG.3A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the heavy chain framework regions 1-4, e.g., SEQ ID NOS: 20-23, or as shown in FIG.3A. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises the light chain framework regions 1-4, e.g., SEQ ID NOs: 26-30, or as shown in FIG.3B.WSGR Docket No.53676-772.601
[0226] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises the heavy chain framework regions 1-4, e.g., SEQ ID NOs: 23-25; and the light chain framework regions 1-4, e.g., SEQ ID NOs: 26-30, or as shown in FIGS.3A and 3B.
[0227] In some embodiments, the heavy or light chain variable domain, or both, of , the anti-TCRβVantibody molecule, e.g., anti-TCRβ V12 antibody molecule includes an amino acid sequence, which is substantially identical to an amino acid as described herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or which differs at least 1 or 5 residues, but less than 40, 30, 20, or 10 residues, from a variable region of an antibody described herein.
[0228] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises at least one, two, three, or four antigen-binding regions, e.g., variable regions, having an amino acid sequence as set forth in Table 2, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 2. In another embodiment, , the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule includes a VH and / or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in Table 2, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in Table 2.
[0229] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising an amino acid sequence chosen from the amino acid sequence of SEQ ID NO: 23, SEQ ID NO:24 or SEQ ID NO:25, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, SEQ ID NO:24 or SEQ ID NO:25, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23, SEQ ID NO:24 or SEQ ID NO:25; and / or a VL domain comprising an amino acid sequence chosen from the amino acid sequence of SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 26, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequenceWSGR Docket No.53676-772.601 SEQ ID NO: 26, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 26.
[0230] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 27, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 27, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 27.
[0231] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 28, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 28, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 28.
[0232] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 29, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 29, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 29.
[0233] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 30, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 30.
[0234] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 24 or 25, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 24 or 25, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 aminoWSGR Docket No.53676-772.601 acid residues from the amino acid sequence of SEQ ID NO: 24 or 25; and a VL domain comprising the amino acid sequence of SEQ ID NO: 26, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 26, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 26.
[0235] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 24 or 25, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 24 or 25, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 24 or 25; and a VL domain comprising the amino acid sequence of SEQ ID NO: 27, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 27, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 27.
[0236] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 24 or 25, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 24 or 25, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 24 or 25; and a VL domain comprising the amino acid sequence of SEQ ID NO: 28, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 28, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 28.
[0237] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 24 or 25, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 24 or 25, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 24 or 25; and a VL domain comprising the amino acid sequence of SEQ ID NO: 29, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 29, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 29.
[0238] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 24 or 25, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 24 or 25, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 24 or 25; and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 30, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 30.
[0239] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 25 or 23, anWSGR Docket No.53676-772.601 amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 25 or 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 25 or 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 26, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 26, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 26.
[0240] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 25 or 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 25 or 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 25 or 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 27, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 27, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 27.
[0241] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 25 or 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 25 or 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 25 or 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 28, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 28, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 28.
[0242] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 25 or 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 25 or 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 25 or 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 29, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 29, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 29.
[0243] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 25 or 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 25 or 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 25 or 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 30, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 30.WSGR Docket No.53676-772.601
[0244] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule is a full antibody or fragment thereof (e.g., a Fab, F(ab')2, Fv, or a single chain Fv fragment (scFv)). In embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V6 (e.g., anti-TCRβ V6- 5*01) antibody molecule is a monoclonal antibody or an antibody with single specificity. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule, can also be a humanized, chimeric, camelid, shark, or an in vitro-generated antibody molecule. In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule is a humanized antibody molecule. The heavy and light chains of the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, a VHH, or a camelid antibody).
[0245] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule is in the form of a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
[0246] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE. In some embodiments, the Fc region is chosen from the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4. In some embodiments, the Fc region is chosen from the heavy chain constant region of IgG1 or IgG2 (e.g., human IgG1, or IgG2). In some embodiments, the heavy chain constant region is human IgG1.
[0247] In some embodiments, the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibodymolecule has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa). In some embodiments, the constant region is altered, e.g., mutated, to modify the properties of the anti-TCRβV antibody molecule, e.g., anti-TCRβ V12 antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function). For example, the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) to alter Fc receptor binding (e.g., the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to E), 316 (H to K) and 317 (N to F) of SEQ ID NOs: 215, 216, 217 or 218).
[0248] Antibody B-H.1 comprises a first chain comprising the amino acid sequence of SEQ ID NO: 3280 and a second chain comprising the amino acid sequence of SEQ ID NO: 3281.
[0249] Additional exemplary anti-TCRβ V12 antibodies are provided in Table 2. In some embodiments, the anti-TCRβ V12 is antibody B, e.g., humanized antibody B (antibody B-H), as provided in Table 2. In some embodiments, the anti-TCRβV antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 2; and / or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 2, or a sequence with at least 95% sequence identity thereto. InWSGR Docket No.53676-772.601 some embodiments, antibody B comprises a variable heavy chain (VH) and / or a variable light chain (VL) provided in Table 2, or a sequence with at least 95% sequence identity thereto.
[0250] In some embodiments, the anti-TCRVB 12 antibody molecule (e.g., anti-TCRVB 12-3 or anti-TCRVB 12-4 antibody molecule) comprises a VH of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B- H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0251] In some embodiments, the anti-TCRVB 12 antibody molecule (e.g., anti-TCRVB 12-3 or anti-TCRVB 12-4 antibody molecule) comprises a VL of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B- H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
[0252] In some embodiments, the anti-TCRVB 12 antibody molecule (e.g., anti-TCRVB 12-3 or anti-TCRVB 12-4 antibody molecule) comprises a VH of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B- H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto; and a VL of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B-H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto. Anti-TCRβ V5 antibodies
[0253] In one aspect, provided herein is an anti-TCRβV antibody molecule that binds to human TCRβV5. In some embodiments, the TCRβ V5 subfamily comprises TCRβ V5-5*01, TCRβ V5-6*01, TCRβ V5-4*01, TCRβ V5-8*01, TCRβ V5-1*01, or a variant thereof. Anti-TCRβ V10 antibodies
[0254] In one aspect, provided herein is an anti-TCRβV antibody molecule that binds to a human TCRβV10 subfamily member. In some embodiments, TCRβ V10 subfamily is also known as TCRβ V12. In some embodiments, the TCRβ V10 subfamily comprises: TCRβ V10-1*01, TCRβ V10-1*02, TCRβ V10-3*01 or TCRβ V10-2*01, or a variant thereof.
[0255] Exemplary anti-TCRβ V10 antibodies are provided in Table 12. In some embodiments, the anti- TCRβ V10 is antibody D, e.g., humanized antibody D (antibody D-H), as provided in Table 12. In some embodiments, antibody D comprises one or more (e.g., three) light chain CDRs and / or one or more (e.g., three) heavy chain CDRs provided in Table 12, or a sequence with at least 95% sequence identity thereto. In some embodiments, antibody D comprises a variable heavy chain (VH) and / or a variable light chain (VL) provided in Table 12, or a sequence with at least 95% sequence identity thereto.
[0256] In some embodiments, the anti-TCRβ V10 antibody molecule comprises a VH or a VL of anantibody described in Table 12, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.WSGR Docket No.53676-772.601
[0257] In some embodiments, the anti-TCRβ V10 antibody molecule comprises a VH and a VL of anantibody described in Table 12, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto. Additional anti-TCRVβ antibodies
[0258] Additional exemplary anti-TCRβV antibodies are provided in Table 13. In some embodiments, the anti-TCRβV antibody is a humanized antibody, e.g., as provided in Table 13. In some embodiments, the anti-TCRβV antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 13; and / or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 13, or a sequence with at least 95% sequence identity thereto. In some embodiments, the anti-TCRβV antibody comprises a variable heavy chain (VH) and / or a variable light chain (VL) provided in Table 13, or a sequence with at least 95% sequence identity thereto. Antibody-like Frameworks or Scaffolds
[0259] A wide variety of antibody / immunoglobulin frameworks or scaffolds can be employed in the anti-TCRvb antibody molecules as described herein or multifunctional formats thereof so long as the resulting polypeptide includes at least one binding region which specifically binds to the target antigen, e.g., a TCRvb, a tumor antigen, among others. Such frameworks or scaffolds include the 5 main idiotypes of human immunoglobulins, or fragments thereof, and include immunoglobulins of other animal species, preferably having humanized aspects. Novel frameworks, scaffolds and fragments continue to be discovered and developed by those skilled in the art.
[0260] In some embodiments, the anti-TCRvb antibody molecules as described herein or multifunctionalformats thereof include non-immunoglobulin based antibodies using non- immunoglobulin scaffolds onto which CDRs can be grafted. Any non-immunoglobulin frameworks and scaffolds may be employed, as long as they comprise a binding region specific for the target antigen (e.g., TCRvb or a tumor antigen). Exemplary non-immunoglobulin frameworks or scaffolds include, but are not limited to, fibronectin (Compound Therapeutics, Inc., Waltham, MA), ankyrin (Molecular Partners AG, Zurich, Switzerland), domain antibodies (Domantis, Ltd., Cambridge, MA, and Ablynx nv, Zwijnaarde, Belgium), lipocalin (Pieris Proteolab AG, Freising, Germany), small modular immuno-pharmaceuticals (Trubion Pharmaceuticals Inc., Seattle, WA), maxybodies (Avidia, Inc., Mountain View, CA), Protein A (Affibody AG, Sweden), and affilin (gamma-crystallin or ubiquitin) (Scil Proteins GmbH, Halle, Germany).
[0261] Fibronectin scaffolds are typically based on fibronectin type III domain (e.g., the tenth module of the fibronectin type III (10 Fn3 domain)). The fibronectin type III domain has 7 or 8 beta strands which are distributed between two beta sheets, which themselves pack against each other to form the core of the protein, and further containing loops (analogous to CDRs) which connect the beta strands to each other and are solvent exposed. There are at least three such loops at each edge of the beta sheet sandwich, where the edge is the boundary of the protein perpendicular to the direction of the beta strands (see USWSGR Docket No.53676-772.601 6,818,418). Because of this structure, the non-immunoglobulin antibody mimics antigen binding properties that are similar in nature and affinity to those of antibodies. These scaffolds can be used in a loop randomization and shuffling strategy in vitro that is similar to the process of affinity maturation of antibodies in vivo. These fibronectin-based molecules can be used as scaffolds where the loop regions of the molecule can be replaced with CDRs of the invention using standard cloning techniques.
[0262] The ankyrin technology is based on using proteins with ankyrin derived repeat modules as scaffolds for bearing variable regions which can be used for binding to different targets. The ankyrin repeat module typically is a about 33 amino acid polypeptide consisting of two anti-parallel α-helices and a β-turn. Binding of the variable regions can be optimized by using ribosome display.
[0263] Avimers are used by nature for protein-protein interactions and in human over 250 proteins are structurally based on A-domains. Avimers consist of a number of different “A-domain” monomers (2-10) linked via amino acid linkers. Avimers can be created that can bind to the target antigen using the methodology described in, for example, U.S. Patent Application Publication Nos.20040175756; 20050053973; 20050048512; and 20060008844.
[0264] Affibody affinity ligands are small, simple proteins composed of a three-helix bundle based on the scaffold of one of the IgG-binding domains of Protein A. Protein A is a surface protein from the bacterium Staphylococcus aureus. This scaffold domain consists of 58 amino acids, 13 of which are randomized to generate affibody libraries with a large number of ligand variants (See e.g., US 5,831,012). Affibody molecules mimic antibodies, they have a molecular weight of 6 kDa, compared to the molecular weight of antibodies, which is 150 kDa. In spite of its small size, the binding site of affibody molecules is similar to that of an antibody.
[0265] Anticalins are known commercially, e.g., Pieris ProteoLab AG. They are derived from lipocalins, a widespread group of small and robust proteins that are usually involved in the physiological transport or storage of chemically sensitive or insoluble compounds. Several natural lipocalins occur in human tissues or body liquids. The protein architecture is reminiscent of immunoglobulins, with hypervariable loops on top of a rigid framework. However, in contrast with antibodies or their recombinant fragments, lipocalins are composed of a single polypeptide chain with 160 to 180 amino acid residues, being just marginally bigger than a single immunoglobulin domain. The set of four loops, which makes up the binding pocket, shows pronounced structural plasticity and tolerates a variety of side chains. The binding site can thus be reshaped in a proprietary process in order to recognize prescribed target molecules of different shape with high affinity and specificity. One protein of lipocalin family, the bilin-binding protein (BBP) of Pieris Brassicae has been used to develop anticalins by mutagenizing the set of four loops. One example of a patent application describing anticalins is in PCT Publication No. WO 199916873.
[0266] Affilin molecules are small non-immunoglobulin proteins which are designed for specific affinities towards proteins and small molecules. New affilin molecules can be very quickly selected from two libraries, each of which is based on a different human derived scaffold protein. Affilin molecules do not show any structural homology to immunoglobulin proteins. Currently, two affilin scaffolds areWSGR Docket No.53676-772.601 employed, one of which is gamma crystalline, a human structural eye lens protein and the other is “ubiquitin” superfamily proteins. Both human scaffolds are very small, show high temperature stability and are almost resistant to pH changes and denaturing agents. This high stability is mainly due to the expanded beta sheet structure of the proteins. Examples of gamma crystalline derived proteins are described in WO200104144 and examples of “ubiquitin-like” proteins are described in WO2004106368.
[0267] Protein epitope mimetics (PEM) are medium-sized, cyclic, peptide-like molecules (MW 1-2kDa) mimicking beta-hairpin secondary structures of proteins, the major secondary structure involved in protein-protein interactions.
[0268] Domain antibodies (dAbs) can be used in the anti-TCRvb antibody molecules as described herein or multifunctional formats thereof are small functional binding fragments of antibodies, corresponding to the variable regions of either the heavy or light chains of antibodies. Domain antibodies are well expressed in bacterial, yeast, and mammalian cell systems. Further details of domain antibodies and methods of production thereof are known in the art (see, for example, U.S. Pat. Nos.6,291,158; 6,582,915; 6,593,081; 6,172,197; 6,696,245; European Patents 0368684 & 0616640; WO05 / 035572, WO04 / 101790, WO04 / 081026, WO04 / 058821, WO04 / 003019 and WO03 / 002609. Nanobodies are derived from the heavy chains of an antibody.
[0269] A nanobody typically comprises a single variable domain and two constant domains (CH2 and CH3) and retains antigen-binding capacity of the original antibody. Nanobodies can be prepared by methods known in the art (See e.g., U.S. Pat. No.6,765,087, U.S. Pat. No.6,838,254, WO 06 / 079372). Unibodies consist of one light chain and one heavy chain of an IgG4 antibody. Unibodies may be made by the removal of the hinge region of IgG4 antibodies. Further details of unibodies and methods of preparing them may be found in WO2007 / 059782.
[0270] Examples of anti-TCRVβ antibodies are, for example, described in WO2020142672,WO2020010250, WO2021138474, and WO2022216993, each of which is incorporated herein byreference in its entirety. Anti-TCRVβ antibody effector function and Fc variants
[0271] In some embodiments, an anti-TCRVβ antibody as described herein comprises an Fc region, e.g.,as described herein. In some embodiments, the Fc region is a wildtype Fc region, e.g., a wildtype human Fc region. In some embodiments, the Fc region comprises a variant, e.g., an Fc region comprising an addition, substitution, or deletion of at least one amino acid residue in the Fc region which results in, e.g., reduced or ablated affinity for at least one Fc receptor.
[0272] The Fc region of an antibody interacts with a number of receptors or ligands including Fc Receptors (e.g., FcγRI, FcγRIIA, FcγRIIIA), the complement protein CIq, and other molecules such as proteins A and G. These interactions are essential for a variety of effector functions and downstream signaling events including: antibody dependent cell-mediated cytotoxicity (ADCC), Antibody-dependent cellular phagocytosis (ADCP) and complement dependent cytotoxicity (CDC).WSGR Docket No.53676-772.601
[0273] In some embodiments, an anti-TCRVβ antibody comprising a variant Fc region has reduced, e.g.,ablated, affinity for an Fc receptor, e.g., an Fc receptor described herein. In some embodiments, the reduced affinity is compared to an otherwise similar antibody with a wildtype Fc region.
[0274] In some embodiments, an anti-TCRVβ antibody comprising a variant Fc region has one or moreof the following properties: (1) reduced effector function (e.g., reduced ADCC, ADCP and / or CDC); (2) reduced binding to one or more Fc receptors; and / or (3) reduced binding to C1q complement. In some embodiments, the reduction in any one, or all of properties (1)-(3) is compared to an otherwise similar antibody with a wildtype Fc region.
[0275] In some embodiments, an anti-TCRVβ antibody comprising a variant Fc region has reducedaffinity to a human Fc receptor, e.g., FcγR I, FcγR II and / or FcγR III. In some embodiments, the anti- TCRVβ antibody comprising a variant Fc region comprises a human IgG1 region or a human IgG4 region.
[0276] In some embodiments, an anti-TCRVβ antibody comprising a variant Fc region activates and / orexpands T cells, e.g., as described herein. In some embodiments, an anti-TCRVβ antibody comprising a variant Fc region has a cytokine profile described herein, e.g., a cytokine profile that differs from a cytokine profile of a T cell engager that binds to a receptor or molecule other than a TCRβV region (“a non-TCRβV-binding T cell engager”). In some embodiments, the non-TCRβV-binding T cell engager comprises an antibody that binds to a CD3 molecule (e.g., CD3 epsilon (CD3e) molecule.
[0277] Exemplary Fc region variants are provided in Table 14 and also disclosed in Saunders O, (2019) Frontiers in Immunology; vol 10, article1296, the entire contents of which is hereby incorporated by reference.
[0278] In some embodiments, an anti-TCRVβ antibody as described herein comprises any one or all, orany combination of Fc region variants disclosed in Table 14.
[0279] In some embodiments, an anti-TCRVβ antibody as described herein comprises any one or all, orany combination of Fc region variants, e.g., mutations, disclosed in Table 14. In some embodiments, an anti-TCRVβ antibody as described herein comprise an Asn297Ala (N297A) mutation. In some embodiments, an anti-TCRVβ antibody as described herein comprise a Leu234Ala / Leu235Ala (LALA) mutation. Multifunctional Molecules
[0280] As used herein, a “multifunctional” or a “multispecific” molecule refers to molecule, e.g., a polypeptide, that has two or more functionalities, e.g., two or more binding specificities. In some embodiments, the functionalities can include one or more immune cell engagers, one or more tumor binding molecules, one or more cytokine molecules, one or more stromal modifiers, and other moieties described herein. In some embodiments, the multispecific molecule is a multispecific antibody molecule, e.g., a bispecific antibody molecule. In some embodiments, the multispecific molecule includes an anti- TCRVb antibody molecule as described herein.WSGR Docket No.53676-772.601
[0281] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, a fourth polypeptide chain, and at least one cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first T cell receptor variable beta (TCRβV)-binding moiety and a first dimerization module linked to the first portion of the first TCRβV-binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV-binding moiety; (iii) the third polypeptide chain comprising a first portion of a second TCRβV-binding moiety and a second dimerization module linked to the first portion of the second TCRβV-binding moiety; and (iv) the fourth polypeptide chain comprising a second portion of the second TCRβV-binding moiety; and wherein the at least one cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof.
[0282] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, and at least one cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain, the second polypeptide chain, and the third polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first TCRβV-binding moiety and a first dimerization module linked to the first portion of the first TCRβV-binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV-binding moiety; and (iii) the third polypeptide chain comprising a second dimerization module; and wherein the at least one cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, or a combination thereof.
[0283] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, and at least one cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain, the second polypeptide chain, and the third polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first TCRβV-binding moiety and a first dimerization module linked to the first portion of the first TCRβV-binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV-binding moiety; and (iii) the third polypeptide chain comprising a second dimerization module; wherein the at least one cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, or a combination thereof; and wherein the multifunctional polypeptide molecule does not comprise an additional TCRβV-binding moiety except the first TCRβV- binding moiety.
[0284] In some embodiments, the first portion of the first TCRβV-binding moiety comprises a firstheavy chain variable domain (VH) and a first heavy chain constant domain 1 (CH1) linked to the firstWSGR Docket No.53676-772.601 VH. In some embodiments, the first CH1 is linked to the C-terminus of the first VH. In some embodiments, the second portion of the first TCRβV-binding moiety comprises a first light chain variable domain (VL) and a first light chain constant domain (CL) linked to the first VL. In some embodiments, first CL is linked to the C-terminus of the first VL. In some embodiments, wherein the first dimerization module is linked to the first portion of the first TCRβV-binding moiety. In some embodiments, the first dimerization module is linked to the C-terminus of the first portion of the first TCRβV-binding moiety. In some embodiments, wherein the first portion of the second TCRβV-binding moiety comprises a second VH and a second CH1 linked to the second VH. In some embodiments, the second CH1 is linked to the C-terminus of the second VH. In some embodiments, the second portion of the second TCRβV-binding moiety comprises a second VL and a second CL linked to the second VL. In some embodiments, the second CL is linked to the C-terminus of the second VL. In some embodiments, the second dimerization module is linked to the first portion of the second TCRβV-binding moiety. In some embodiments, the second dimerization module is linked to the C-terminus of the first portion of the second TCRβV-binding moiety.
[0285] In some embodiments, (a) the N-terminus of the first polypeptide chain is linked to a firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to a second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b) the N-terminus of the second polypeptide chain is linked to a third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to a fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (c) the N-terminus of the third polypeptide chain is linked to a fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the third polypeptide chain is linked to a sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (d) the N-terminus of the fourth polypeptide chain is linked to a seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the fourth polypeptide chain is linked to an eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; or (e) a combination thereof.
[0286] In some embodiments, (a-1) the N-terminus of the first polypeptide chain is linked to the firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (a-2) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b-1) the N-terminus of the first polypeptide chain is linked to the first cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (b-2) the N- terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragmentWSGR Docket No.53676-772.601 or a functional variant thereof; the C-terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (c-1) the N-terminus of the first polypeptide chain is linked to the first cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (c-2) the N-terminus of the fourth polypeptide chain is linked to the seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the fourth polypeptide chain is linked to the eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (d-1) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (d-2) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (e-1) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (e-2) the N-terminus of the fourth polypeptide chain is linked to the seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the fourth polypeptide chain is linked to the eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; or (f-1) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (f-2) the N-terminus of the fourth polypeptide chain is linked to the seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the fourth polypeptide chain is linked to the eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof.
[0287] In some embodiments, (a-1) the N-terminus of the first polypeptide chain is linked to the firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (a-2) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (a-3) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b-1) the N-terminus of the firstWSGR Docket No.53676-772.601 polypeptide chain is linked to the first cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b-2) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (b-3) the N-terminus of the fourth polypeptide chain is linked to the seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the fourth polypeptide chain is linked to the eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; or (c-1) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (c-2) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (c-3) the N-terminus of the fourth polypeptide chain is linked to the seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the fourth polypeptide chain is linked to the eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof.
[0288] In some embodiments, (1) the N-terminus of the first polypeptide chain is linked to the firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (2) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (3) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (4) the N-terminus of the fourth polypeptide chain is linked to the seventh cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the fourth polypeptide chain is linked to the eighth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof.
[0289] In some embodiments, the first cytokine polypeptide, the second cytokine polypeptide, or acombination thereof is within a single contiguous polypeptide chain of the first polypeptide chain, the third cytokine polypeptide, the fourth cytokine polypeptide, or a combination thereof is within a single contiguous polypeptide chain of the second polypeptide chain, the fifth cytokine polypeptide, the sixth cytokine polypeptide, or a combination thereof is within a single contiguous polypeptide chain of the third polypeptide chain, the seventh cytokine polypeptide, the eighth cytokine polypeptide, or aWSGR Docket No.53676-772.601 combination thereof is within a single contiguous polypeptide chain of the fourth polypeptide chain, or a combination thereof.
[0290] In some embodiments, (a) the N-terminus of the first polypeptide chain is linked to a firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to a second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b) the N-terminus of the second polypeptide chain is linked to a third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to a fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (c) the N-terminus of the third polypeptide chain is linked to a fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the third polypeptide chain is linked to a sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; or (d) a combination thereof.
[0291] In some embodiments, (a-1) the N-terminus of the first polypeptide chain is linked to the firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (a-2) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b-1) the N-terminus of the first polypeptide chain is linked to the first cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (b-2) the N- terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; or (c-1) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; and (c-2) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof.
[0292] In some embodiments, (1) the N-terminus of the first polypeptide chain is linked to the firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to the second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (2) the N-terminus of the second polypeptide chain is linked to the third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to the fourth cytokine polypeptide or a functional fragment or aWSGR Docket No.53676-772.601 functional variant thereof; or a combination thereof; and (3) the N-terminus of the third polypeptide chain is linked to the fifth cytokine polypeptide or a functional fragment or a functional variant thereof; the C- terminus of the third polypeptide chain is linked to the sixth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof.
[0293] In some embodiments, the first cytokine polypeptide, the second cytokine polypeptide, or acombination thereof is within a single contiguous polypeptide chain of the first polypeptide chain, the third cytokine polypeptide, the fourth cytokine polypeptide, or a combination thereof is within a single contiguous polypeptide chain of the second polypeptide chain, the fifth cytokine polypeptide, the sixth cytokine polypeptide, or a combination thereof is within a single contiguous polypeptide chain of the third polypeptide chain, or a combination thereof.
[0294] In some embodiments, the multifunctional polypeptide molecule as described herein furthercomprises a linker between the first portion of the first TCRβV-binding moiety and the first dimerization module, a linker between the first portion of the second TCRβV-binding moiety and the second dimerization module, a linker between the first VH and the first CH1, a linker between the first VL and the first CL, a linker between the second VH and the second CH1, a linker between the second VL and the second CL, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the first polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the second polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the third polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the fourth polypeptide chain, or a combination thereof.
[0295] In some embodiments, the multifunctional polypeptide molecule as described herein furthercomprises comprising a linker between the first portion of the first TCRβV-binding moiety and the first dimerization module, a linker between the first VH and the first CH1, a linker between the first VL and the first CL, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the first polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the second polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the third polypeptide chain, or a combination thereof. In some embodiments, linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, and a non-helical linker. In some embodiments, the linker is the peptide linker and wherein the linker is a GS linker. In some embodiments, the linker is the peptide linker and wherein the linker comprises the sequence of SEQ ID NO: 3308 or SEQ ID NO: 3643.
[0296] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, a fourth polypeptide chain, a first cytokine polypeptide or a functional fragment or a functional variant thereof, and a second cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the firstWSGR Docket No.53676-772.601 polypeptide chain, the second polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first TCRβV-binding moiety and a first dimerization module linked to the first portion of the first TCRβV- binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV- binding moiety; (iii) the third polypeptide chain comprising a first portion of a second TCRβV-binding moiety and a second dimerization module linked to the first portion of the second TCRβV-binding moiety; and (iv) the fourth polypeptide chain comprising a second portion of the second TCRβV-binding moiety; and wherein the first cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the C-terminus of the second polypeptide chain, and the second cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the C-terminus of the fourth polypeptide chain.
[0297] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, a fourth polypeptide chain, a cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first TCRβV-binding moiety and a first dimerization module linked to the first portion of the first TCRβV- binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV- binding moiety; (iii) the third polypeptide chain comprising a first portion of a second TCRβV-binding moiety and a second dimerization module linked to the first portion of the second TCRβV-binding moiety; and (iv) the fourth polypeptide chain comprising a second portion of the second TCRβV-binding moiety; and wherein the cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the C-terminus of the second polypeptide chain or the C-terminus of the fourth polypeptide chain.
[0298] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, a fourth polypeptide chain, a cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first TCRβV-binding moiety and a first dimerization module linked to the first portion of the first TCRβV- binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV- binding moiety; (iii) the third polypeptide chain comprising a first portion of a second TCRβV-binding moiety and a second dimerization module linked to the first portion of the second TCRβV-binding moiety; and (iv) the fourth polypeptide chain comprising a second portion of the second TCRβV-binding moiety; and wherein the cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the C-terminus of the first polypeptide chain or the C-terminus of the third polypeptide chain.WSGR Docket No.53676-772.601
[0299] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain, and a cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain, the second polypeptide chain, and the third polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first portion of a first TCRβV-binding moiety and a first dimerization module linked to the first portion of the first TCRβV-binding moiety; (ii) the second polypeptide chain comprising a second portion of the first TCRβV-binding moiety; and (iii) the third polypeptide chain comprising a second dimerization module; wherein the at least one cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the N terminus of the third polypeptide chain; and wherein the multifunctional polypeptide molecule does not comprise an additional TCRβV- binding moiety except the first TCRβV-binding moiety.
[0300] In some embodiments, the first portion of the first TCRβV-binding moiety comprises a first VHand a first CH1 linked to the first VH. In some embodiments, the first CH1 is linked to the C-terminus of the first VH.
[0301] In some embodiments, the second portion of the first TCRβV-binding moiety comprises a firstVL and a first CL linked to the first VL. In some embodiments, first CL is linked to the C-terminus of the first VL.
[0302] In some embodiments, the first dimerization module is linked to the first portion of the firstTCRβV-binding moiety. In some embodiments, the first dimerization module is linked to the C-terminus of the first portion of the first TCRβV-binding moiety. In some embodiments, the first portion of the second TCRβV-binding moiety comprises a second VH and a second CH1 linked to the second VH. In some embodiments, the second CH1 is linked to the C-terminus of the second VH. In some embodiments, the second portion of the second TCRβV-binding moiety comprises a second VL and a second CL linked to the second VL. In some embodiments, the second CL is linked to the C-terminus of the second VL. In some embodiments, the second dimerization module is linked to the first portion of the second TCRβV-binding moiety. In some embodiments, the second dimerization module is linked to the C-terminus of the first portion of the second TCRβV-binding moiety.
[0303] In some embodiments, the multifunctional polypeptide molecule as described herein furthercomprises a linker between the first portion of the first TCRβV-binding moiety and the first dimerization module, a linker between the first portion of the second TCRβV-binding moiety and the second dimerization module, a linker between the first VH and the first CH1, a linker between the first VL and the first CL, a linker between the second VH and the second CH1, a linker between the second VL and the second CL, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the first polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the second polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the third polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the fourth polypeptide chain, or a combinationWSGR Docket No.53676-772.601 thereof. In some embodiments, the multifunctional polypeptide molecule as described herein further comprises a linker between the first portion of the first TCRβV-binding moiety and the first dimerization module, a linker between the first VH and the first CH1, a linker between the first VL and the first CL, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the third polypeptide chain, or a combination thereof. In some embodiments, linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, and a non-helical linker. In some embodiments, the linker is the peptide linker and wherein the linker is a GS linker. In some embodiments, the linker is the peptide linker and wherein the linker comprises the sequence of SEQ ID NO: 3308 or SEQ ID NO: 3643.
[0304] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises any one selected from the group consisting of a Fab, F(ab')2, Fv, a single chain Fv (scFv), a single domain antibody, a VHH, a diabody (dAb), a camelid antibody and a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV- binding moiety, or a combination thereof comprises a scFv or a Fab.
[0305] In some embodiments, the multifunctional polypeptide molecule does not comprise an additionalantigen-binding moiety except the TCRβV-binding moiety. In some embodiments, the multifunctional polypeptide molecule further comprise an additional antigen-binding moiety that is not the TCRβV- binding moiety.
[0306] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, and at least one cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain and the second polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first TCRβV- binding moiety and a first dimerization module linked to the C-terminus of the first TCRβV-binding moiety, wherein the first TCRβV-binding moiety comprises a first VL and a first VH; and (ii) the second polypeptide chain comprising a second TCRβV-binding moiety and a second dimerization module linked to the C-terminus of the second TCRβV-binding moiety; wherein the at least one cytokine polypeptide or a functional fragment or a functional variant thereof is covalently linked to the first polypeptide chain, the second polypeptide chain, or a combination thereof; wherein the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises a scFv; and wherein the multifunctional polypeptide molecule does not comprise an additional antigen-binding moiety except the first TCRβV-binding moiety and the second TCRβV-binding moiety.
[0307] Described herein, in certain embodiments, is a multifunctional polypeptide molecule comprising a first polypeptide chain, a second polypeptide chain, and at least one cytokine polypeptide or a functional fragment or a functional variant thereof, wherein the first polypeptide chain and the second polypeptide chain are non-contiguous, wherein: (i) the first polypeptide chain comprising a first TCRβV- binding moiety and a first dimerization module linked to the C-terminus of the first TCRβV-binding moiety, wherein the first TCRβV-binding moiety comprises a first VL and a first VH; and (ii) the second polypeptide chain comprising a second dimerization module; wherein the at least one cytokineWSGR Docket No.53676-772.601 polypeptide or a functional fragment or a functional variant thereof is covalently linked to the first polypeptide chain, the second polypeptide chain, or a combination thereof; wherein the first TCRβV- binding moiety comprises a scFv; wherein the multifunctional polypeptide molecule does not comprise an additional antigen-binding moiety except the first TCRβV-binding moiety; and wherein the multifunctional polypeptide molecule does not comprise an additional TCRβV-binding moiety except the first TCRβV-binding moiety.
[0308] In some embodiments, (a) the N-terminus of the first polypeptide chain is linked to a firstcytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the first polypeptide chain is linked to a second cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; (b) the N-terminus of the second polypeptide chain is linked to a third cytokine polypeptide or a functional fragment or a functional variant thereof; the C-terminus of the second polypeptide chain is linked to a fourth cytokine polypeptide or a functional fragment or a functional variant thereof; or a combination thereof; or (e) a combination thereof.
[0309] In some embodiments, the first cytokine polypeptide, the second cytokine polypeptide, or acombination thereof is within a single contiguous polypeptide chain of the first polypeptide chain, the third cytokine polypeptide, the fourth cytokine polypeptide, or a combination thereof is within a single contiguous polypeptide chain of the second polypeptide chain, or a combination thereof.
[0310] In some embodiments, the multifunctional polypeptide molecule as described herein furthercomprises a linker between the first TCRβV-binding moiety and the first dimerization module, a linker between the second TCRβV-binding moiety and the second dimerization module, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the first polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the second polypeptide chain, or a combination thereof.
[0311] In some embodiments, the multifunctional polypeptide molecule as described herein furthercomprises a linker between the first TCRβV-binding moiety and the first dimerization module, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the first polypeptide chain, a linker between the at least one cytokine polypeptide or a functional fragment or a functional variant thereof and the second polypeptide chain, or a combination thereof. In some embodiments, the linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, and a non-helical linker. In some embodiments, the linker is the peptide linker and wherein the linker is a GS linker. In some embodiments, the linker is the peptide linker and wherein the linker comprises the sequence of SEQ ID NO: 3308 or SEQ ID NO: 3643.
[0312] In some embodiments, the multifunctional polypeptide molecule comprises at least two of thecytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises at least three of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises at least four of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises at least five of the cytokine polypeptide. In some embodiments, theWSGR Docket No.53676-772.601 multifunctional polypeptide molecule comprises at least six of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises at least seven of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises at least eight of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises two of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises three of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises four of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises five of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises six of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises seven of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises eight of the cytokine polypeptide. In some embodiments, the multifunctional polypeptide molecule comprises two of the cytokine polypeptide, each of which is linked to the first polypeptide chain and the second polypeptide chain; the first polypeptide chain and the third polypeptide chain;. the first polypeptide chain and the fourth polypeptide chain; the second and the third polypeptide chain; the second polypeptide chain and the fourth polypeptide chain; or the third polypeptide chain and the fourth polypeptide chain, respectively. In some embodiments, the multifunctional polypeptide molecule comprises three of the cytokine polypeptide, each of which is linked to the first polypeptide chain, the second polypeptide chain, and the third polypeptide chain; the first polypeptide chain, the second polypeptide chain, and the fourth polypeptide chain; the first polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain; or the second polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain, respectively. In some embodiments, the multifunctional polypeptide molecule comprises four of the cytokine polypeptide, each of which is linked to the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, and the fourth polypeptide chain, respectively. In some embodiments, the cytokine polypeptide is not linked to the polypeptides that comprise the first TCRβV-binding moiety.
[0313] In some embodiments, , the at least one cytokine polypeptide is selected from the groupconsisting of interleukin-2 (IL-2) or a fragment or a functional fragment or a functional variant thereof, interleukin-7 (IL-7) or a fragment or a functional fragment or a functional variant thereof, interleukin-12 (IL-12) or a fragment or a functional fragment or a functional variant thereof, interleukin-15 (IL-15) or a fragment or a functional fragment or a functional variant thereof, interleukin-18 (IL-18) or a fragment or a functional fragment or a functional variant thereof, interleukin-21 (IL-21) or a fragment or a functional fragment or a functional variant thereof, or interferon gamma or a fragment or a functional fragment or a functional variant thereof, or a combination thereof.
[0314] In some embodiments, the at least one cytokine polypeptide comprises interleukin-2 (IL-2) or afragment thereof. In some embodiments, the at least one cytokine polypeptide is interleukin-2 (IL-2) or a fragment thereof. In some embodiments, the at least one cytokine polypeptide comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2191. In some embodiments, the at least one cytokine polypeptide comprisesWSGR Docket No.53676-772.601 the sequence of SEQ ID NO: 2191. In some embodiments, the sequence of the at least one cytokine polypeptide is a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2191. In some embodiments, the sequence of the at least one cytokine polypeptide is the sequence of SEQ ID NO: 2191.
[0315] In some embodiments, the variant of the at least one cytokine polypeptide comprises an IL-2variant comprising a mutation. In some embodiments, the mutation comprises an insertion mutation, a deletion mutation, or a substitution mutation. In some embodiments, the mutation comprises the substitution mutation. In some embodiments, the variant comprises an IL-2 variant comprising C125A mutation. In some embodiments, the variant of the at least one cytokine polypeptide is an IL-2 variant comprising a mutation. In some embodiments, the mutation is an insertion mutation, a deletion mutation, or a substitution mutation. In some embodiments, the mutation is the substitution mutation. In some embodiments, the variant is an IL-2 variant comprising C125A mutation. In some embodiments, the variant comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270. In some embodiments, the variant comprises the sequence of SEQ ID NO: 2270. In some embodiments, the sequence of the variant is a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270. In some embodiments, the sequence of the variant is the sequence of SEQ ID NO: 2270.
[0316] In some embodiments, the first dimerization module comprises a first immunoglobulin constantregions (Fc regions) and the second dimerization module comprises a second Fc region. In some embodiments, the first dimerization module is a first immunoglobulin constant regions (Fc regions) and the second dimerization module is a second Fc region.
[0317] In some embodiments, the first Fc region, the second Fc region, or a combination thereof isselected from an IgG1 Fc region or a fragment thereof, an IgG2 Fc region or a fragment thereof, an IgG3 Fc region or a fragment thereof, an IgGA1 Fc region or a fragment thereof, an IgGA2 Fc region or a fragment thereof, an IgG4 Fc region or a fragment thereof, an IgJ Fc region or a fragment thereof, an IgM Fc region or a fragment thereof, an IgD Fc region or a fragment thereof, and an IgE Fc region or a fragment thereof.
[0318] In some embodiments, the first Fc region, the second Fc region, or a combination thereof isselected from a human IgG1 Fc region or a fragment thereof, a human IgG2 Fc region or a fragment thereof, and a human IgG4 Fc region or a fragment thereof.
[0319] In some embodiments, the first Fc region, the second Fc region, or a combination thereofcomprises an Fc interface with one or more of: a paired cavity-protuberance, an electrostatic interaction, or a strand-exchange, wherein the dimerization of the first Fc region and the second Fc region is enhanced as indicated by a greater ratio of heteromultimer:homomultimer forms relative to a dimerization of Fc regions with a non-engineered interface. In some embodiments, the dimerization of the first Fc region and the second Fc region is enhanced at least by 1.1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 1.6 fold, 1.7 fold, 1.8 fold, 1.9 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10WSGR Docket No.53676-772.601 fold, 15 fold, 20 fold, 25 fold, 30 fold, 35 fold, 40 fold, 45 fold, 50 fold, 55 fold, 60 fold, 65 fold, 70 fold, 75 fold, 80 fold, 85 fold, 90 fold, 95 fold, 100 fold, 150 fold, 200 fold, 250 fold, 300 fold, 250 fold, 400 fold, 450 fold, 500 fold, 550 fold, 600 fold, 650 fold, 700 fold, 750 fold, 800 fold, 850 fold, 900 fold, 950 fold, 1000 fold, 2000 fold, 3000 fold, 4000 fold, 5000 fold, 6000 fold, 7000 fold, 8000 fold, 9000 fold, or 10000 fold relative to a dimerization of Fc regions with a non-engineered interface. In some embodiments, the dimerization of the first Fc region and the second Fc region is enhanced at most by 1.1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 1.6 fold, 1.7 fold, 1.8 fold, 1.9 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 15 fold, 20 fold, 25 fold, 30 fold, 35 fold, 40 fold, 45 fold, 50 fold, 55 fold, 60 fold, 65 fold, 70 fold, 75 fold, 80 fold, 85 fold, 90 fold, 95 fold, 100 fold, 150 fold, 200 fold, 250 fold, 300 fold, 250 fold, 400 fold, 450 fold, 500 fold, 550 fold, 600 fold, 650 fold, 700 fold, 750 fold, 800 fold, 850 fold, 900 fold, 950 fold, 1000 fold, 2000 fold, 3000 fold, 4000 fold, 5000 fold, 6000 fold, 7000 fold, 8000 fold, 9000 fold, or 10000 fold relative to a dimerization of Fc regions with a non- engineered interface. In some embodiments, the dimerization of the first Fc region and the second Fc region is enhanced by 1.1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 1.6 fold, 1.7 fold, 1.8 fold, 1.9 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 15 fold, 20 fold, 25 fold, 30 fold, 35 fold, 40 fold, 45 fold, 50 fold, 55 fold, 60 fold, 65 fold, 70 fold, 75 fold, 80 fold, 85 fold, 90 fold, 95 fold, 100 fold, 150 fold, 200 fold, 250 fold, 300 fold, 250 fold, 400 fold, 450 fold, 500 fold, 550 fold, 600 fold, 650 fold, 700 fold, 750 fold, 800 fold, 850 fold, 900 fold, 950 fold, 1000 fold, 2000 fold, 3000 fold, 4000 fold, 5000 fold, 6000 fold, 7000 fold, 8000 fold, 9000 fold, or 10000 fold relative to a dimerization of Fc regions with a non-engineered interface.
[0320] In some embodiments, the first Fc region, the second Fc region, or a combination thereofcomprises an amino acid substitution listed in Table 14.
[0321] In some embodiments, the first Fc region, the second Fc region, or a combination thereofcomprises an Asn297Ala (N297A) mutation or a Leu234Ala / Leu235Ala (LALA) mutation.
[0322] In some embodiments, the first Fc region, the second Fc region, or a combination thereofcomprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO:3648, or SEQ ID NO: 3649. In some embodiments, the first Fc region, the second Fc region, or a combination thereof comprises the sequence of SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO:3648, or SEQ ID NO: 3649.
[0323] In some embodiments, the sequence of the first Fc region, the second Fc region, or a combinationthereof is a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO:3648, or SEQ ID NO: 3649. In some embodiments, the sequence of the first Fc region, the second Fc region, or a combination thereof is the sequence of SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO:3648, or SEQ ID NO: 3649.WSGR Docket No.53676-772.601
[0324] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof binds to one or more of a TCRβV subfamily selected from the group consisting of: (i) TCRβ V2 subfamily comprising TCRβ V2*01; (ii) TCRβ V3 subfamily comprising TCRβ V3-1*01; (iii) TCRβ V4 subfamily comprising one or more selected from TCRβ V4-1, TCRβ V4-2, and TCRβ V4- 3; (iv) TCRβ V5 subfamily comprising one or more selected from TCRβ V5-6*01, TCRβ V5-4*01, TCRβ V5-1*01, and TCRβ V5-8*01; (v) the TCRβ V6 subfamily comprising one or more selected from TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6-2*01, TCRβ V6-3*01, and TCRβ V6-1*01; (vi) TCRβ V9 subfamily; (vii) TCRβ V10 subfamily comprising one or more selected from TCRβ V10-1*01, TCRβ V10-1*02, TCRβ V10-3*01, and TCRβ V10-2*01; (viii) TCRβ V11 subfamily comprising TCRβ V11-2; (ix) TCRβ V12 subfamily comprising one or more selected from TCRβ V12-4*01, TCRβ V12-3*01, and TCRβ V12- 5*01; (x) TCRβ V13 subfamily comprising TCRβ V13*01; (xi) TCRβ V16 subfamily comprising TCRβ V16*01; (xii) TCRβ V19 subfamily comprising one or more selected from TCRβ V19*01 and TCRβ V19*02; (xiii) TCRβ V21 subfamily. (xiv) TCRβ V23 subfamily. (xv) TCRβ V27 subfamily; and (xvi) TCRβ V28 subfamily.
[0325] In some embodiments, the first TCRβV-binding moiety and the second TCRβV-binding moietyare same. In some embodiments, the first TCRβV-binding moiety and the second TCRβV-binding moiety are different.
[0326] In some embodiments, the first TCRβV-binding moiety and the second TCRβV-binding moietybinds: (i) one or more of a TCRβ V6 subfamily member and one or more of a TCRβ V10 subfamily member, respectively; (ii) one or more of a TCRβ V6 subfamily member and one or more of a TCRβ V5 subfamily member, respectively; (iii) one or more of a TCRβ V6 subfamily member and one or more of a TCRβ V12 subfamily member, respectively; (iv) one or more of a TCRβ V10 subfamily member and one or more of a TCRβ V5 subfamily member, respectively; (v) one or more of a TCRβ V10 subfamily member and one or more of a TCRβ V12 subfamily member, respectively; or (vi) one or more of a TCRβ V5 subfamily member and one or more of a TCRβ V12 subfamily member, respectively.
[0327] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 sequences listed in Table 1; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 the sequences listed in Table 1; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV- binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 having any one of the CDR1, CDR2, and CDR3 sequences listed in Table 1; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 having any one of the CDR1, CDR2, and CDR3 the sequences listed in Table 1; or (iii) a combination thereof.WSGR Docket No.53676-772.601
[0328] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 sequences listed in Table 1, respectively; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 the sequences listed in Table 1, respectively; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 having any one of the CDR1, CDR2, and CDR3 sequences listed in Table 1, respectively; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 having any one of the CDR1, CDR2, and CDR3 the sequences listed in Table 1, respectively; or (iii) a combination thereof.
[0329] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a VH comprising a framework region (FR) comprising a framework 1 (FR1), a framework region 2 (FR2), a framework region 3 (FR3), and a framework region 4 (FR4) that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a non- murine germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a non-murine germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV- binding moiety, or a combination thereof comprises: (i) a VH comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 having the sequences of a non-murine germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 having the sequences of a non-murine germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4; or (iii) a combination thereof.
[0330] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a VH comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a non-murine germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4, respectively; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a non-murine germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4, respectively; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a VH comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 having the sequences of a non-murine germline FR1, a non- murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4, respectively; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 having the sequences of a non-murineWSGR Docket No.53676-772.601 germline FR1, a non-murine germline FR2, a non-murine germline FR3, and a non-murine germline FR4, respectively; or (iii) a combination thereof.
[0331] In some embodiments, the VH comprises the FR3 comprising (i) a Threonine at position 73according to Kabat numbering; (ii) a Glycine a position 94 according to Kabat numbering; or (iii) a combination thereof. In some embodiments, the VL comprises the FR1 comprising a Phenylalanine at position 10 according to Kabat numbering. In some embodiments, the VL comprises the FR2 comprising (i) a Histidine at position 36 according to Kabat numbering; (ii) an Alanine at position 46 according to Kabat numbering; or (iii) a combination thereof. In some embodiments, the VL comprises the FR3 comprising a Phenylalanine at position 87 according to Kabat numbering.
[0332] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV- binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 having any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 having any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2; or (iii) a combination thereof.
[0333] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2, respectively; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2, respectively; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 having any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2, respectively; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 having any one of the CDR1, CDR2, and CDR3 sequences listed in Table 2, respectively; or (iii) a combination thereof.
[0334] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a VH comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-WSGR Docket No.53676-772.601 binding moiety, or a combination thereof comprises: (i) a VH comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have the sequence of a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have the sequence of a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2; or (iii) a combination thereof.
[0335] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a VH comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2, respectively; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity with a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2, respectively; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a VH comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have the sequence of a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2, respectively; (ii) a VL comprising a FR comprising a FR1, a FR2, a FR3, and a FR4 that have the sequence of a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2, respectively; or (iii) a combination thereof.
[0336] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a VH comprising a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the VH sequence of a humanized Antibody B-H listed in Table 2; (ii) a VL comprising a sequence having at least at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the VL sequence of a humanized Antibody B-H listed in Table 2; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a VH comprising the VH sequence of a humanized Antibody B-H listed in Table 2; (ii) a VL comprising the VL sequence of a humanized Antibody B-H listed in Table 2; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) the VH of a humanized Antibody B-H listed in Table 2; (ii) the VL sequence of a humanized Antibody B-H listed in Table 2; or (iii) a combination thereof.
[0337] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region having a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the sequences listed in Table 3, 21, or 22 or a combination thereof. In some embodiments, the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region having any one of the sequences listed in Table 3, 21, or 22 or a combination thereof. In some embodiments, the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region of which sequence is a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100%WSGR Docket No.53676-772.601 sequence identity to any one of the sequences listed in Table 3, 21, or 22 or a combination thereof. In some embodiments, the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region having any one of the heavy chain constant region sequences listed in Table 3, 21, or 22 or a combination thereof. In some embodiments, the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region of an IgM or a fragment thereof. In some embodiments, the heavy chain constant region of the IgM comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 73. In some embodiments, the heavy chain constant region of the IgM comprises the sequence of SEQ ID NO: 73. In some embodiments, the sequence of the heavy chain constant region of the IgM is the sequence of SEQ ID NO: 73.
[0338] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region of an IgJ or a fragment thereof. In some embodiments, the heavy chain constant region of the IgJ comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 76. In some embodiments, the heavy chain constant region of the IgJ comprises the sequence of SEQ ID NO: 76. In some embodiments, the sequence of the heavy chain constant region of the IgJ is the sequence of SEQ ID NO: 76.
[0339] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region of an IgGA1 or a fragment thereof. In some embodiments, the heavy chain constant region of the IgGA1comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 74. In some embodiments, the heavy chain constant region of the IgGA1 comprises the sequence of SEQ ID NO: 74. In some embodiments, the sequence of the heavy chain constant region of the IgGA1 is the sequence of SEQ ID NO: 74.
[0340] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region of an IgGA2 or a fragment thereof. In some embodiments, the heavy chain constant region of the IgGA2 comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 75. In some embodiments, the heavy chain constant region of the IgGA2 comprises the sequence of SEQ ID NO: 75. In some embodiments, the sequence of the heavy chain constant region of the IgGA2 is the sequence of SEQ ID NO: 75.
[0341] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a heavy chain constant region of an IgG1 or a fragment thereof. In some embodiments, the heavy chain constant region of the IgG1 comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 41. In some embodiments, the heavy chain constant region of the IgG1 comprises the sequence of SEQ ID NO: 41. In some embodiments, theWSGR Docket No.53676-772.601 sequence of the heavy chain constant region of the IgG1 is the sequence of SEQ ID NO: 41. In some embodiments, the heavy chain constant region of the IgG1 comprises a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3645. In some embodiments, the heavy chain constant region of the IgG1 comprises the sequence of SEQ ID NO: 3645. In some embodiments, the sequence of the heavy chain constant region of the IgG1 is the sequence of SEQ ID NO: 3645.
[0342] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a light chain constant region having a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to any one of the sequences listed in Table 3, 21, or 22 or a combination thereof. In some embodiments, the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a light chain constant region having any one of the sequences listed in Table 3, 21, or 22 or a combination thereof. In some embodiments, the first polypeptide chain, the second polypeptide chain, the third polypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a light chain constant region having any one of the light chain constant region sequences listed in Table 3, 21, or 22 or a combination thereof.
[0343] In some embodiments, the first polypeptide chain, the second polypeptide chain, the thirdpolypeptide chain, the fourth polypeptide chain, or a combination thereof comprises a light chain constant region of a kappa chain or a fragment thereof. In some embodiments, the light chain constant region of a kappa chain comprises a light chain constant region sequence listed in Table 3, 21, or 22.
[0344] In some embodiments, the light chain constant region of a kappa chain comprises a sequencehaving at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 39 or SEQ ID NO: 3644. In some embodiments, the light chain constant region of a kappa chain comprises the sequence of SEQ ID NO: 39 or SEQ ID NO: 3644. In some embodiments, the sequence of the light chain constant region of a kappa chain is a sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 39 or SEQ ID NO: 3644. In some embodiments, the sequence of the light chain constant region of a kappa chain is the sequence of SEQ ID NO: 39 or SEQ ID NO: 3644.
[0345] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 comprising amino acid sequences having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to CDR1, CDR2, and CDR3 sequences of a VH disclosed in Tables 1, 2, 10, 11, 12 or 13; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 comprising an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to CDR1, CDR2, and CDR3 sequences of a VL disclosed in Tables 1, 2, 10, 11, 12 or 13; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 comprising the CDR1, CDR2, and CDR3 sequences of a VH disclosed in Tables 1, 2, 10, 11, 12 or 13; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 comprising theWSGR Docket No.53676-772.601 CDR1, CDR2, and CDR3 sequences of a VL disclosed in Tables 1, 2, 10, 11, 12 or 13; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV- binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 comprising amino acid sequences having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to CDR1, CDR2, and CDR3 sequences of a VH disclosed in Tables 1, 2, 10, 11, 12 or 13, respectively; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 comprising an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 99%, 99.5%, 99.9%, or 100% sequence identity to CDR1, CDR2, and CDR3 sequences of a VL disclosed in Tables 1, 2, 10, 11, 12 or 13, respectively; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV- binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 comprising the CDR1, CDR2, and CDR3 sequences of a VH disclosed in Tables 1, 2, 10, 11, 12 or 13, respectively; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 comprising the CDR1, CDR2, and CDR3 sequences of a VL disclosed in Tables 1, 2, 10, 11, 12 or 13, respectively; or (iii) a combination thereof. In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of a VH disclosed in Tables 1, 2, 10, 11, 12 or 13; (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of a VL disclosed in Tables 1, 2, 10, 11, 12 or 13; or (iii) a combination thereof.
[0346] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises a light chain comprising a FR1 comprising: (i) an Aspartic Acid at position 1 according to Kabat numbering; (ii) an Asparagine at position 2 according to Kabat numbering; (iii) a Leucine at position 4 according to Kabat numbering; or (iv) a combination thereof.
[0347] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof comprises a light chain comprising a FR3 comprising: (i) a Glycine at position 66 according to Kabat numbering; (ii) an Asparagine at position 69 according to Kabat numbering; (iii) a Tyrosine at position 71 according to Kabat numbering; or (iv) a combination thereof.
[0348] In some embodiments, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or acombination thereof binds to an outward facing region on a TCRβV protein. In some embodiments, the outward facing region on the TCRβV protein comprises a structurally conserved region of TCRβV having a similar structure across one or more TCRβV subfamilies.
[0349] In an aspect, provided herein is, inter alia, a multifunctional molecule comprising:(a) a tumor-associated antigen binding moiety, wherein the tumor-associated antigen binding moiety comprises a Nectin-4 binding moiety; (b) a molecule that binds to a co-stimulatory receptor of a T cell; and (c) a TCRβV-binding moiety.
[0350] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR3comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904.WSGR Docket No.53676-772.601
[0351] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3902.
[0352] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR2comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3903.
[0353] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3902, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3903, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904.
[0354] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR3comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904.
[0355] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3905.
[0356] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR2comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3906.
[0357] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3905, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3906, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904.WSGR Docket No.53676-772.601
[0358] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR3comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3909.
[0359] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3907.
[0360] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR2comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3908.
[0361] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3907, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3908, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3909.
[0362] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3901.
[0363] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR3comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0364] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3911.
[0365] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR2comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3912.WSGR Docket No.53676-772.601
[0366] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3911, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3912, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0367] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3902, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3903, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904, and / or a VL comprising a LC CDR1 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3911, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3912, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0368] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3905, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3906, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904, and / or a VL comprising a LC CDR1 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3911, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%,WSGR Docket No.53676-772.601 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3912, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0369] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3907, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3908, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3909, and / or a VL comprising a LC CDR1 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3911, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3912, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0370] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR3comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0371] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3914.
[0372] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR2comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3915.
[0373] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3914, a LC CDR2 comprising a sequence having at least 30%,WSGR Docket No.53676-772.601 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3915, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0374] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3902, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3903, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904, and / or a VL comprising a LC CDR1 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3914, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3915, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0375] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3905, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3906, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3904, and / or a VL comprising a LC CDR1 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3914, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3915, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%,WSGR Docket No.53676-772.601 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0376] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3907, a HC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3908, and a HC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3909, and / or a VL comprising a LC CDR1 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3914, a LC CDR2 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3915, and a LC CDR3 comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3913.
[0377] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3910.
[0378] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3901, and a VL comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3910.
[0379] In some embodiments, the at least one cytokine molecule or a functional fragment or functionalvariant thereof comprises a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270 or the sequence of SEQ ID NO: 2191.
[0380] In some embodiments, the molecule that binds to a co-stimulatory receptor of a T cell comprisesat least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the cytokineWSGR Docket No.53676-772.601 sequences as described herein or any one of the cytokine sequences as described herein or as listed in Table 25, 28, or 29.
[0381] In some embodiments, the first Fc region, the second Fc region, or a combination thereofcomprises a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO:3648, SEQ ID NO: 3649, SEQ ID NO: 3792, or SEQ ID NO: 3794.
[0382] In some embodiments, the first Fc region comprises a sequence having at least 30%, 35%, 40%,45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, and the second Fc region comprises a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794, or the first Fc region comprises a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794, and the second Fc region comprises a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794.
[0383] In some embodiments, the TCRβV-binding moiety comprises:
[0384] (i) a VH comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%,70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the heavy chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22;
[0385] (ii) a VL comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%,70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the light chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22;
[0386] (iii) a combination thereof.
[0387] In some embodiments, the second polypeptide chain comprises a sequence having at least 30%,35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1346, a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1349, a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270, and a sequence having at least 30%, 35%, 40%,WSGR Docket No.53676-772.601 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3648.
[0388] In some embodiments, the second polypeptide chain further comprises the sequence of SEQ IDNO: 3801, the sequence of SEQ ID NO: 3309, the sequence of SEQ ID NO: 3308, or any combination thereof.
[0389] In some embodiments, the second polypeptide chain comprises a sequence having at least 30%,35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1346 operatively linked to a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1349 operatively linked to a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270 operatively linked to a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3648.
[0390] In some embodiments, the sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%,65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1346 is operatively linked to the sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1349 via the sequence of SEQ ID NO: 3801.
[0391] In some embodiments, the sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%,65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1349 is operatively linked to the sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270 via the sequence of SEQ ID NO: 3309.
[0392] In some embodiments, the sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%,65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 2270 is operatively linked to the sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3648 via the sequence of SEQ ID NO: 3308.
[0393] In some embodiments, the second polypeptide chain comprises a sequence having at least 30%,35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3800.WSGR Docket No.53676-772.601
[0394] In some embodiments, the multifunctional molecule consists of a first polypeptide chain and asecond polypeptide chain, wherein the first polypeptide chain comprises the tumor-associated antigen binding moiety linked to a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, wherein the tumor- associated antigen binding moiety is an scFv that binds to a tumor-associated antigen, and the second polypeptide chain comprises the sequence of SEQ ID NO 3800.
[0395] In some embodiments, the multifunctional molecule consists of a first polypeptide chain, asecond polypeptide chain, and a third polypeptide chain, wherein the first polypeptide chain comprises a first portion of the tumor-associated antigen binding moiety linked to a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, wherein the tumor-associated antigen binding moiety is an Fab that binds to a tumor- associated antigen; the second polypeptide chain comprises the sequence of SEQ ID NO 3800; and the third polypeptide chain comprises a second portion of the tumor-associated antigen binding moiety.
[0396] In some embodiments, the TCRβV-binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1346 or the sequence of SEQ ID NO: 541.
[0397] In some embodiments, the TCRβV-binding moiety comprises a VL comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1349 or the sequence of SEQ ID NO: 3527.
[0398] In some embodiments, the TCRβV-binding moiety comprises a VH comprising the sequence ofSEQ ID NO: 1346 or the sequence of SEQ ID NO: 541.
[0399] In some embodiments, the TCRβV-binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1346 and a VL comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1349.
[0400] In some embodiments, the TCRβV-binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 541 and a VL comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity the sequence of SEQ ID NO: 3527.WSGR Docket No.53676-772.601
[0401] In some embodiments, the TCRβV-binding moiety comprises an scFv comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to the sequence of SEQ ID NO: 1331 or the sequence of SEQ ID NO: 1376.
[0402] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1sequence comprising any one of the HC CDR1 sequences listed in Table 24 or any one of the HC CDR1 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0403] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR2sequence comprising any one of the HC CDR2 sequences listed in Table 24 or any one of the HC CDR2 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0404] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR3sequence comprising any one of the HC CDR3 sequences listed in Table 24 or any one of the HC CDR3 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0405] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1sequence comprising any one of the HC CDR1 sequences listed in Table 24 or any one of the HC CDR1 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a HC CDR2 sequence comprising any one of the HC CDR2 sequences listed in Table 24 or any one of the HC CDR2 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a HC CDR3 sequence comprising any one of the HC CDR3 sequences listed in Table 24 or any one of the HC CDR3 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; or any combination thereof.
[0406] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1sequence comprising the HC CDR1 sequence of any one of the VH sequences listed in Table 24 or the HC CDR1 sequence of the any one of the VH sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0407] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR2sequence comprising the HC CDR2 sequence of any one of the VH sequences listed in Table 24 or the HC CDR2 sequence of any one of the VH sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0408] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR3sequence comprising the HC CDR3 sequence of any one of the VH sequences listed in Table 24 or theWSGR Docket No.53676-772.601 HC CDR3 sequence of any one of the VH sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0409] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a HC CDR1sequence comprising the HC CDR1 sequence of any one of the VH sequences listed in Table 24 or the HC CDR1 sequence of any one of the VH sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a HC CDR2 sequence comprising the HC CDR2 sequence of any one of the VH sequences listed in Table 24 or the HC CDR2 sequence of any one of the VH sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a HC CDR3 sequence comprising the HC CDR3 sequence of any one of the VH sequences listed in Table 24 or the HC CDR3 sequence of any one of the VH sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; or any combination thereof.
[0410] In some embodiments, the HC CDR1 sequence, the HC CDR2 sequence, and / or the HC CDR3sequence are determined according to the Kabat numbering scheme.
[0411] In some embodiments, the HC CDR1 sequence, the HC CDR2 sequence, and / or the HC CDR3sequence are determined according to the Chothia numbering scheme.
[0412] In some embodiments, the HC CDR1 sequence, the HC CDR2 sequence, and / or the HC CDR3sequence are determined according to the IMGT numbering scheme.
[0413] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1sequence comprising any one of the LC CDR1 sequences listed in Table 24 or any one of the LC CDR1 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0414] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR2sequence comprising any one of the LC CDR2 sequences listed in Table 24 or any one of the LC CDR2 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0415] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR3sequence comprising any one of the LC CDR3 sequences listed in Table 24 or any one of the LC CDR3 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0416] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1sequence comprising any one of the LC CDR1 sequences listed in Table 24 or any one of the LC CDR1 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a LC CDR2 sequence comprising any one of the LC CDR2 sequences listed in Table 24 or any one of the LC CDR2 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acidWSGR Docket No.53676-772.601 substitutions, deletions, and / or additions therein; a LC CDR3 sequence comprising any one of the LC CDR3 sequences listed in Table 24 or any one of the LC CDR3 sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; or any combination thereof.
[0417] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1sequence comprising the LC CDR1 sequence of any one of the VL sequences listed in Table 24 or the LC CDR1 sequence of any one of the VL sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0418] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR2sequence comprising the LC CDR2 sequence of any one of the VL sequences listed in Table 24 or the LC CDR2 sequence of any one of the VL sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0419] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR3sequence comprising the LC CDR3 sequence of any one of the VL sequences listed in Table 24 or the LC CDR3 sequence of any one of the VL sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein.
[0420] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a LC CDR1sequence comprising the LC CDR1 sequence of any one of the VL sequences listed in Table 24 or the LC CDR1 sequence of any one of the VL sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a LC CDR2 sequence comprising the LC CDR2 sequence of any one of the VL sequences listed in Table 24 or the LC CDR2 sequence of any one of the VL sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; a LC CDR3 sequence comprising the LC CDR3 sequence of any one of the VL sequences listed in Table 24 or the LC CDR3 sequence of any one of the VL sequences listed in Table 24 with at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve amino acid substitutions, deletions, and / or additions therein; or any combination thereof.
[0421] In some embodiments, the LC CDR1 sequence, the LC CDR2 sequence, and / or the LC CDR3sequence are determined according to the Kabat numbering scheme.
[0422] In some embodiments, the LC CDR1 sequence, the LC CDR2 sequence, and / or the LC CDR3sequence are determined according to the Chothia numbering scheme.
[0423] In some embodiments, the LC CDR1 sequence, the LC CDR2 sequence, and / or the LC CDR3sequence are determined according to the IMGT numbering scheme.
[0424] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%,WSGR Docket No.53676-772.601 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the VH sequences listed in Table 24.
[0425] In some embodiments, the Nectin-4 binding moiety comprises a VL comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the VL sequences listed in Table 24.
[0426] In some embodiments, the Nectin-4 binding moiety comprises a VH comprising a sequencehaving at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the VH sequences listed in Table 24, and / or a VL comprising a sequence having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to any one of the VL sequences listed in Table 24.
[0427] In some embodiments, the multifunctional molecule as provided herein comprise any one of theconfiguration as describe herein, for example, any one of the configurations as described in FIGs.1A-1T, 103A-103F, and 125A-125T. In some embodiments, the multifunctional molecules as provided herein comprises a tumor-associated antigen binding moiety (e.g., a Nectin-4 binding moiety), a molecule that binds to a co-stimulatory receptor of a T cell, and a TCRβV-binding moiety. In some embodiments, the tumor-associated antigen binding moiety comprises a Nectin-4 binding moiety. In some embodiments, the molecule that binds to a co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof. In some embodiments, the molecule that binds to a co-stimulatory receptor of a T cell comprises an antibody molecule, an antigen binding domain, a ligand, an extracellular domain of a receptor, or any combination thereof. In some embodiments, the molecule that binds to a co-stimulatory receptor of a T cell binds to CD2, 4-1BB, CD27, CD28, or any combination thereof. Cytokine Molecules
[0428] In some embodiments, the multifunctional molecule includes a cytokine molecule. As usedherein, a “cytokine molecule” or a “cytokine polypeptide” as interchangeably used herein, refers to full length, a fragment or a variant of a cytokine; a cytokine further comprising a receptor domain, e.g., a cytokine receptor dimerizing domain; or an agonist of a cytokine receptor, e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor, that elicits at least one activity of a naturally- occurring cytokine. In some embodiments the cytokine molecule is chosen from interleukin-2 (IL-2), interleukin-7 (IL-7), interleukin-12 (IL-12), interleukin-10 (IL-10), interleukin-15 (IL-15), interleukin-18 (IL-18), interleukin-21 (IL-21), or interferon gamma, or a fragment or variant thereof, or a combination of any of the aforesaid cytokines. The cytokine molecule can be a monomer or a dimer. In embodiments, the cytokine molecule can further include a cytokine receptor dimerizing domain. In other embodiments, the cytokine molecule is an agonist of a cytokine receptor, e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor chosen from an IL-15Ra or IL-21R.WSGR Docket No.53676-772.601
[0429] Cytokines are generally polypeptides that influence cellular activity, for example, through signal transduction pathways. Accordingly, a cytokine of the multispecific or multifunctional polypeptide is useful and can be associated with receptor-mediated signaling that transmits a signal from outside the cell membrane to modulate a response within the cell. Cytokines are proteinaceous signaling compounds that are mediators of the immu...
Claims
WSGR Docket No.53676-772.601 CLAIMS What is claimed is:
1. A multifunctional molecule comprising:(a) a tumor-associated antigen binding moiety, wherein the tumor-associated antigen binding moiety comprises a Nectin-4 binding moiety; (b) a molecule that binds to a co-stimulatory receptor of a T cell; and (c) a TCRβV-binding moiety.
2. The multifunctional molecule of claim 1, wherein the TCRβV-binding moiety is covalently linkedto the molecule that binds to a co-stimulatory receptor of a T cell.
3. The multifunctional molecule of claim 1 or 2, wherein the molecule that binds to a co-stimulatoryreceptor of a T cell activates the co-stimulatory receptor when the molecule that binds to a co- stimulatory receptor of a T cell binds to the co-stimulatory receptor.
4. The multifunctional molecule of any one of claims 1-3, wherein the molecule that binds to a co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof.
5. The multifunctional molecule of any one of claims 1-3, wherein the molecule that binds to a co-stimulatory receptor of a T cell comprises an antibody molecule, an antigen binding domain, a ligand, an extracellular domain of a receptor, or any combination thereof.
6. The multifunctional molecule of any one of claims 1-5, wherein the Nectin-4 binding moietycomprises a antibody domain or an antigen binding domain.
7. The multifunctional molecule of any one of claims 1-6, wherein the antigen binding domaincomprises any one selected from the group consisting of a Fab, a F(ab')2, an Fv, a single chain Fv (scFv), a single domain antibody, a diabody (dAb), a VHH, a camelid antibody, and any combination thereof.
8. The multifunctional molecule of any one of claims 1-7, wherein the Nectin-4 binding moietycomprises (A) a heavy chain variable region (VH) comprising a heavy chain complementarity- determining region 1 (HC CDR1) sequence, a HC CDR2 sequence and a HC CDR3 sequence, and (B) a light chain variable region (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: (a) 3905, 3906, 3904, 3911, 3912, and 3913, respectively;(b) 3902, 3903, 3904, 3911, 3912, and 3913, respectively;(c) 3907, 3908, 3909, 3914, 3915, and 3913, respectively;(d) 1002, 3903, 3904, 3911, 3912, and 3913, respectively;(e) 1207, 1208, 1209, 3911, 4002, and 3913, respectively;(f) 1210, 1211, 1209, 3911, 4002, and 3913, respectively;(g) 1212, 1213, 1214, 3914, 4003, and 3913, respectively;WSGR Docket No.53676-772.601(h) 1215, 1211, 1209, 3911, 4002, and 3913, respectively;(i) 4005, 4006, 1209, 3911, 4002, and 3913, respectively;(j) 1222, 1223, 1209, 3911, 4002, and 3913, respectively;(k) 1224, 1225, 1226, 3914, 4003, and 3913, respectively;(l) 1227, 1223, 1209, 3911, 4002, and 3913, respectively;(m) 1229, 4007, 4008, 3911, 4002, and 3913, respectively;(n) 3902, 4009, 4008, 3911, 4002, and 3913, respectively;(o) 4010, 4011, 4012, 3914, 4003, and 3913, respectively;(p) 4013, 4009, 4008, 3911, 4002, and 3913, respectively;(q) 4005, 4006, 1209, 3911, 4015, and 3913, respectively;(r) 1222, 1223, 1209, 3911, 4015, and 3913, respectively;(s) 1224, 1225, 1226, 3914, 3915, and 3913, respectively;(t) 1227, 1223, 1209, 3911, 4015, and 3913, respectively;(u) 1229, 4007, 4008, 3911, 4015, and 3913, respectively;(v) 3902, 4009, 4008, 3911, 4015, and 3913, respectively;(w) 4010, 4011, 4012, 3914, 3915, and 3913, respectively;(x) 4013, 4009, 4008, 3911, 4015, and 3913, respectively;(y) 4017, 1241, 1209, 3911, 4002, and 3913, respectively;(z) 1242, 4018, 1209, 3911, 4002, and 3913, respectively;(aa) 4019, 4020, 1214, 3914, 4003, and 3913, respectively;(bb) 1246, 4018, 1209, 3911, 4002, and 3913, respectively;(cc) 4005, 4006, 1209, 3911, 1248, and 3913, respectively;(dd) 1222, 1223, 1209, 3911, 1248, and 3913, respectively;(ee) 1224, 1225, 1226, 3914, 1249, and 3913, respectively;(ff) 1227, 1223, 1209, 3911, 1248, and 3913, respectively;(gg) 1250, 1251, 1252, 3911, 4002, and 3913, respectively;(hh) 1253, 1254, 1252, 3911, 4002, and 3913, respectively;(ii) 1255, 1256, 1257, 3914, 4003, and 3913, respectively;(jj) 1258, 1254, 1252, 3911, 4002, and 3913, respectively;(kk) 4005, 4006, 1209, 3911, 1260, and 3913, respectively;(ll) 1222, 1223, 1209, 3911, 1260, and 3913, respectively;(mm) 1224, 1225, 1226, 3914, 1261, and 3913, respectively;(nn) 1227, 1223, 1209, 3911, 1260, and 3913, respectively;(oo) 1263, 1264, 3904, 3911, 4002, and 3913, respectively;(pp) 1265, 1266, 3904, 3911, 4002, and 3913, respectively;(qq) 1267, 1268, 3909, 3914, 4003, and 3913, respectively;(rr) 1269, 1266, 3904, 3911, 4002, and 3913, respectively;(ss) 1271, 1272, 3904, 3911, 4002, and 3913, respectively;WSGR Docket No.53676-772.601(tt) 1273, 1274, 3904, 3911, 4002, and 3913, respectively;(uu) 1275, 1276, 3909, 3914, 4003, and 3913, respectively;(vv) 1277, 1274, 3904, 3911, 4002, and 3913, respectively;(ww) 1279, 1280, 1209, 3911, 4002, and 3913, respectively;(xx) 1210, 1281, 1209, 3911, 4002, and 3913, respectively;(yy) 1282, 1283, 1214, 3914, 4003, and 3913, respectively;(zz) 1284, 1281, 1209, 3911, 4002, and 3913, respectively;(aaa)1400, 1401, 1209, 3911, 3912, and 3913, respectively;(bbb) 1402, 1403, 1209, 3911, 3912, and 3913, respectively;(ccc)1404, 1405, 1214, 3914, 3915, and 3913, respectively;(ddd) 1406, 1403, 1209, 3911, 3912, and 3913, respectively;(eee)4017, 1241, 1209, 1408, 4002, and 3913, respectively;(fff) 1242, 4018, 1209, 1408, 4002, and 3913, respectively;(ggg) 4019, 4020, 1214, 1409, 4003, and 3913, respectively;(hhh) 1246, 4018, 1209, 1408, 4002, and 3913, respectively;(iii) 4017, 1241, 1209, 1411, 4002, and 3913, respectively;(jjj) 1242, 4018, 1209, 1411, 4002, and 3913, respectively;(kkk) 4019, 4020, 1214, 1412, 4003, and 3913, respectively;(lll) 1246, 4018, 1209, 1411, 4002, and 3913, respectively;(mmm) 4017, 1241, 1209, 1411, 1414, and 3913, respectively;(nnn) 1242, 4018, 1209, 1411, 1414, and 3913, respectively;(ooo) 4019, 4020, 1214, 1412, 1415, and 3913, respectively;(ppp) 1246, 4018, 1209, 1411, 1414, and 3913, respectively;(qqq) 4017, 1241, 1209, 1417, 4002, and 3913, respectively;(rrr) 1242, 4018, 1209, 1417, 4002, and 3913, respectively;(sss) 4019, 4020, 1214, 1418, 4003, and 3913, respectively;(ttt) 1246, 4018, 1209, 1417, 4002, and 3913, respectively;(uuu) 4017, 1241, 1209, 1417, 1414, and 3913, respectively;(vvv) 1242, 4018, 1209, 1417, 1414, and 3913, respectively;(www) 4019, 4020, 1214, 1418, 1415, and 3913, respectively;(xxx) 1246, 4018, 1209, 1417, 1414, and 3913, respectively;(yyy) 1421, 1422, 1423, 1431, 1432, and 1433, respectively;(zzz)1424, 1425, 1423, 1431, 1432, and 1433, respectively;(aaaa) 1426, 1427, 1428, 1434, 3915, and 1433, respectively;(bbbb) 1429, 1425, 1423, 1431, 1432, and 1433, respectively;(cccc) 1436, 1422, 1423, 1431, 1432, and 1433, respectively;(dddd) 1437, 1425, 1423, 1431, 1432, and 1433, respectively;(eeee) 1438, 1427, 1428, 1434, 3915, and 1433, respectively;WSGR Docket No.53676-772.601 (ffff)1439, 1425, 1423, 1431, 1432, and 1433, respectively; (gggg) 1441, 1425, 1423, 1431, 1432, and 1433, respectively;(hhhh) 1442, 1427, 1428, 1434, 3915, and 1433, respectively;(iiii) 1443, 1425, 1423, 1431, 1432, and 1433, respectively;(jjjj) 1421, 1422, 1445, 1431, 1432, and 1433, respectively;(kkkk) 1424, 1425, 1445, 1431, 1432, and 1433, respectively;(llll) 1426, 1427, 1446, 1434, 3915, and 1433, respectively;(mmmm) 1429, 1425, 1445, 1431, 1432, and 1433, respectively;(nnnn) 1421, 1422, 1423, 1431, 1432, and 1449, respectively;(oooo) 1424, 1425, 1423, 1431, 1432, and 1449, respectively;(pppp) 1426, 1427, 1428, 1434, 3915, and 1449, respectively;(qqqq) 1429, 1425, 1423, 1431, 1432, and 1449, respectively;(rrrr)1424, 1451, 1423, 1431, 1432, and 1433, respectively; (ssss) 1429, 1451, 1423, 1431, 1432, and 1433, respectively;(tttt) 1441, 1425, 1423, 1431, 1432, and 1449, respectively;(uuuu) 1442, 1427, 1428, 1434, 3915, and 1449, respectively;(vvvv) 1443, 1425, 1423, 1431, 1432, and 1449, respectively;(wwww) 1421, 1422, 1423, 1453, 1454, and 1433, respectively;(xxxx) 1424, 1425, 1423, 1453, 1454, and 1433, respectively;(yyyy) 1426, 1427, 1428, 1455, 3915, and 1433, respectively;(zzzz) 1429, 1425, 1423, 1453, 1454, and 1433, respectively;(aaaaa) 1421, 1422, 1423, 1453, 1454, and 1449, respectively;(bbbbb) 1424, 1425, 1423, 1453, 1454, and 1449, respectively;(ccccc) 1426, 1427, 1428, 1455, 3915, and 1449, respectively;(ddddd) 1429, 1425, 1423, 1453, 1454, and 1449, respectively;(eeeee) 1458, 1425, 1423, 1431, 1432, and 1433, respectively;(fffff) 1459, 1427, 1428, 1434, 3915, and 1433, respectively;(ggggg) 1460, 1425, 1423, 1431, 1432, and 1433, respectively;(hhhhh) 1436, 1422, 1423, 1431, 1432, and 1449, respectively;(iiiii) 1437, 1425, 1423, 1431, 1432, and 1449, respectively;(jjjjj) 1438, 1427, 1428, 1434, 3915, and 1449, respectively; or(kkkkk) 1439, 1425, 1423, 1431, 1432, and 1449, respectively.
9. The multifunctional molecule of any one of claims 1-8, wherein the Nectin-4 binding moietycomprises a. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1001 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;b. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1200 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;c. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1200 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;d. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1202 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;e. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1202 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;f. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1202 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1203;g. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1204 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;h. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1204 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;WSGR Docket No.53676-772.601i. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1205 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;j. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1205 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;k. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1206 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;l. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;m. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1228 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;n. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4014;o. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1228 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4014;p. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;q. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1247;r. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1249 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;s. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1259;t. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1262 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;u. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1270 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;v. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1278 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;w. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1285 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;WSGR Docket No.53676-772.601x. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1407;y. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1410;z. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1413;aa. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1416;bb. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1419;cc. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;dd. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1435 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;ee. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1440 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;ff. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1444 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;gg. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;hh. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1448;ii. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1450 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;jj. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1435 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;kk. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1440 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;ll. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1450 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;WSGR Docket No.53676-772.601 mm. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1440 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1448; nn. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1452; oo. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1456; pp. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1457 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430; or qq. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1435 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1448.
10. The multifunctional molecule of any one of claims 1-9, wherein the Nectin-4 binding moietycomprises a VH comprising a HC CDR1, a HC CDR2, and a HC CDR3 comprising the HC CDR1 sequence, the HC CDR2 sequence, and the HC CDR3 sequence of any one of SEQ ID NOs: 1001, 1200, 1202, 1204, 1205, 1206, 4004, 1228, 4016, 1249, 1262, 1270, 1278, 1285, 4016, 1420, 1435, 1440, 1444, 1450, and 1457, wherein the HC CDR1 sequence, the HC CDR2 sequence, and the HC CDR3 sequence are determined according to the Kabat. IMGT or Chothia numbering scheme.
11. The multifunctional molecule of any one of claims 1-9, wherein the Nectin-4 binding moietycomprises a VL comprising a LC CDR1, a LC CDR2, and a LC CDR3 comprising the LC CDR1 sequence, the LC CDR2 sequence, and the LC CDR3 sequence of any one of SEQ ID NOs: 1003, 1201, 1203, 4001, 4014, 1247, 1259, 1407, 1410, 1413, 1416, 1419, 1430, 1447, 1448, 1452, and 1456, wherein the LC CDR1 sequence, the LC CDR2 sequence, and the LC CDR3 sequence are determined according to the Kabat, IMGT or Chothia numbering scheme.WSGR Docket No.53676-772.60112. The multifunctional molecule of any one of claims 1-11, wherein the multifunctional moleculecomprises a first polypeptide chain comprising a first portion of a dimerization module, and a second polypeptide chain comprising a second portion of the dimerization module; wherein the first polypeptide chain and the second polypeptide chain are non-contiguous, and wherein the tumor-associated antigen binding moiety is linked to the first portion of the dimerization module, and the TCRβV-binding moiety and / or the molecule that binds to a co- stimulatory receptor of a T cell are independently linked to the first portion of the dimerization module, the second portion of the dimerization module, or a combination thereof.
13. The multifunctional molecule of claim 12, wherein:(i) the tumor-associated antigen binding moiety is linked to the N-terminus of the first portion of the dimerization module, and the TCRβV-binding moiety is linked to the C-terminus of the first portion of the dimerization module, the N-terminus of the second portion of the dimerization module, the C-terminus of the second portion of the dimerization module, or any combination thereof; or (ii) the tumor-associated antigen binding moiety is linked to the C-terminus of the first portion of the dimerization module, and the molecule that binds to a co-stimulatory receptor of a T cell is linked to the N-terminus of the first portion of the dimerization module, the N-terminus of the second portion of the dimerization module, the C-terminus of the second portion of the dimerization module, or any combination thereof.
14. The multifunctional molecule of claim 12 or 13, wherein:(i) the tumor-associated antigen binding moiety is linked to the N-terminus of the first portion of the dimerization module, and the molecule that binds to a co-stimulatory receptor of a T cell is linked to the C-terminus of the first portion of the dimerization module, the N-terminus of the second portion of the dimerization module, the C-terminus of the second portion of the dimerization module, or any combination thereof; or (ii) the tumor-associated antigen binding moiety is linked to the C-terminus of the first portion of the dimerization module, and the molecule that binds to a co-stimulatory receptor of a T cell is linked to the N-terminus of the first portion of the dimerization module, the N-terminus of the second portion of the dimerization module, the C-terminus of the second portion of the dimerization module, or any combination thereof.
15. The multifunctional molecule of any one of claims 12-14, wherein the TCRβV-binding moiety andthe molecule that binds to a co-stimulatory receptor of a T cell is within a single contiguous polypeptide chain of the first polypeptide chain or the second polypeptide chain.
16. The multifunctional molecule of any one of claims 1-15, wherein the tumor-associated antigenbinding moiety, the TCRβV-binding moiety, or a combination thereof comprises an antibody or antigen binding fragment thereof, or antigen binding domain, wherein the antigen binding fragment or antigen binding domain comprises any one selected from the group consisting of a Fab, aWSGR Docket No.53676-772.601 F(ab')2, an Fv, a single chain Fv (scFv), a single domain antibody, a diabody (dAb), a VHH, a camelid antibody, and any combination thereof.
17. The multifunctional molecule of any one of claims 1-16, wherein the TCRβV-binding moietycomprises a heavy chain variable domain (VH) and a light chain variable domain (VL), or a single domain antibody.
18. The multifunctional molecule of any one of claims 12-16, wherein the TCRβV-binding moietycomprises a first portion of the TCRβV-binding moiety, and wherein the multifunctional molecule further comprises a third polypeptide chain comprising a second portion of the TCRβV-binding moiety, wherein the third polypeptide chain is non- contiguous with the first polypeptide chain and the second polypeptide chain.
19. The multifunctional molecule of claim 18, wherein the first portion of the TCRβV-binding moietycomprises a VH of the TCRβV-binding moiety and the second portion of the TCRβV-binding moiety comprises a VL of the TCRβV-binding moiety, or the first portion of the TCRβV-binding moiety comprises a VL of the TCRβV-binding moiety and the second portion of the TCRβV- binding moiety comprises a VH of the TCRβV-binding moiety.
20. The multifunctional molecule of any one of claims 1-19, wherein the tumor-associated antigenbinding moiety comprises a VH and a VL, or a single domain antibody.
21. The multifunctional molecule of any one of claims 12-19, wherein the tumor-associated antigenbinding moiety comprises a first portion of the tumor-associated antigen binding moiety, and wherein the multifunctional molecule further comprises a fourth polypeptide chain comprising a second portion of the tumor-associated antigen binding moiety, wherein the fourth polypeptide chain is non-contiguous with the first polypeptide chain, the second polypeptide chain, and the third polypeptide chain.
22. The multifunctional molecule of claim 21, wherein the first portion of the tumor-associated antigenbinding moiety comprises a VH of the tumor-associated antigen binding moiety and the second portion of the tumor-associated antigen binding moiety comprises a VL of the tumor-associated antigen binding moiety, or the first portion of the tumor-associated antigen binding moiety comprises a VL of the tumor-associated antigen binding moiety and the second portion of the tumor-associated antigen binding moiety comprises a VH of the tumor-associated antigen binding moiety.
23. The multifunctional molecule of any one of claims 1-22, wherein the first portion of thedimerization module and the second portion of the dimerization module are dimerized.
24. The multifunctional molecule of any one of claims 1-23, wherein:(i) the tumor-associated antigen binding moiety further comprises a heavy chain constant domain 1 (CH1) linked to the VH of the tumor-associated antigen binding moiety; (ii) the TCRβV-binding moiety further comprises a heavy chain constant domain 1 (CH1) linked to the VH of the TCRβV-binding moiety; or (iii) a combination thereof.WSGR Docket No.53676-772.60125. The multifunctional molecule of any one of claims 1-24, wherein:(i) the tumor-associated antigen binding moiety further comprises a light chain constant domain (CL) linked to the VL of the tumor-associated antigen binding moiety; (ii) the TCRβV-binding moiety further comprises a light chain constant domain (CL) linked to the VL of the TCRβV-binding moiety; or (iii) a combination thereof.
26. The multifunctional molecule of claim 25, wherein:(i) the CL linked to the VL of the tumor-associated antigen binding moiety comprises a kappa chain constant domain or a lambda chain constant domain; (ii) the CL linked to the VL of the TCRβV-binding moiety comprises a kappa chain constant domain or a lambda chain constant domain; or (iii) a combination thereof.
27. The multifunctional molecule of claim 26, wherein the kappa chain constant domain or the lambdachain constant domain comprises any one of the light chain constant region sequences listed in Table 3, 21, or 22.
28. The multifunctional molecule of any one of claims 1-27, further comprising:(i) a linker between the first portion of the dimerization module and the tumor-associated antigen binding moiety or the first portion of the tumor-associated antigen; (ii) a linker between the molecule that binds to a co-stimulatory receptor of a T cell and the first portion of the dimerization module, a linker between the molecule that binds to a co-stimulatory receptor of a T cell and the second portion of the dimerization module, or a combination thereof; (iii) a linker between the molecule that binds to a co-stimulatory receptor of a T cell and the TCRβV-binding moiety or the first portion of the TCRβV-binding moiety; (iv) a linker between the VH and the VL of the tumor-associated antigen binding moiety; (v) a linker between the VH and the VL of the TCRβV-binding moiety; (vi) a linker between the CH1 and the VH of the tumor-associated antigen binding moiety; (vii) a linker between the CH1 and the VH of the TCRβV-binding moiety; (viii) a linker between the CL and the VL of the tumor-associated antigen binding moiety; (ix) a linker between the CL and the VL of the TCRβV-binding moiety; or (x) any combination thereof.
29. The multifunctional molecule of claim 28, wherein the linker is selected from the group consistingof a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, and a non-helical linker.
30. The multifunctional molecule of claim 29, wherein the linker is the peptide linker, and wherein thelinker comprises the sequence of SEQ ID NO: 3801, 3309, 3307, 3308, or 3643.
31. The multifunctional molecule of any one of claims 1-30, wherein the multifunctional molecule isan isolated multifunctional molecule .WSGR Docket No.53676-772.60132. The multifunctional molecule of any one of claims 1-31, wherein the tumor-associated antigenbinding moiety, the TCRβV-binding moiety, or a combination thereof comprises a VHH, an Fab, or an scFv.
33. The multifunctional molecule of any one of claims 1-32, wherein the molecule that binds to a co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof is selected from the group consisting of interleukin-2 (IL-2) or a functional fragment or functional variant thereof, interleukin-7 (IL-7) or a functional fragment or functional variant thereof, interleukin-12 (IL-12) or a functional fragment or functional variant thereof, interleukin-15 (IL-15) or a functional fragment or functional variant thereof, interleukin-18 (IL-18) or a functional fragment or functional variant thereof, interleukin-21 (IL-21) or a functional fragment or functional variant thereof, or interferon gamma or a functional fragment or functional variant thereof, or any combination thereof.
34. The multifunctional molecule of any one of claims 1-33, wherein the molecule that binds to a co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises interleukin-2 (IL-2) or a functional fragment or functional variant thereof.
35. The multifunctional molecule of claim 34, wherein the at least one cytokine molecule or afunctional fragment or functional variant thereof is an IL-2 variant comprising a substitution mutation.
36. The multifunctional molecule of claim 35, wherein the at least one cytokine molecule or afunctional fragment or functional variant thereof is an IL-2 variant comprising C125A mutation.
37. The multifunctional molecule of any one of claims 34-36, wherein the at least one cytokinemolecule or a functional fragment or functional variant thereof comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 2270 or the sequence of SEQ ID NO: 2191.
38. The multifunctional molecule of any one of claims 34-37, wherein the at least one cytokinemolecule or a functional fragment or functional variant thereof comprises the sequence of SEQ ID NO: 2270 or the sequence of SEQ ID NO: 2191.
39. The multifunctional molecule of any one of claims 1-38, wherein the molecule that binds to a co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to any one of the cytokine sequences as described herein or any one of the cytokine sequences as listed in Table 28 or 29.WSGR Docket No.53676-772.60140. The multifunctional molecule of any one of claims 1-39, wherein the molecule that binds to a co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises any one of the cytokine sequences as described herein or any one of the cytokine sequences as listed in Table 28 or 29.
41. The multifunctional molecule of any one of claims 1-3, and 5-32, wherein the molecule that bindsto a co-stimulatory receptor of a T cell binds to CD2, 4-1BB, CD27, CD28, or any combination thereof.
42. The multifunctional molecule of any one of claims 1-41, wherein the first portion of thedimerization module comprises a first immunoglobulin constant regions (Fc regions) and the second portion of the dimerization module comprises a second Fc region.
43. The multifunctional molecule of claim 42, wherein the first Fc region, the second Fc region, or acombination thereof is selected from the group consisting of an IgG1 Fc region or a fragment thereof, an IgG2 Fc region or a fragment thereof, an IgG3 Fc region or a fragment thereof, an IgGA1 Fc region or a fragment thereof, an IgGA2 Fc region or a fragment thereof, an IgG4 Fc region or a fragment thereof, an IgJ Fc region or a fragment thereof, an IgM Fc region or a fragment thereof, an IgD Fc region or a fragment thereof, and an IgE Fc region or a fragment thereof.
44. The multifunctional molecule of claim 43, wherein the first Fc region, the second Fc region, or acombination thereof is selected from the group consisting of a human IgG1 Fc region or a fragment thereof, a human IgG2 Fc region or a fragment thereof, and a human IgG4 Fc region or a fragment thereof.
45. The multifunctional molecule of any one of claims 42-44, wherein the first Fc region, the secondFc region, or a combination thereof comprises an Fc interface with one or more of: a paired cavity- protuberance, an electrostatic interaction, or a strand-exchange, wherein the dimerization of the first Fc region and the second Fc region is enhanced as indicated by a greater ratio of heteromultimer:homomultimer forms relative to a dimerization of Fc regions with a non- engineered interface.
46. The multifunctional molecule of claim 45, wherein the first Fc region, the second Fc region, or acombination thereof comprises an amino acid substitution listed in Table 4 or 14.
47. The multifunctional molecule of claim 46, wherein the first Fc region, the second Fc region, or acombination thereof comprises an Asn297Ala (N297A) mutation or a Leu234Ala / Leu235Ala (LALA) mutation.
48. The multifunctional molecule of claim 45, wherein the first Fc region, the second Fc region, or acombination thereof comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 40, 42, 3645, 3646, 3647, 3648, 3649, 3792,WSGR Docket No.53676-772.601 3648, 3794, 3533, 1247, 1619, 1620, 571, 1669, 573, 1670, 1691, 1692, 1257, 550, 1080; 560, 1259, 1612, 1613, 579, 1678, 1700, 1704, 579, 1278, 1287, or 3794.
49. The multifunctional molecule of claim 45, wherein the first Fc region, the second Fc region, or acombination thereof comprises the sequence of SEQ ID NO: 40, 42, 3645, 3646, 3647, 3648, 3649, 3792, 3648, 3794, 3533, 1247, 1619, 1620, 571, 1669, 573, 1670, 1691, 1692, 1257, 550, 1080; 560, 1259, 1612, 1613, 579, 1678, 1700, 1704, 579, 1278, 1287, or 3794.
50. The multifunctional molecule of claim 45, wherein the first Fc region comprises a sequence havingat least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, and the second Fc region comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794, or the first Fc region comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794, and the second Fc region comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794.
51. The multifunctional molecule of claim 45, wherein the first Fc region comprises a sequence havingthe sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, and the second Fc region comprises the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794, or the first Fc region comprises the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794, and the second Fc region comprises the sequence of SEQ ID NO: 3648 or SEQ ID NO: 3794.
52. The multifunctional molecule of claim 45, wherein the first Fc region comprises a sequence havingat least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3648, 3794, 3533, 1247, 1619, 1620, 571, 1669, 573, 1670, 1691, 1692, or 1257, and the second Fc region comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 550, 1080; 560, 1259, 1612, 1613, 579, 1678, 1700, 1704, 579, 1278, or 1287, or the first Fc region comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 550, 1080; 560, 1259, 1612, 1613, 579, 1678, 1700, 1704, 579, 1278, or 1287, and the second Fc region comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3648, 3794, 3533, 1247, 1619, 1620, 571, 1669, 573, 1670, 1691, 1692, or 1257.WSGR Docket No.53676-772.60153. The multifunctional molecule of claim 45, wherein the first Fc region comprises a sequence havingthe sequence of SEQ ID NO: 3648, 3794, 3533, 1247, 1619, 1620, 571, 1669, 573, 1670, 1691, 1692, or 1257, and the second Fc region comprises the sequence of SEQ ID NO: 550, 1080; 560, 1259, 1612, 1613, 579, 1678, 1700, 1704, 579, 1278, or 1287, or the first Fc region comprises the sequence of SEQ ID NO: 550, 1080; 560, 1259, 1612, 1613, 579, 1678, 1700, 1704, 579, 1278, or 1287, and the second Fc region comprises the sequence of SEQ ID NO: 3648, 3794, 3533, 1247, 1619, 1620, 571, 1669, 573, 1670, 1691, 1692, or 1257.
54. The multifunctional molecule of any one of claims 1-53, wherein the TCRβV-binding moiety bindsto one or more of a TCRβV subfamily selected from the group consisting of TCRβ V2 subfamily, TCRβ V3 subfamily, TCRβ V4 subfamily, TCRβ V5 subfamily, TCRβ V6 subfamily, TCRβ V9 subfamily, TCRβ V10 subfamily, TCRβ V11 subfamily, TCRβ V12 subfamily, TCRβ V13 subfamily, TCRβ V16 subfamily, TCRβ V19, TCRβ V20 subfamily, TCRβ V21 subfamily, TCRβ V23 subfamily, TCRβ V27 subfamily, and TCRβ V28 subfamily.
55. The multifunctional molecule of any one of claims 1-54, wherein the TCRβV-binding moiety bindsto one or more of a TCRβV subfamily selected from the group consisting of: (i) TCRβ V2 subfamily comprising TCRβ V2*01; (ii) TCRβ V3 subfamily comprising TCRβ V3-1*01; (iii) TCRβ V4 subfamily comprising one or more selected from TCRβ V4-1, TCRβ V4-2, and TCRβ V4-3; (iv) TCRβ V5 subfamily comprising one or more selected from TCRβ V5-6*01, TCRβ V5-4*01, TCRβ V5-1*01, and TCRβ V5-8*01; (v) TCRβ V6 subfamily comprising one or more selected from TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6- 2*01, TCRβ V6-3*01, and TCRβ V6-1*01; (vi) TCRβ V10 subfamily comprising one or more selected from TCRβ V10-1*01, TCRβ V10- 1*02, TCRβ V10-3*01, and TCRβ V10-2*01; (vii) TCRβ V11 subfamily comprising TCRβ V11-2; (viii) TCRβ V12 subfamily comprising one or more selected from TCRβ V12-4*01, TCRβ V12- 3*01, and TCRβ V12-5*01; (ix) TCRβ V13 subfamily comprising TCRβ V13*01; (x) TCRβ V16 subfamily comprising TCRβ V16*01; (xi) TCRβ V19 subfamily comprising one or more selected from TCRβ V19*01 and TCRβ V19*02; or (xii) TCRβ V20 subfamily comprising TCRβ V20-1*01, or TCRβ V20-1*02.
56. The multifunctional molecule of any one of claims 1-55, wherein the TCRβV-binding moiety bindsto TCRβ V6 subfamily, TCRβV10 subfamily, TCRβV12 subfamily, or TCRβ V20 subfamily.
57. The multifunctional molecule of any one of claims 1-56, wherein the TCRβV-binding moietycomprises:WSGR Docket No.53676-772.601 (i) a VH comprising a combination of a HC CDR1, a HC CDR2 and a HC CDR3 listed in Tables 1, 2, 12, 13, 21, or 22; (ii) a VL comprising a combination of a LC CDR1, a LC CDR2, and a LC CDR3 listed in Tables 1, 2, 12, 13, 21, or 22; or (iii) any combination thereof.
58. The multifunctional molecule of any one of claims 1-57, wherein the TCRβV-binding moietycomprises: (i) a VH comprising a HC CDR1, a HC CDR2 and a HC CDR3 of any one of the heavy chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22; (ii) a VL comprising a LC CDR1, a LC CDR2, and a LC CDR3 of any one of the light chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22; or (iii) any combination thereof.
59. The multifunctional molecule of any one of claims 1-58, wherein the TCRβV-binding moietycomprises: (i) a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the heavy chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22; (ii) a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the light chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22; (iii) a combination thereof.
60. The multifunctional molecule of any one of claims 1-59, wherein the TCRβV-binding moietycomprises: (i) a VH comprising any one of the heavy chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22; (ii) a VL comprising any one of the light chain variable domain amino acid sequences listed in Tables 1, 2, 12, 13, 21, or 22; (iii) a combination thereof.
61. The multifunctional molecule of any one of claims 1-60, wherein the TCRβV-binding moietycomprises (A) a heavy chain variable region (VH) comprising a heavy chain complementarity- determining region 1 (HC CDR1) sequence, a HC CDR2 sequence and a HC CDR3 sequence, and (B) a light chain variable region (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: a. 1069, 1070, 5, 3655, 3653, and 8, respectively;WSGR Docket No.53676-772.601 b. 1071, 3651, 5, 3655, 3653, and 8, respectively;c. 1072, 1073, 1074, 1075, 1076, and 8, respectively;d. 3650, 3651, 5, 3655, 3653, and 8, respectively;e. 1069, 1070, 5, 1218, 1219, and 8, respectively;f. 1071, 3651, 5, 1218, 1219, and 8, respectively;g. 1072, 1073, 1074, 1220, 1221, and 8, respectively;h. 3650, 3651, 5, 1218, 1219, and 8, respectively;i. 1232, 1233, 544, 545, 546, and 547, respectively;j. 1234, 543, 544, 545, 546, and 547, respectively;k. 1235, 1236, 1237, 1239, 1240, and 547, respectively;l. 1238, 543, 544, 545, 546, and 547, respectively;m. 1243, 1233, 544, 545, 546, and 547, respectively;n. 1244, 543, 544, 545, 546, and 547, respectively;o. 1245, 1236, 1237, 1239, 1240, and 547, respectively;p. 542, 543, 544, 545, 546, and 547, respectively;q. 1069, 1070, 5, 3655, 1467, and 8, respectively;r. 1071, 3651, 5, 3655, 1467, and 8, respectively;s. 1072, 1073, 1074, 1220, 1221, and 8, respectively;t. 3650, 3651, 5, 3655, 1467, and 8, respectively;u. 1232, 1233, 544, 545, 546, and 1486, respectively;v. 1234, 543, 544, 545, 546, and 1486, respectively;w. 1235, 1236, 1237, 1239, 1240, and 1486, respectively; orx. 1238, 543, 544, 545, 546, and 1486, respectively.
62. The multifunctional molecule of any one of claims 1-61, wherein the TCRβV-binding moietycomprises a. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1346 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1349, b. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1346 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1217, c. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1231 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 3527, d. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 541 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 3527, e. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1231 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1485, or f. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1346 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1466.
63. The multifunctional molecule of any one of claims 1-61, wherein the TCRβV-binding moietycomprises a. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1331, b. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1216, c. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1230, d. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1376, e. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1483, or f. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1701.WSGR Docket No.53676-772.60164. The multifunctional molecule of any one of claims 12 to 62, wherein the second polypeptide chaincomprises a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346, 541, or 1231, a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466, a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 2270, and a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 3648.
65. The multifunctional molecule of any one of claims 12-63, wherein the second polypeptide chaincomprises the sequence of SEQ ID NO: 1346, 541, or 1231, the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466, the sequence of SEQ ID NO: 2270, and the sequence of SEQ ID NO: 3648.
66. The multifunctional molecule of claim 63 or 65, wherein the second polypeptide chain furthercomprises the sequence of SEQ ID NO: 3801, the sequence of SEQ ID NO: 3309, the sequence of SEQ ID NO: 3308, or any combination thereof.
67. The multifunctional molecule of any one of claims 12-63, wherein the second polypeptide chaincomprises a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346, 541, or 1231 operatively linked to a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466 operatively linked to a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 2270 operatively linked to a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 3648.
68. The multifunctional molecule of claim 67, wherein the sequence having at least 80%, 81%, 82%,83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346, 541, or 1231 is operatively linked to the sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466 via the sequence of SEQ ID NO: 3801.
69. The multifunctional molecule of claim 67 or 68, wherein the sequence having at least 80%, 81%,82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466WSGR Docket No.53676-772.601 is operatively linked to the sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 2270 via the sequence of SEQ ID NO: 3309.
70. The multifunctional molecule of any one of claims 67-69, wherein the sequence having at least80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 2270 is operatively linked to the sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 3648 via the sequence of SEQ ID NO: 3308.
71. The multifunctional molecule of any one of claims 12-70, wherein the second polypeptide chaincomprises the sequence of SEQ ID NO: 1346, 541, or 1231 operatively linked to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466 operatively linked to the sequence of SEQ ID NO: 2270 operatively linked to the sequence of SEQ ID NO: 3648.
72. The multifunctional molecule of claim 71, wherein the sequence of SEQ ID NO: 1346, 541, or1231 is operatively linked to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466 via the sequence of SEQ ID NO: 3801.
73. The multifunctional molecule of claim 71 or 72, wherein the sequence of SEQ ID NO: 1349, 1217,3527, 1485, or 1466 is operatively linked to the sequence of SEQ ID NO: 2270 via the sequence of SEQ ID NO: 3309.
74. The multifunctional molecule of any one of claims 71-73, wherein the sequence of SEQ ID NO:2270 is operatively linked to the sequence of SEQ ID NO: 3648 via the sequence of SEQ ID NO: 3308.
75. The multifunctional molecule of any one of claims 12-74, wherein the second polypeptide chaincomprises a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 3800.
76. The multifunctional molecule of any one of claims 12-75, wherein the second polypeptide chaincomprises the sequence of SEQ ID NO: 3800.
77. The multifunctional molecule of any one of claims 1-76, wherein the multifunctional moleculeconsists of a first polypeptide chain and a second polypeptide chain, wherein the first polypeptide chain comprises the tumor-associated antigen binding moiety linked to an Fc region, wherein the tumor-associated antigen binding moiety is an scFv that binds to a tumor-associated antigen, and the second polypeptide chain comprises the sequence of SEQ ID NO 3800.
78. The multifunctional molecule of any one of claims 1-77, wherein the multifunctional moleculeconsists of a first polypeptide chain and a second polypeptide chain, wherein the first polypeptide chain comprises the tumor-associated antigen binding moiety linked to a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3649 or SEQ IDWSGR Docket No.53676-772.601 NO: 3792, wherein the tumor-associated antigen binding moiety is an scFv that binds to a tumor- associated antigen, and the second polypeptide chain comprises the sequence of SEQ ID NO 3800.
79. The multifunctional molecule of any one of claims 1-78, wherein the multifunctional moleculeconsists of a first polypeptide chain and a second polypeptide chain, wherein the first polypeptide chain comprises the tumor-associated antigen binding moiety linked to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, wherein the tumor-associated antigen binding moiety is an scFv that binds to a tumor-associated antigen, and the second polypeptide chain comprises the sequence of SEQ ID NO 3800.
80. The multifunctional molecule of any one of claims 1-76, wherein the multifunctional moleculeconsists of a first polypeptide chain, a second polypeptide chain, and a third polypeptide chain, wherein the first polypeptide chain comprises a first portion of the tumor-associated antigen binding moiety linked to an Fc region, wherein the tumor-associated antigen binding moiety is an Fab that binds to a tumor-associated antigen; the second polypeptide chain comprises the sequence of SEQ ID NO 3800; and the third polypeptide chain comprises a second portion of the tumor- associated antigen binding moiety.
81. The multifunctional molecule of any one of claims 1-76, and 80, wherein the multifunctionalmolecule consists of a first polypeptide chain, a second polypeptide chain, and a third polypeptide chain, wherein the first polypeptide chain comprises a first portion of the tumor-associated antigen binding moiety linked to a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%- sequence identity to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, wherein the tumor-associated antigen binding moiety is an Fab that binds to a tumor-associated antigen; the second polypeptide chain comprises the sequence of SEQ ID NO 3800; and the third polypeptide chain comprises a second portion of the tumor-associated antigen binding moiety.
82. The multifunctional molecule of any one of claims 1-76, 80, and 81, wherein the multifunctionalmolecule consists of a first polypeptide chain, a second polypeptide chain, and a third polypeptide chain, wherein the first polypeptide chain comprises a first portion of the tumor-associated antigen binding moiety linked to the sequence of SEQ ID NO: 3649 or SEQ ID NO: 3792, wherein the tumor-associated antigen binding moiety is an Fab that binds to a tumor-associated antigen; the second polypeptide chain comprises the sequence of SEQ ID NO 3800; and the third polypeptide chain comprises a second portion of the tumor-associated antigen binding moiety.
83. The multifunctional molecule of any one of claims 1-82, wherein the tumor-associated antigen isNectin-4.
84. The multifunctional molecule of any one of claims 1-83, wherein the multifunctional molecule is apolypeptide molecule.
85. The multifunctional molecule of any one of claims 1-84, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%,WSGR Docket No.53676-772.601 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346, 541, or 1231.
86. The multifunctional molecule of any one of claims 1-85, wherein the TCRβV-binding moietycomprises a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466.
87. The multifunctional molecule of any one of claims 1-86, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346 and a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1349.
88. The multifunctional molecule of any one of claims 1-86, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 541 and a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the sequence of SEQ ID NO: 3527.
89. The multifunctional molecule of any one of claims 1-86, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346 and a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the sequence of SEQ ID NO: 1217.
90. The multifunctional molecule of any one of claims 1-86, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1231 and a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the sequence of SEQ ID NO: 3527.
91. The multifunctional molecule of any one of claims 1-86, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1231 and a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the sequence of SEQ ID NO: 1485.
92. The multifunctional molecule of any one of claims 1-86, wherein the TCRβV-binding moietycomprises a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%,WSGR Docket No.53676-772.601 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1346 and a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the sequence of SEQ ID NO: 1466.
93. The multifunctional molecule of any one of claims 1-92, wherein the TCRβV-binding moietycomprises an scFv comprising the sequence of SEQ ID NO: 1346, 541, or 1231 operatively linked to the sequence of SEQ ID NO: 1349, 1217, 3527, 1485, or 1466 via a linker comprising the sequence of SEQ ID NO: 3801.
94. The multifunctional molecule of any one of claims 1-93, wherein the TCRβV-binding moietycomprises an scFv comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 1331, 1216, 1230, 1376, 1483, or 1701.
95. The multifunctional molecule of any one of claims 1-92, wherein the multifunctional moleculecomprises a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1066, 1067, 1461, 1462, 1464, 1465, 1471, 1472, 1477, 1478, 1481, 1482, 1496, 1497, 1617, 1703, 1705, 1706, 515, 1661, 506, or 1681.
96. The multifunctional molecule of any one of claims 1-92, wherein the multifunctional moleculecomprises a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1077, 1078, 1468, 1469, 1473, 1474, 1479, 1480, 1491, 1492, 1608, 1609, 1614, 1615, 1631, 1632, 1634, 1707, 1653, 1654, 1675, 1679, 1695, or 1696.
97. The multifunctional molecule of any one of claims 1-92, wherein the multifunctional moleculecomprises a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1081, 1087, 1096, 1494, 1623, 1625, 1629, 1647, 1660, 516, 1660, or 507.
98. The multifunctional molecule of any one of claims 1-92, wherein the multifunctional moleculecomprises: a. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 10661067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;WSGR Docket No.53676-772.601b. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;c. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;d. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;e. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;f. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,WSGR Docket No.53676-772.601 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;g. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1464 or 1465, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;h. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1464 or 1465, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO:1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;i. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1464 or 1465, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1077 or 1078, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;j. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1468 or 1469, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;k. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,WSGR Docket No.53676-772.601 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1468 or 1469, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;l. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1468 or 1469, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;m. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1468 or 1469, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;n. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1468 or 1469, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;o. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1468 or 1469, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;p. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100%WSGR Docket No.53676-772.601 sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;q. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;r. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1477 or 1478, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;s. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1477 or 1478, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;t. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1479 or 1480, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;WSGR Docket No.53676-772.601u. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1479 or 1480, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;v. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1477 or 1478, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1479 or 1480, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081;w. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1477 or 1478, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1479 or 1480, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;x. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;y. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1477 or 1478, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,WSGR Docket No.53676-772.601 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;z. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1479 or 1480, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;aa. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1477 or 1478, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1479 or 1480, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;bb. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1481 or 1482, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1081:cc. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1481 or 1482, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1087;dd. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1481 or 1482, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,WSGR Docket No.53676-772.601 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1473 or 1474, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1096;ee. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1491 or 1492, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1494;ff. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1496 or 1497, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1491 or 1492, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1494;gg. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1464 or 1465, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1491 or 1492, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1494;hh. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1496 or 1497, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1491 or 1492, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1494;ii. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100%WSGR Docket No.53676-772.601 sequence identity to SEQ ID NO: 1617 or 1703, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1608 or 1609, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1494;jj. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1614 or 1615, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1623;kk. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1614 or 1615, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1625;ll. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1614 or 1615, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1629;mm. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%,85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1614 or 1615, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1623;WSGR Docket No.53676-772.601nn. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1614 or 1615, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1625;oo. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1614 or 1615, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1629;pp. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1631 or 1632, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1623;qq. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1631 or 1632, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1625;rr. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1066 or 1067, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1631 or 1632, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,WSGR Docket No.53676-772.601 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1629;ss. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1631 or 1632, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1623;tt. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1631 or 1632, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1625;uu. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1461 or 1462, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1631 or 1632, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1629;vv. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1471 or 1472, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1634 or 1707, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1647;ww. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%,85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1705 or 1706, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,WSGR Docket No.53676-772.601 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1653 or 1654, and a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1660; xx. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 515 or 1661, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1675 or 1679, a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 516, and a fourth polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1660; yy. a first polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 506 or 1681, a second polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1695 or 1696, a third polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 507; and a fourth polypeptide chain having a sequence with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 100% sequence identity to SEQ ID NO: 1623.
99. The multifunctional molecule of any one of claims 1-98, wherein the multifunctional molecule is amultispecific molecule.
100. A polynucleotide comprising a sequence encoding the multifunctional molecule of any one ofclaims 1-99.
101. The polynucleotide of claim 100, wherein the polynucleotide is an isolated nucleic acid molecule.
102. A vector comprising one or more of the polynucleotide of claim 100 or 101.
103. A cell comprising the polynucleotide of claim 100 or 101, or the vector of claim 102.
104. A pharmaceutical composition comprising the multifunctional molecule of any one of claims 1-99,the polynucleotide of claim 100 or 101, the vector of claim 102, or the cell of claim 103, and a pharmaceutically acceptable carrier, excipient, or diluent.
105. A method of treating a condition or disease in a subject in need thereof comprising administering tothe subject a therapeutically effective amount of the multifunctional molecule of any one of claims 1-99, the polynucleotide of claim 100 or 101, the vector of claim 102, the cell of claim 103, the pharmaceutical composition of claim 104, or any combination thereof,WSGR Docket No.53676-772.601 wherein the administering is effective to treat the condition or disease in the subject.
106. The method of claim 105, wherein the condition or disease is cancer.
107. The method of claim 106, wherein the cancer is a solid tumor, a hematological cancer, a metastaticcancer, a soft tissue tumor, or any combination thereof.
108. The method of claim 105 or 106, wherein the cancer is the solid tumor selected from the groupconsisting of melanoma, pancreatic cancer, breast cancer, colorectal cancer, lung cancer, skin cancer, ovarian cancer, liver cancer, and any combination thereof.
109. The method of claim 105 or 106, wherein the cancer is the hematological cancer selected from thegroup consisting of Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma, acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome, multiple myeloma, T-cell lymphoma, acute lymphocytic leukemia, and any combination thereof.
110. The method of claim 109, wherein the Non-Hodgkin’s lymphoma is selected from the groupconsisting of B cell lymphoma, diffuse large B cell lymphoma (DLBCL), follicular lymphoma, chronic lymphocytic leukemia (B-CLL), mantle cell lymphoma, marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia, and any combination thereof.
111. The method of claim 110, wherein the T-cell lymphoma is peripheral T-cell lymphoma.
112. The method of any one of claims 106-111, wherein the cancer is characterized by a cancer antigenpresent on the cancer.
113. The method of claim 112, wherein the cancer antigen is a tumor antigen, a stromal antigen, or ahematological antigen.
114. The method of claim 112 or 113, wherein the cancer antigen is selected from the group consistingof CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRvIII), ganglioside G2 (GD2), ganglioside GD3, TNF receptor family member B cell maturation (BCMA), Tn antigen ((Tn Ag) or (GalNAcα-Ser / Thr)), prostate-specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, Receptor tyrosine-protein kinase ERBB2 (Her2 / neu), Mucin 1, cell surface associated (MUC1), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100 / pmel17), oncogene fusion protein consisting of breakpointWSGR Docket No.53676-772.601 cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GM1, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDN6), thyroid stimulating hormone receptor (TSHR), G protein-coupled receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, CD179a, anaplastic lymphoma kinase (ALK), Polysialic acid, placenta-specific 1 (PLAC1), hexasaccharide portion of globoH glycoceramide (GloboH), mammary gland differentiation antigen (NY-BR-1), uroplakin 2 (UPK2), Hepatitis A virus cellular receptor 1 (HAVCR1), adrenoceptor beta 3 (ADRB3), pannexin 3 (PANX3), G protein-coupled receptor 20 (GPR20), lymphocyte antigen 6 complex, locus K 9 (LY6K), Olfactory receptor 51E2 (OR51E2), TCR Gamma Alternate Reading Frame Protein (TARP), Wilms tumor protein (WT1), Cancer / testis antigen 1 (NY-ESO-1 / LAGE- 1), Cancer / testis antigen 2 (LAGE-1a), Melanoma-associated antigen 1 (MAGE-A1), ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML), sperm protein 17 (SPA17), X Antigen Family, Member 1A (XAGE1), angiopoietin-binding cell surface receptor 2 (Tie 2), melanoma cancer testis antigen-1 (MAD-CT-1), melanoma cancer testis antigen-2 (MAD- CT-2), Fos-related antigen 1, tumor protein p53 (p53), p53 mutant, prostein, Survivin, telomerase, prostate carcinoma tumor antigen-1, melanoma antigen recognized by T cells 1, Rat sarcoma (Ras) mutant, human Telomerase reverse transcriptase (hTERT), sarcoma translocation breakpoints, melanoma inhibitor of apoptosis (ML-IAP), ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene), N-Acetyl glucosaminyl-transferase V (NA17), paired box protein Pax-3 (PAX3), Androgen receptor, Cyclin B1, v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN), Ras Homolog Family Member C (RhoC), Tyrosinase- related protein 2 (TRP-2), Cytochrome P4501B1 (CYP1B1), CCCTC-Binding Factor (Zinc Finger Protein)-Like, Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3), Paired box protein Pax-5 (PAX5), proacrosin binding protein sp32 (OY-TES1), lymphocyte-specific protein tyrosine kinase (LCK), A kinase anchor protein 4 (AKAP-4), synovial sarcoma, X breakpoint 2 (SSX2), Receptor for Advanced Glycation Endproducts (RAGE-1), renal ubiquitous 1 (RU1), renal ubiquitous 2 (RU2), legumain, human papilloma virus E6 (HPV E6), human papilloma virus E7 (HPV E7), intestinal carboxyl esterase, heat shock protein 70-2 mutated (mut hsp70-2), CD79a, CD79b, CD72, Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), Fc fragment of IgA receptor (FCAR or CD89), Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2), CD300 molecule-like family member f (CD300LF), C-type lectin domain family 12 member A (CLEC12A), bone marrow stromal cell antigen 2 (BST2), EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2), lymphocyte antigen 75 (LY75), Glypican-3 (GPC3), Fc receptor-like 5 (FCRL5), FcRH5, PDL1, CD47, prostate specific membrane antigen (PMSA), prostate-specific antigen (PSA), Ron Kinase, c-Met, Immature laminin receptor, TAG-72, BING-4,WSGR Docket No.53676-772.601 Calcium-activated chloride channel 2, Cyclin-B1, 9D7, Ep-CAM, EphA3, SAP-1, PRAME, SSX- 2, Melan-A / MART-1, TRP1 / gp75, MC1R, β-catenin, BRCA1 / 2, CDK4, CML66, Fibronectin, Ras, TGF-Β receptor, AFP, ETA, MAGE, CA-125, BAGE, GAGE, CDC27, α actinin-4, gangliosides, MART-2, MUC2, MUM1, MUM2, MUM3, NA88-1, NPM, OA1, OGT, RCC, RU11, RU12, SAGE, TRG, TSTA, L1-CAM, gpA33, GM2, VEGFR, Integrins, carbohydrates, TRAILR1, TRAILR2, RANKL, TGF-beta, hyaluronic acid, collagen, tenascin C, tenascin W, and immunoglobulin lambda-like polypeptide 1 (IGLL1).
115. The method of claim 112 or 113, wherein the cancer antigen is Nectin-4.
116. The method of claim 106 or 107, wherein the cancer is a Nectin-4 associated cancer.
117. The method of any one of claims 106, 107, and 116, wherein the cancer comprises breast cancer,lung cancer, pancreatic cancer, head and neck cancer, bladder cancer, urothelial cancer, endometrial cancer, glioma, liver cancer, renal cancer, stomach cancer, testis cancer, thyroid cancer, ovarian cancer, gallbladder cancer, gastric cancer, esophageal cancer, hepatocellular cancer, epithelial cancer, or any combination thereof.
118. The method of any one of claims 106, 107, 116, and 117, wherein the cancer comprises gastriccancer, pancreatic cancer, ovarian cancer, or any combination thereof.
119. The method of claim 106 or 107, wherein the cancer comprises a solid cancer selected from thegroup consisting of colon cancer, breast cancer, renal cancer, melanoma, prostate cancer, lung cancer, rectal cancer, colorectal cancer, cervical cancer, and any combination thereof.
120. The method of any one of claims 106-119, wherein the cancer comprises an anti-PD1 therapyresistant cancer.
121. The method of claim 120, wherein the cancer comprises an anti-PD1 therapy resistant solid cancer.
122. The method of any one of claims 106-121, wherein the cancer comprises an HPV-positive cancer.
123. The method of claim 122, wherein the cancer comprises an HPV-positive solid cancer.
124. The method of any one of claims 106-123, wherein the cancer comprises a cancer with a hightumor mutation burden.
125. The method of any one of claims 105-124, further comprising administering a second therapeuticagent or therapy to the subject.
126. The method of claim 125, wherein the second therapeutic agent or therapy comprises achemotherapeutic agent, a biologic agent, a hormonal therapy, radiation, or surgery.
127. The method of claim 125 or 126, wherein the second therapeutic agent or therapy is administeredin combination with the multifunctional molecule of any one of claims 1-99, the polynucleotide of claim 100 or 101, the vector of claim 102, the cell of claim 103, and / or the pharmaceutical composition of claim 104, sequentially, simultaneously, or concurrently.
128. The method of any one of claims 105-127, wherein the multifunctional molecule of any one ofclaims 1-99, the polynucleotide of claim 100 or 101, the vector of claim 102, the cell of claim 103, and / or the pharmaceutical composition of claim 104 induces T cell mediated cytotoxicity of tumor cells.WSGR Docket No.53676-772.601129. The method of any one of claims 105-128, wherein the multifunctional molecule of any one ofclaims 1-99, the polynucleotide of claim 100 or 101, the vector of claim 102, the cell of claim 103, and / or the pharmaceutical composition of claim 104 induces T cell activation.
130. The method of any one of claims 105-129, wherein the multifunctional molecule of any one ofclaims 1-99, the polynucleotide of claim 100 or 101, the vector of claim 102, the cell of claim 103, and / or the pharmaceutical composition of claim 104 induces T cell proliferation.
131. A molecule comprising a TCRβV-binding moiety wherein the TCRβV-binding moiety comprises aheavy chain variable region (VH) comprising a heavy chain complementarity-determining region 1 (HC CDR1) sequence, a HC CDR2 sequence and a HC CDR3 sequence, wherein the HC CDR1, HC CDR2, HC CDR3 sequences have a sequence according to SEQ ID NOs: a. 1232, 1233 and 544, respectively;b. 1234, 543 and 544, respectively;c. 1235, 1236 and 1237, respectively; ord. 1238, 543 and 544, respectively;132. The molecule of claim 131, wherein the TCRβV-binding moiety comprises a light chain variableregion (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: a. 3655, 3653, and 8, respectively;b. 1075, 1076, and 8, respectively;c. 1218, 1219, and 8, respectively;d. 1220, 1221, and 8, respectively;e. 545, 546, and 547, respectively;f. 1239, 1240, and 547, respectively;g. 3655, 1467, and 8, respectively;h. 545, 546, and 1486, respectively; ori. 1239, 1240, and 1486, respectively.
133. A molecule comprising a TCRβV-binding moiety wherein the TCRβV-binding moiety comprises alight chain variable region (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: a. 1218, 1219, and 8, respectively;b. 1220, 1221, and 8, respectively;c. 3655, 1467, and 8, respectively;d. 545, 546, and 1486, respectively; ore. 1239, 1240, and 1486, respectively.
134. The molecule of claim 133, wherein the TCRβV-binding moiety comprises a heavy chain variableregion (VH) comprising a heavy chain complementarity-determining region 1 (HC CDR1)WSGR Docket No.53676-772.601 sequence, a HC CDR2 sequence and a HC CDR3 sequence, wherein the HC CDR1, HC CDR2, HC CDR3 sequences have a sequence according to SEQ ID NOs: a. 1069, 1070 and 5, respectively;b. 1071, 3651 and 5, respectively;c. 1072, 1073 and 1074, respectively;d. 3650, 3651 and 5, respectively;e. 1069, 1070 and 5, respectively;f. 1071, 3651 and 5, respectively;g. 1072, 1073 and 1074, respectively;h. 3650, 3651 and 5, respectively;i. 1232, 1233 and 544, respectively;j. 1234, 543 and 544, respectively;k. 1235, 1236 and 1237, respectively;l. 1238, 543 and 544, respectively;m. 1243, 1233 and 544, respectively;n. 1244, 543 and 544, respectively;o. 1245, 1236 and 1237, respectively;p. 542, 543 and 544, respectively;q. 1069, 1070 and 5, respectively;r. 1071, 3651 and 5, respectively;s. 3650, 3651 and 5, respectively;t. 1232, 1233 and 544, respectively;u. 1234, 543 and 544, respectively;v. 1235, 1236 and 1237, respectively; orw. 1238, 543 and 544, respectively.
135. A molecule comprising a TCRβV-binding moiety wherein the TCRβV-binding moiety comprises(A) a heavy chain variable region (VH) comprising a heavy chain complementarity-determining region 1 (HC CDR1) sequence, a HC CDR2 sequence and a HC CDR3 sequence, and (B) a light chain variable region (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: a. 1069, 1070, 5, 1218, 1219, and 8, respectively;b. 1071, 3651, 5, 1218, 1219, and 8, respectively;c. 1072, 1073, 1074, 1220, 1221, and 8, respectively;d. 3650, 3651, 5, 1218, 1219, and 8, respectively;e. 1232, 1233, 544, 545, 546, and 547, respectively;f. 1234, 543, 544, 545, 546, and 547, respectively;WSGR Docket No.53676-772.601 g. 1238, 543, 544, 545, 546, and 547, respectively;h. 1069, 1070, 5, 3655, 1467, and 8, respectively;i. 1071, 3651, 5, 3655, 1467, and 8, respectively;j. 3650, 3651, 5, 3655, 1467, and 8, respectively;k. 1232, 1233, 544, 545, 546, and 1486, respectively;l. 1234, 543, 544, 545, 546, and 1486, respectively;m. 1235, 1236, 1237, 1239, 1240, and 1486, respectively; orn. 1238, 543, 544, 545, 546, and 1486, respectively.
136. The molecule of any one of claims 131-134.a, wherein the TCRβV-binding moiety comprisesa. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1231 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 3527, 1485, 1466, 1217 or 1349. b. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1346, 1231, or 541, and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1217, c. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1346, 1231, or 541, and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1466, or d. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1346, 1231, or 541, and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1485.
137. The multifunctional molecule of any one of claims 131-136, wherein the TCRβV-binding moietycomprises: a. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1216, b. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1230,WSGR Docket No.53676-772.601 c. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1376, d. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1483, or e. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1701.
138. A composition comprising (i) a first agent that comprises a first TCRβV-binding moiety, a tumor-associated antigen binding moiety, and, optionally, a first molecule that binds to a first co- stimulatory receptor of a T cell; and (ii) a second agent that comprises a second TCRβV-binding moiety and a second molecule that binds to a second co-stimulatory receptor of a T cell.
139. A method of treating a condition or disease in a subject in need thereof comprising administering tothe subject (i) a first agent that comprises a first TCRβV-binding moiety, a tumor-associated antigen binding moiety, and, optionally, a first molecule that binds to a first co-stimulatory receptor of a T cell; and (ii) a second agent that comprises a second TCRβV-binding moiety and a second molecule that binds to a second co-stimulatory receptor of a T cell.
140. A combination therapy for treating a condition or disease in a subject in need thereof comprisingadministering to the subject (i) a first agent that comprises a first TCRβV-binding moiety, a tumor- associated antigen binding moiety, and, optionally, a first molecule that binds to a first co- stimulatory receptor of a T cell; and (ii) a second agent that comprises a second TCRβV-binding moiety and a second molecule that binds to a second co-stimulatory receptor of a T cell.
141. The composition of claim 138, the method of claim 139, or the combination therapy of claim 140,wherein the tumor-associated antigen binding moiety is conjugated to a drug, a therapeutic agent, a cancer agent, a chemotherapeutic agent, or a biologic agent.
142. The composition of claim 138, the method of claim 139, or the combination therapy of claim 140,wherein: (A) the first TCRβV-binding moiety binds to one or more of a TCRβV subfamily selected from the group consisting of TCRβ V2 subfamily, TCRβ V3 subfamily, TCRβ V4 subfamily, TCRβ V5 subfamily, TCRβ V6 subfamily, TCRβ V9 subfamily, TCRβ V10 subfamily, TCRβ V11 subfamily, TCRβ V12 subfamily, TCRβ V13 subfamily, TCRβ V16 subfamily, TCRβ V19, TCRβ V20 subfamily, TCRβ V21 subfamily, TCRβ V23 subfamily, TCRβ V27 subfamily, and TCRβ V28 subfamily; and / or (B) the second TCRβV-binding moiety binds to one or more of a TCRβV subfamily selected from the group consisting of TCRβ V2 subfamily, TCRβ V3 subfamily, TCRβ V4 subfamily, TCRβ V5 subfamily, TCRβ V6 subfamily, TCRβ V9 subfamily, TCRβ V10 subfamily, TCRβ V11 subfamily, TCRβ V12 subfamily, TCRβ V13 subfamily, TCRβ V16 subfamily, TCRβ V19, TCRβWSGR Docket No.53676-772.601 V20 subfamily, TCRβ V21 subfamily, TCRβ V23 subfamily, TCRβ V27 subfamily, and TCRβ V28 subfamily.
143. The composition, the method, or the combination therapy of any one of claims 138-142, wherein:(A) the first TCRβV-binding moiety binds to binds to one or more of a TCRβV subfamily selected from the group consisting of: (i) TCRβ V2 subfamily comprising TCRβ V2*01; (ii) TCRβ V3 subfamily comprising TCRβ V3-1*01; (iii) TCRβ V4 subfamily comprising one or more selected from TCRβ V4-1, TCRβ V4-2, and TCRβ V4-3; (iv) TCRβ V5 subfamily comprising one or more selected from TCRβ V5-6*01, TCRβ V5-4*01, TCRβ V5-1*01, and TCRβ V5-8*01; (v) TCRβ V6 subfamily comprising one or more selected from TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6- 2*01, TCRβ V6-3*01, and TCRβ V6-1*01; (vi) TCRβ V10 subfamily comprising one or more selected from TCRβ V10-1*01, TCRβ V10- 1*02, TCRβ V10-3*01, and TCRβ V10-2*01; (vii) TCRβ V11 subfamily comprising TCRβ V11-2; (viii) TCRβ V12 subfamily comprising one or more selected from TCRβ V12-4*01, TCRβ V12- 3*01, and TCRβ V12-5*01; (ix) TCRβ V13 subfamily comprising TCRβ V13*01; (x) TCRβ V16 subfamily comprising TCRβ V16*01; (xi) TCRβ V19 subfamily comprising one or more selected from TCRβ V19*01 and TCRβ V19*02; or (xii) TCRβ V20 subfamily comprising TCRβ V20-1*01, or TCRβ V20-1*02; and / or (B) the second TCRβV-binding moiety binds to binds to one or more of a TCRβV subfamily selected from the group consisting of: (i) TCRβ V2 subfamily comprising TCRβ V2*01; (ii) TCRβ V3 subfamily comprising TCRβ V3-1*01; (iii) TCRβ V4 subfamily comprising one or more selected from TCRβ V4-1, TCRβ V4-2, and TCRβ V4-3; (iv) TCRβ V5 subfamily comprising one or more selected from TCRβ V5-6*01, TCRβ V5-4*01, TCRβ V5-1*01, and TCRβ V5-8*01; (v) TCRβ V6 subfamily comprising one or more selected from TCRβ V6-4*01, TCRβ V6-4*02, TCRβ V6-9*01, TCRβ V6-8*01, TCRβ V6-5*01, TCRβ V6-6*02, TCRβ V6-6*01, TCRβ V6- 2*01, TCRβ V6-3*01, and TCRβ V6-1*01; (vi) TCRβ V10 subfamily comprising one or more selected from TCRβ V10-1*01, TCRβ V10- 1*02, TCRβ V10-3*01, and TCRβ V10-2*01; (vii) TCRβ V11 subfamily comprising TCRβ V11-2;WSGR Docket No.53676-772.601 (viii) TCRβ V12 subfamily comprising one or more selected from TCRβ V12-4*01, TCRβ V12- 3*01, and TCRβ V12-5*01; (ix) TCRβ V13 subfamily comprising TCRβ V13*01; (x) TCRβ V16 subfamily comprising TCRβ V16*01; (xi) TCRβ V19 subfamily comprising one or more selected from TCRβ V19*01 and TCRβ V19*02; or (xii) TCRβ V20 subfamily comprising TCRβ V20-1*01, or TCRβ V20-1*02.
144. The composition, the method, or the combination therapy of any one of claims 138-143, wherein:(A) the first TCRβV-binding moiety binds to TCRβ V6 subfamily, TCRβV10 subfamily, TCRβV12 subfamily, or TCRβ V20 subfamily; and / or (B) the second TCRβV-binding moiety binds to TCRβ V6 subfamily, TCRβV10 subfamily, TCRβV12 subfamily, or TCRβ V20 subfamily.
145. The composition, the method, or the combination therapy of any one of claims 138-144, whereinthe first TCRβV-binding moiety and the second TCRβV-binding moiety bind to a same TCRβV subfamily.
146. The composition, the method, or the combination therapy of any one of claims 138-145, whereinthe first TCRβV-binding moiety and the second TCRβV-binding moiety are the same.
147. The composition, the method, or the combination therapy of any one of claims 138-144, whereinthe first TCRβV-binding moiety and the second TCRβV-binding moiety binds to binds to different TCRβV subfamilies.
148. The composition, the method, or the combination therapy of any one of claims 138-145 and 146,wherein the first TCRβV-binding moiety and the second TCRβV-binding moiety are the same.
149. The composition, the method, or the combination therapy of any one of claims 138-148, whereinthe first TCRβV-binding moiety comprises an antibody domain or an antigen binding domain, and / or the second TCRβV-binding moiety comprises an antibody domain or an antigen binding domain.
150. The composition, the method, or the combination therapy of any one of claims 138-149, whereinthe tumor-associated antigen binding moiety comprises an antibody domain or an antigen binding domain.
151. The composition, the method, or the combination therapy of claim 150, wherein the antigenbinding domain comprises any one selected from the group consisting of a Fab, a F(ab')2, an Fv, a single chain Fv (scFv), a single domain antibody, a diabody (dAb), a VHH, a camelid antibody, and any combination thereof.
152. The composition, the method, or the combination therapy of any one of claims 138-151, whereinthe first TCRβV-binding moiety is covalently linked to the tumor-associated antigen binding moiety.WSGR Docket No.53676-772.601153. The composition, the method, or the combination therapy of any one of claims 138-152, whereinthe tumor-associated antigen binding moiety is covalently linked to the first molecule that binds to the first co-stimulatory receptor of a T cell.
154. The composition, the method, or the combination therapy of any one of claims 138-153, whereinthe second TCRβV-binding moiety is covalently linked to the second molecule that binds to the second co-stimulatory receptor of a T cell.
155. The composition, the method, or the combination therapy of any one of claims 138-154, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell activates the first co- stimulatory receptor when the first molecule that binds to the first co-stimulatory receptor of a T cell binds to the first co-stimulatory receptor.
156. The composition, the method, or the combination therapy of any one of claims 138-155, whereinthe second molecule that binds to the second co-stimulatory receptor of a T cell activates the second co-stimulatory receptor when the second molecule that binds to the second co-stimulatory receptor of a T cell binds to the second co-stimulatory receptor.
157. The composition, the method, or the combination therapy of any one of claims 138-156, whereinthe first co-stimulatory receptor of a T cell and the second co-stimulatory receptor of a T cell are a same co-stimulatory receptor of a T cell.
158. The composition, the method, or the combination therapy of any one of claims 138-156, whereinthe first co-stimulatory receptor of a T cell and the second co-stimulatory receptor of a T cell are different co-stimulatory receptors of a T cell.
159. The composition, the method, or the combination therapy of any one of claims 138-158, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprise at least one cytokine molecule or a functional fragment or functional variant thereof.
160. The composition, the method, or the combination therapy of any one of claims 138-158, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprise an antibody molecule, an antigen binding domain, a ligand, an extracellular domain of a receptor, or any combination thereof.
161. The composition, the method, or the combination therapy of claim 160, wherein the antigenbinding domain comprises any one selected from the group consisting of a Fab, a F(ab')2, an Fv, a single chain Fv (scFv), a single domain antibody, a diabody (dAb), a VHH, a camelid antibody, and any combination thereof.
162. The composition, the method, or the combination therapy of any one of claims 138-161, whereinthe first agent comprises a first polypeptide chain of the first agent comprising a first portion of a first dimerization module, and a second polypeptide chain of the first agent comprising a second portion of the first dimerization module;WSGR Docket No.53676-772.601 wherein the first polypeptide chain of the first agent and the second polypeptide chain of the first agent are non-contiguous, and wherein the tumor-associated antigen binding moiety is linked to the first portion of the first dimerization module, and the first TCRβV-binding moiety and / or the first molecule that binds to the first co-stimulatory receptor of a T cell are independently linked to the first portion of the first dimerization module, the second portion of the first dimerization module, or a combination thereof.
163. The composition, the method, or the combination therapy of claim 162, wherein:(i) the tumor-associated antigen binding moiety is linked to the N-terminus of the first portion of the first dimerization module, and the first TCRβV-binding moiety is linked to the C-terminus of the first portion of the first dimerization module, the N-terminus of the second portion of the first dimerization module, the C-terminus of the second portion of the first dimerization module, or any combination thereof; or (ii) the tumor-associated antigen binding moiety is linked to the C-terminus of the first portion of the first dimerization module, and the first molecule that binds to the first co-stimulatory receptor of a T cell is linked to the N-terminus of the first portion of the first dimerization module, the N- terminus of the second portion of the first dimerization module, the C-terminus of the second portion of the first dimerization module, or any combination thereof.
164. The composition, the method, or the combination therapy of claim 162 or 163, wherein:(i) the tumor-associated antigen binding moiety is linked to the N-terminus of the first portion of the first dimerization module, and the first molecule that binds to the first co-stimulatory receptor of a T cell is linked to the C-terminus of the first portion of the first dimerization module, the N- terminus of the second portion of the first dimerization module, the C-terminus of the second portion of the first dimerization module, or any combination thereof; or (ii) the tumor-associated antigen binding moiety is linked to the C-terminus of the first portion of the first dimerization module, and the first molecule that binds to the first co-stimulatory receptor of a T cell is linked to the N-terminus of the first portion of the first dimerization module, the N- terminus of the second portion of the first dimerization module, the C-terminus of the second portion of the first dimerization module, or any combination thereof.
165. The composition, the method, or the combination therapy of any one of claims 162-164, wherein:(i) the tumor-associated antigen binding moiety is linked to the N-terminus of the first portion of the first dimerization module, and the first TCRβV-binding moiety is linked to the first molecule that binds to the first co-stimulatory receptor of a T cell that is linked to the N-terminus of the second portion of the first dimerization module; or (ii) the tumor-associated antigen binding moiety is linked to the N-terminus of the first portion of the first dimerization module, and the first TCRβV-binding moiety is linked to the tumor- associated antigen binding moiety.
166. The composition, the method, or the combination therapy of any one of claims 162-165, whereinthe first polypeptide chain of the first agent comprises a first portion of the tumor-associatedWSGR Docket No.53676-772.601 antigen binding moiety and the first agent further comprises a third polypeptide chain of the first agent comprising a second portion of the tumor-associated antigen binding moiety, wherein the first polypeptide chain of the first agent, the second polypeptide chain of the first agent, and the third polypeptide chain of the first agent are non-contiguous.
167. The composition, the method, or the combination therapy of claim 166, wherein the first portion ofthe tumor-associated antigen binding moiety comprises a heavy chain variable domain (VH) of the tumor-associated antigen binding moiety and the second portion of the tumor-associated antigen binding moiety comprises a light chain variable domain (VL) of the tumor-associated antigen binding moiety, or the first portion of the tumor-associated antigen binding moiety comprises a VL of the tumor-associated antigen binding moiety and the second portion of the tumor-associated antigen binding moiety comprises a VH of the tumor-associated antigen binding moiety.
168. The composition, the method, or the combination therapy of any one of claims 162-167, whereinthe first TCRβV-binding moiety comprises a first portion of the first TCRβV-binding moiety and the first agent further comprises a fourth polypeptide chain of the first agent comprising a second portion of the first TCRβV-binding moiety, wherein the first polypeptide chain of the first agent, the second polypeptide chain of the first agent, and the fourth polypeptide chain of the first agent, and / or the third polypeptide chain of the first agent are non-contiguous.
169. The composition, the method, or the combination therapy of claim 168, wherein the first portion ofthe first TCRβV-binding moiety comprises a heavy chain variable domain (VH) of the first TCRβV-binding moiety and the second portion of the first TCRβV-binding moiety comprises a light chain variable domain (VL) of the first TCRβV-binding moiety, or the first portion of the first TCRβV-binding moiety comprises a VL of the first TCRβV-binding moiety and the second portion of the first TCRβV-binding moiety comprises a VH of the first TCRβV-binding moiety.
170. The composition, the method, or the combination therapy of any one of claims 138-169, whereinthe second agent comprises a first polypeptide chain of the second agent comprising a first portion of a second dimerization module, and a second polypeptide chain of the second agent comprising a second portion of the second dimerization module; wherein the first polypeptide chain of the second agent and the second polypeptide chain of the second agent are non-contiguous, and wherein the second TCRβV-binding moiety is linked to the first portion of the second dimerization module and the second molecule that binds to the second co-stimulatory receptor of a T cell is linked to the first portion of the second dimerization module, the second portion of the second dimerization module, or a combination thereof.
171. The composition, the method, or the combination therapy of claim 170, wherein the secondTCRβV-binding moiety is linked to the N-terminus of the first portion of the second dimerization module or the C-terminus of the first portion of the second dimerization module, and the second molecule that binds to the second co-stimulatory receptor of a T cell is linked to the N-terminus of the first portion of the second dimerization module, the C-terminus of the first portion of theWSGR Docket No.53676-772.601 second dimerization module, the N-terminus of the second portion of the second dimerization module, the C-terminus of the second portion of the second dimerization module, or any combination thereof.
172. The composition, the method, or the combination therapy of claim 170 or 171, wherein the secondTCRβV-binding moiety comprises a first portion of the second TCRβV-binding moiety and the second agent further comprises a fourth polypeptide chain of the second agent comprising a second portion of the second TCRβV-binding moiety, wherein the first polypeptide chain of the second agent, the second polypeptide chain of the second agent, and the third polypeptide chain of the second agent are non-contiguous.
173. The composition, the method, or the combination therapy of claim 172, wherein the first portion ofthe second TCRβV-binding moiety comprises a heavy chain variable domain (VH) of the second TCRβV-binding moiety and the second portion of the second TCRβV-binding moiety comprises a light chain variable domain (VL)of the second TCRβV-binding moiety, or the first portion of the second TCRβV-binding moiety comprises a VL of the second TCRβV-binding moiety and the second portion of the second TCRβV-binding moiety comprises a VH of the second TCRβV- binding moiety.
174. The composition, the method, or the combination therapy of any one of claims 138-173, whereinthe first agent comprises two or more tumor-associated antigen binding moiety, two or more first TCRβV-binding moieties, and / or two or more first molecules that binds to the first co-stimulatory receptor of a T cell.
175. The composition, the method, or the combination therapy of claim 174, wherein the two or moretumor-associated antigen binding moiety are tandemly connected.
176. The composition, the method, or the combination therapy of claim 174 or 175, wherein the two ormore first TCRβV-binding moieties are tandemly connected.
177. The composition, the method, or the combination therapy of any one of claims 138-176, whereinthe second agent comprises two or more second TCRβV-binding moieties and / or two or more second molecules that binds to the second co-stimulatory receptor of a T cell.
178. The composition, the method, or the combination therapy of claim 177, wherein the two or moretumor-associated antigen binding moiety are tandemly connected.
179. The composition, the method, or the combination therapy of any one of claims 162-178, whereinthe first TCRβV-binding moiety and the first molecule that binds to the first co-stimulatory receptor of a T cell is within a single contiguous polypeptide chain of the first polypeptide chain of the first agent or the second polypeptide chain of the first agent.
180. The composition, the method, or the combination therapy of any one of claims 170-178, whereinthe second TCRβV-binding moiety and the second molecule that binds to the second co- stimulatory receptor of a T cell is within a single contiguous polypeptide chain of the first polypeptide chain of the second agent or the second polypeptide chain of the second agent.WSGR Docket No.53676-772.601181. The composition, the method, or the combination therapy of any one of claims 138-180, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), or a single domain antibody.
182. The composition, the method, or the combination therapy of any one of claims 138-181, whereinthe tumor-associated antigen binding moiety comprises a VH and a VL, or a single domain antibody.
183. The composition, the method, or the combination therapy of any one of claims 162-182, whereinthe first portion of the first dimerization module and the second portion of the first dimerization module are dimerized, and / or the first portion of the second dimerization module and the second portion of the second dimerization module are dimerized.
184. The composition, the method, or the combination therapy of any one of claims 138-183, wherein:(i) the tumor-associated antigen binding moiety further comprises a heavy chain constant domain 1 (CH1) linked to the VH of the tumor-associated antigen binding moiety; (ii) the first TCRβV-binding moiety further comprises a heavy chain constant domain 1 (CH1) linked to the VH of the first TCRβV-binding moiety; (iii) the second TCRβV-binding moiety further comprises a heavy chain constant domain 1 (CH1) linked to the VH of the second TCRβV-binding moiety; or (iv) any combination thereof.
185. The composition, the method, or the combination therapy of any one of claims 138-184, whereinthe CH1 comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the CH1 sequences selected from the CH1 sequences listed herein or listed in Table 3, 28, or 29.
186. The composition, the method, or the combination therapy of any one of claims 138-185, whereinthe CH1 comprises any one of the CH1 sequences selected from the CH1 sequences listed herein or listed in Table 3, 28, or 29.
187. The composition, the method, or the combination therapy of any one of claims 138-186, wherein:(i) the tumor-associated antigen binding moiety further comprises a light chain constant domain (CL) linked to the VL of the tumor-associated antigen binding moiety; (ii) the first TCRβV-binding moiety further comprises a light chain constant domain (CL) linked to the VL of the first TCRβV-binding moiety; (iii) the first TCRβV-binding moiety further comprises a light chain constant domain (CL) linked to the VL of the first TCRβV-binding moiety; or (iv) any combination thereof.
188. The composition, the method, or the combination therapy of claim 187, wherein:(i) the CL linked to the VL of the tumor-associated antigen binding moiety comprises a kappa chain constant domain or a lambda chain constant domain;WSGR Docket No.53676-772.601 (ii) the CL linked to the VL of the first TCRβV-binding moiety comprises a kappa chain constant domain or a lambda chain constant domain; (iii) the CL linked to the VL of the second TCRβV-binding moiety comprises a kappa chain constant domain or a lambda chain constant domain; or (iv) a combination thereof.
189. The composition, the method, or the combination therapy of any one of claims 186-188, whereinthe CL comprises any one of the light chain constant region sequences listed in Table 3, 28, 29.
190. The composition, the method, or the combination therapy of any one of claims 138-189, whereinthe first agent further comprises one or more linkers as described herein.
191. The composition, the method, or the combination therapy of any one of claims 138-190, whereinthe first agent further comprises: (i) a linker between the first portion of the first dimerization module and the tumor-associated antigen binding moiety or the first portion of the tumor-associated antigen; (ii) a linker between the first molecule that binds to the first co-stimulatory receptor of a T cell and the first portion of the first dimerization module, a linker between the first molecule that binds to the first co-stimulatory receptor of a T cell and the second portion of the first dimerization module, or a combination thereof; (iii) a linker between the first molecule that binds to the first co-stimulatory receptor of a T cell and the first TCRβV-binding moiety or the first portion of the first TCRβV-binding moiety; (iv) a linker between the VH and the VL of the tumor-associated antigen binding moiety; (v) a linker between the VH and the VL of the first TCRβV-binding moiety; (vi) a linker between the CH1 and the VH of the tumor-associated antigen binding moiety (vii) a linker between the CH1 and the VH of the first TCRβV-binding moiety; (viii) a linker between the CL and the VL of the tumor-associated antigen binding moiety; (ix) a linker between the CL and the VL of the TCRβV-binding moiety; (x) a linker between the tumor-associated antigen binding moiety and the first TCRβV-binding moiety; or (xi) any combination thereof.
192. The composition, the method, or the combination therapy of any one of claims 138-191, whereinthe first agent further comprises one or more linkers as described herein.
193. The composition, the method, or the combination therapy of any one of claims 138-192, whereinthe second agent further comprises: (i) a linker between the second molecule that binds to the second co-stimulatory receptor of a T cell and the first portion of the second dimerization module, a linker between the second molecule that binds to the second co-stimulatory receptor of a T cell and the second portion of the second dimerization module, or a combination thereof;WSGR Docket No.53676-772.601 (ii) a linker between the second molecule that binds to the second co-stimulatory receptor of a T cell and the second TCRβV-binding moiety or the first portion of the second TCRβV-binding moiety; (iii) a linker between the VH and the VL of the second TCRβV-binding moiety; (iv) a linker between the CH1 and the VH of the second TCRβV-binding moiety; (v) a linker between the CL and the VL of the second TCRβV-binding moiety; or (xi) any combination thereof.
194. The composition, the method, or the combination therapy of any one of claims 190-193, whereinthe linker is any one of the linkers as described herein.
195. The composition, the method, or the combination therapy of any one of claims 190-194, whereinthe linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, and a non-helical linker.
196. The composition, the method, or the combination therapy of any one of any one of claims 138-195,wherein the multifunctional molecule is an isolated multifunctional molecule .
197. The composition, the method, or the combination therapy of any one of any one of claims 138-196,wherein the tumor-associated antigen binding moiety, the first TCRβV-binding moiety, the second TCRβV-binding moiety, or a combination thereof comprises a VHH, an Fab, or an scFv.
198. The composition, the method, or the combination therapy of any one of claims 138-197, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof is selected from the group consisting of interleukin-2 (IL-2) or a functional fragment or functional variant thereof, interleukin- 7 (IL-7) or a functional fragment or functional variant thereof, interleukin-12 (IL-12) or a functional fragment or functional variant thereof, interleukin-15 (IL-15) or a functional fragment or functional variant thereof, interleukin-18 (IL-18) or a functional fragment or functional variant thereof, interleukin-21 (IL-21) or a functional fragment or functional variant thereof, or interferon gamma or a functional fragment or functional variant thereof, or any combination thereof.
199. The composition, the method, or the combination therapy of any one of claims 138-198, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises interleukin-2 (IL-2) or a functional fragment or functional variant thereof.
200. The composition, the method, or the combination therapy of claim 199, wherein the at least onecytokine molecule or a functional fragment or functional variant thereof is an IL-2 variant comprising a substitution mutation.WSGR Docket No.53676-772.601201. The composition, the method, or the combination therapy of claim 200, wherein the at least onecytokine molecule or a functional fragment or functional variant thereof is an IL-2 variant comprising C125A mutation.
202. The composition, the method, or the combination therapy of any one of claims 198-201, whereinthe at least one cytokine molecule or a functional fragment or functional variant thereof comprises a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the sequence of SEQ ID NO: 2270 or the sequence of SEQ ID NO: 2191.
203. The composition, the method, or the combination therapy of any one of claims 198-202, whereinthe at least one cytokine molecule or a functional fragment or functional variant thereof comprises the sequence of SEQ ID NO: 2270 or the sequence of SEQ ID NO: 2191.
204. The composition, the method, or the combination therapy of any one of claims 198-203, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises a sequence having at least 75%,80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the cytokine sequences as described herein or any one of the cytokine sequences as listed in Table 28 or 29.
205. The composition, the method, or the combination therapy of any one of claims 198-204 whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises any one of the cytokine sequences as described herein or any one of the cytokine sequences as listed in Table 28 or 29.
206. The composition, the method, or the combination therapy of any one of claims 198-205, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least one cytokine molecule or a functional fragment or functional variant thereof comprises a sequence having at least 75%,80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the cytokine sequences as described herein or any one of the cytokine sequences as listed in Table 28 or 29.
207. The composition, the method, or the combination therapy of any one of claims 198-206, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell comprises at least one cytokine molecule or a functional fragment or functional variant thereof, and the at least oneWSGR Docket No.53676-772.601 cytokine molecule or a functional fragment or functional variant thereof comprises any one of the cytokine sequences as described herein or any one of the cytokine sequences as listed in Table 28 or 29.
208. The composition, the method, or the combination therapy of any one of claims 138-197, whereinthe first molecule that binds to the first co-stimulatory receptor of a T cell and / or the second molecule that binds to the second co-stimulatory receptor of a T cell binds to CD2, 4-1BB, CD27, CD28, or any combination thereof.
209. The composition, the method, or the combination therapy of any one of claims 138-208, whereinthe first portion of the first dimerization module comprises a first immunoglobulin constant regions (Fc regions) of the first dimerization module and the second portion of the dimerization module comprises a second Fc region of the first dimerization module.
210. The composition, the method, or the combination therapy of any one of claims 138-209, whereinthe first portion of the second dimerization module comprises a first immunoglobulin constant regions (Fc regions) of the second dimerization module and the second portion of the second dimerization module comprises a second Fc region of the second dimerization module.
211. The composition, the method, or the combination therapy of claim 209 or 210, wherein the first Fcregion of the first dimerization module, the second Fc region of the first dimerization module, the first Fc region of the second dimerization module, the second Fc region of the second dimerization module, or any combination thereof is selected from the group consisting of an IgG1 Fc region or a fragment thereof, an IgG2 Fc region or a fragment thereof, an IgG3 Fc region or a fragment thereof, an IgGA1 Fc region or a fragment thereof, an IgGA2 Fc region or a fragment thereof, an IgG4 Fc region or a fragment thereof, an IgJ Fc region or a fragment thereof, an IgM Fc region or a fragment thereof, an IgD Fc region or a fragment thereof, and an IgE Fc region or a fragment thereof.
212. The composition, the method, or the combination therapy of claim 211, wherein the first Fc regionof the first dimerization module, the second Fc region of the first dimerization module, the first Fc region of the second dimerization module, the second Fc region of the second dimerization module, or any combination thereof is selected from the group consisting of a human IgG1 Fc region or a fragment thereof, a human IgG2 Fc region or a fragment thereof, and a human IgG4 Fc region or a fragment thereof.
213. The composition, the method, or the combination therapy of any one of claims 209-212, whereinthe first Fc region of the first dimerization module, the second Fc region of the first dimerization module, or a combination thereof comprises an Fc interface with one or more of: a paired cavity- protuberance, an electrostatic interaction, or a strand-exchange, wherein the dimerization of the first Fc region and the second Fc region is enhanced as indicated by a greater ratio of heteromultimer:homomultimer forms relative to a dimerization of Fc regions with a non- engineered interface.WSGR Docket No.53676-772.601214. The composition, the method, or the combination therapy of any one of claims 209-213, whereinthe first Fc region of the second dimerization module, the second Fc region of the second dimerization module, or a combination thereof comprises an Fc interface with one or more of: a paired cavity-protuberance, an electrostatic interaction, or a strand-exchange, wherein the dimerization of the first Fc region and the second Fc region is enhanced as indicated by a greater ratio of heteromultimer:homomultimer forms relative to a dimerization of Fc regions with a non- engineered interface.
215. The composition, the method, or the combination therapy of any one of claims 209-214, whereinthe first Fc region of the first dimerization module, the second Fc region of the first dimerization module, the first Fc region of the second dimerization module, the second Fc region of the second dimerization module, or any combination thereof comprises an amino acid substitution listed in Table 14.
216. The composition, the method, or the combination therapy of any one of claims 209-215, whereinthe first Fc region, the second Fc region, or a combination thereof comprises an Asn297Ala (N297A) mutation or a Leu234Ala / Leu235Ala (LALA) mutation.
217. The composition, the method, or the combination therapy of any one of claims 209-216, whereinthe first Fc region of the first dimerization module, the second Fc region of the first dimerization module, the first Fc region of the second dimerization module, the second Fc region of the second dimerization module, or any combination thereof comprises a sequence having at least 75%,80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the Fc region or heavy chain constant region sequence selected from the Fc region or heavy chain constant region sequences described herein or listed in Table 3, 28, or 29.
218. The composition, the method, or the combination therapy of claim 217, wherein the first Fc regionof the first dimerization module, the second Fc region of the first dimerization module, the first Fc region of the second dimerization module, the second Fc region of the second dimerization module, or any combination thereof comprises any one of the Fc region or heavy chain constant region sequence selected from the Fc region or heavy chain constant region sequences described herein or listed in Table 3, 28, or 29.
219. The composition, the method, or the combination therapy of any one of claims 138-218, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises: (i) a VH comprising a combination of a HC CDR1, a HC CDR2 and a HC CDR3 listed in Table 1. 2, 12, 13, 27, 28, or 29; (ii) a VL comprising a combination of a LC CDR1, a LC CDR2, and a LC CDR3 listed in Table 1. 2, 12, 13, 27, 28, or 29; or (iii) any combination thereof.
220. The composition, the method, or the combination therapy of any one of claims 138-219, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises:WSGR Docket No.53676-772.601 (i) a VH comprising a HC CDR1, a HC CDR2 and a HC CDR3 of any one of the heavy chain variable domain amino acid sequences listed in Table 1.2, 12, 13, 27, 28, or 29; (ii) a VL comprising a LC CDR1, a LC CDR2, and a LC CDR3 of any one of the light chain variable domain amino acid sequences listed in Table 1.2, 12, 13, 27, 28, or 29; or (iii) any combination thereof.
221. The composition, the method, or the combination therapy of any one of claims 138-220, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises: (i) a VH comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the heavy chain variable domain amino acid sequences listed in Table 1.2, 12, 13, 27, 28, or 29; (ii) a VL comprising a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the light chain variable domain amino acid sequences listed in Table 1.2, 12, 13, 27, 28, or 29; (iii) a combination thereof.
222. The composition, the method, or the combination therapy of any one of claims 138-221, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises: (i) a VH comprising any one of the heavy chain variable domain amino acid sequences listed in Tables 11.2, 12, 13, 27, 28, or 29; (ii) a VL comprising any one of the light chain variable domain amino acid sequences listed in Tables 1.2, 12, 13, 27, 28, or 29; (iii) a combination thereof.
223. The composition, the method, or the combination therapy of any one of claims 138-222, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises (A) a heavy chain variable region (VH) comprising a heavy chain complementarity-determining region 1 (HC CDR1) sequence, a HC CDR2 sequence and a HC CDR3 sequence, and (B) a light chain variable region (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the HC CDR1, HC CDR2, HC 1075CDR3, LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: a. 1069, 1070, 5, 3655, 3653, and 8, respectively;b. 1071, 3651, 5, 3655, 3653, and 8, respectively;c. 1072, 1073, 1074, 1075, 1076, and 8, respectively;d. 3650, 3651, 5, 3655, 3653, and 8, respectively;e. 1069, 1070, 5, 1218, 1219, and 8, respectively;f. 1071, 3651, 5, 1218, 1219, and 8, respectively;g. 1072, 1073, 1074, 1220, 1221, and 8, respectively;WSGR Docket No.53676-772.601 h. 3650, 3651, 5, 1218, 1219, and 8, respectively;i. 1232, 1233, 544, 545, 546, and 547, respectively;j. 1234, 543, 544, 545, 546, and 547, respectively;k. 1235, 1236, 1237, 1239, 1240, and 547, respectively;l. 1238, 543, 544, 545, 546, and 547, respectively;m. 1243, 1233, 544, 545, 546, and 547, respectively;n. 1244, 543, 544, 545, 546, and 547, respectively;o. 1245, 1236, 1237, 1239, 1240, and 547, respectively;p. 542, 543, 544, 545, 546, and 547, respectively;q. 1069, 1070, 5, 3655, 1467, and 8, respectively;r. 1071, 3651, 5, 3655, 1467, and 8, respectively;s. 1072, 1073, 1074, 1220, 1221, and 8, respectively;t. 3650, 3651, 5, 3655, 1467, and 8, respectively;u. 1232, 1233, 544, 545, 546, and 1486, respectively;v. 1234, 543, 544, 545, 546, and 1486, respectively;w. 1235, 1236, 1237, 1239, 1240, and 1486, respectively; orx. 1238, 543, 544, 545, 546, and 1486, respectively.
224. The composition, the method, or the combination therapy of any one of claims 138-223, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises a. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1346 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1349, b. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1346 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1217, c. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1231 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 3527, d. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 541 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%,WSGR Docket No.53676-772.601 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 3527, e. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1231 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1485, or f. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1346 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1466.
225. The composition, the method, or the combination therapy of any one of claims 138-223.a, whereinthe first TCRβV-binding moiety and / or the second TCRβV-binding moiety comprises a. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1331, b. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1216, c. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1230, d. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1376, e. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1483, or f. an scFv having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1701.
226. The composition, the method, or the combination therapy of any one of claims 138-224.a, whereinthe tumor-associated antigen is Nectin-4.
227. The composition, the method, or the combination therapy of claim 225.a, wherein the tumor-associated antigen binding moiety comprises a Nectin-4 binding moiety.
228. The composition, the method, or the combination therapy of claim 227, wherein the Nectin-4binding moiety comprises an antibody domain or an antigen binding domain.WSGR Docket No.53676-772.601229. The composition, the method, or the combination therapy of claim 228, wherein the antigenbinding domain comprises any one selected from the group consisting of a Fab, a F(ab')2, an Fv, a single chain Fv (scFv), a single domain antibody, a diabody (dAb), a VHH, a camelid antibody, and any combination thereof.
230. The composition, the method, or the combination therapy of any one of claims 228 or 229, whereinthe Nectin-4 binding moiety comprises (A) a heavy chain variable region (VH) comprising a heavy chain complementarity-determining region 1 (HC CDR1) sequence, a HC CDR2 sequence and a HC CDR3 sequence, and (B) a light chain variable region (VL) comprising a light chain complementarity-determining region 1 (LC CDR1) sequence, a LC CDR2 sequence and a LC CDR3 sequence; wherein the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2 and LC CDR3 sequences have a sequence according to SEQ ID NOs: (lllll) 3905, 3906, 3904, 3911, 3912, and 3913, respectively;(mmmmm) 3902, 3903, 3904, 3911, 3912, and 3913, respectively;(nnnnn) 3907, 3908, 3909, 3914, 3915, and 3913, respectively;(ooooo) 1002, 3903, 3904, 3911, 3912, and 3913, respectively;(ppppp) 1207, 1208, 1209, 3911, 4002, and 3913, respectively;(qqqqq) 1210, 1211, 1209, 3911, 4002, and 3913, respectively;(rrrrr) 1212, 1213, 1214, 3914, 4003, and 3913, respectively;(sssss) 1215, 1211, 1209, 3911, 4002, and 3913, respectively;(ttttt) 4005, 4006, 1209, 3911, 4002, and 3913, respectively;(uuuuu) 1222, 1223, 1209, 3911, 4002, and 3913, respectively;(vvvvv) 1224, 1225, 1226, 3914, 4003, and 3913, respectively;(wwwww) 1227, 1223, 1209, 3911, 4002, and 3913, respectively;(xxxxx) 1229, 4007, 4008, 3911, 4002, and 3913, respectively;(yyyyy) 3902, 4009, 4008, 3911, 4002, and 3913, respectively;(zzzzz) 4010, 4011, 4012, 3914, 4003, and 3913, respectively;(aaaaaa) 4013, 4009, 4008, 3911, 4002, and 3913, respectively;(bbbbbb) 4005, 4006, 1209, 3911, 4015, and 3913, respectively;(cccccc) 1222, 1223, 1209, 3911, 4015, and 3913, respectively;(dddddd) 1224, 1225, 1226, 3914, 3915, and 3913, respectively;(eeeeee) 1227, 1223, 1209, 3911, 4015, and 3913, respectively;(ffffff) 1229, 4007, 4008, 3911, 4015, and 3913, respectively;(gggggg) 3902, 4009, 4008, 3911, 4015, and 3913, respectively;(hhhhhh) 4010, 4011, 4012, 3914, 3915, and 3913, respectively;(iiiiii) 4013, 4009, 4008, 3911, 4015, and 3913, respectively;(jjjjjj) 4017, 1241, 1209, 3911, 4002, and 3913, respectively;(kkkkkk) 1242, 4018, 1209, 3911, 4002, and 3913, respectively;4019, 4020, 1214, 3914, 4003, and 3913, respectively;WSGR Docket No.53676-772.601(mmmmmm) 1246, 4018, 1209, 3911, 4002, and 3913, respectively;(nnnnnn) 4005, 4006, 1209, 3911, 1248, and 3913, respectively;(oooooo) 1222, 1223, 1209, 3911, 1248, and 3913, respectively;(pppppp) 1224, 1225, 1226, 3914, 1249, and 3913, respectively;(qqqqqq) 1227, 1223, 1209, 3911, 1248, and 3913, respectively;(rrrrrr) 1250, 1251, 1252, 3911, 4002, and 3913, respectively;(ssssss) 1253, 1254, 1252, 3911, 4002, and 3913, respectively;(tttttt) 1255, 1256, 1257, 3914, 4003, and 3913, respectively;(uuuuuu) 1258, 1254, 1252, 3911, 4002, and 3913, respectively;(vvvvvv) 4005, 4006, 1209, 3911, 1260, and 3913, respectively;(wwwwww) 1222, 1223, 1209, 3911, 1260, and 3913, respectively;(xxxxxx) 1224, 1225, 1226, 3914, 1261, and 3913, respectively;(yyyyyy) 1227, 1223, 1209, 3911, 1260, and 3913, respectively;(zzzzzz) 1263, 1264, 3904, 3911, 4002, and 3913, respectively;(aaaaaaa) 1265, 1266, 3904, 3911, 4002, and 3913, respectively;(bbbbbbb) 1267, 1268, 3909, 3914, 4003, and 3913, respectively;(ccccccc) 1269, 1266, 3904, 3911, 4002, and 3913, respectively;(ddddddd) 1271, 1272, 3904, 3911, 4002, and 3913, respectively;(eeeeeee) 1273, 1274, 3904, 3911, 4002, and 3913, respectively;(fffffff) 1275, 1276, 3909, 3914, 4003, and 3913, respectively;(ggggggg) 1277, 1274, 3904, 3911, 4002, and 3913, respectively;(hhhhhhh) 1279, 1280, 1209, 3911, 4002, and 3913, respectively;(iiiiiii) 1210, 1281, 1209, 3911, 4002, and 3913, respectively;(jjjjjjj) 1282, 1283, 1214, 3914, 4003, and 3913, respectively;(kkkkkkk) 1284, 1281, 1209, 3911, 4002, and 3913, respectively;1400, 1401, 1209, 3911, 3912, and 3913, respectively;(mmmmmmm) 1402, 1403, 1209, 3911, 3912, and 3913, respectively;(nnnnnnn) 1404, 1405, 1214, 3914, 3915, and 3913, respectively;(ooooooo) 1406, 1403, 1209, 3911, 3912, and 3913, respectively;(ppppppp) 4017, 1241, 1209, 1408, 4002, and 3913, respectively;(qqqqqqq) 1242, 4018, 1209, 1408, 4002, and 3913, respectively;(rrrrrrr) 4019, 4020, 1214, 1409, 4003, and 3913, respectively;(sssssss) 1246, 4018, 1209, 1408, 4002, and 3913, respectively;(ttttttt) 4017, 1241, 1209, 1411, 4002, and 3913, respectively;(uuuuuuu) 1242, 4018, 1209, 1411, 4002, and 3913, respectively;(vvvvvvv) 4019, 4020, 1214, 1412, 4003, and 3913, respectively;(wwwwwww) 1246, 4018, 1209, 1411, 4002, and 3913, respectively;(xxxxxxx) 4017, 1241, 1209, 1411, 1414, and 3913, respectively;WSGR Docket No.53676-772.601(yyyyyyy) 1242, 4018, 1209, 1411, 1414, and 3913, respectively;(zzzzzzz) 4019, 4020, 1214, 1412, 1415, and 3913, respectively;(aaaaaaaa) 1246, 4018, 1209, 1411, 1414, and 3913, respectively;(bbbbbbbb) 4017, 1241, 1209, 1417, 4002, and 3913, respectively;(cccccccc) 1242, 4018, 1209, 1417, 4002, and 3913, respectively;(dddddddd) 4019, 4020, 1214, 1418, 4003, and 3913, respectively;(eeeeeeee) 1246, 4018, 1209, 1417, 4002, and 3913, respectively;(ffffffff) 4017, 1241, 1209, 1417, 1414, and 3913, respectively;(gggggggg) 1242, 4018, 1209, 1417, 1414, and 3913, respectively;(hhhhhhhh) 4019, 4020, 1214, 1418, 1415, and 3913, respectively;(iiiiiiii) 1246, 4018, 1209, 1417, 1414, and 3913, respectively;(jjjjjjjj) 1421, 1422, 1423, 1431, 1432, and 1433, respectively;(kkkkkkkk) 1424, 1425, 1423, 1431, 1432, and 1433, respectively;1426, 1427, 1428, 1434, 3915, and 1433, respectively;(mmmmmmmm) 1429, 1425, 1423, 1431, 1432, and 1433, respectively;(nnnnnnnn) 1436, 1422, 1423, 1431, 1432, and 1433, respectively;(oooooooo) 1437, 1425, 1423, 1431, 1432, and 1433, respectively;(pppppppp) 1438, 1427, 1428, 1434, 3915, and 1433, respectively;(qqqqqqqq) 1439, 1425, 1423, 1431, 1432, and 1433, respectively;(rrrrrrrr) 1441, 1425, 1423, 1431, 1432, and 1433, respectively;(ssssssss) 1442, 1427, 1428, 1434, 3915, and 1433, respectively;(tttttttt) 1443, 1425, 1423, 1431, 1432, and 1433, respectively;(uuuuuuuu) 1421, 1422, 1445, 1431, 1432, and 1433, respectively;(vvvvvvvv) 1424, 1425, 1445, 1431, 1432, and 1433, respectively;(wwwwwwww) 1426, 1427, 1446, 1434, 3915, and 1433, respectively;(xxxxxxxx) 1429, 1425, 1445, 1431, 1432, and 1433, respectively;(yyyyyyyy) 1421, 1422, 1423, 1431, 1432, and 1449, respectively;(zzzzzzzz) 1424, 1425, 1423, 1431, 1432, and 1449, respectively;(aaaaaaaaa) 1426, 1427, 1428, 1434, 3915, and 1449, respectively;(bbbbbbbbb) 1429, 1425, 1423, 1431, 1432, and 1449, respectively;(ccccccccc) 1424, 1451, 1423, 1431, 1432, and 1433, respectively;(ddddddddd) 1429, 1451, 1423, 1431, 1432, and 1433, respectively;(eeeeeeeee) 1441, 1425, 1423, 1431, 1432, and 1449, respectively;(fffffffff) 1442, 1427, 1428, 1434, 3915, and 1449, respectively;(ggggggggg) 1443, 1425, 1423, 1431, 1432, and 1449, respectively;(hhhhhhhhh) 1421, 1422, 1423, 1453, 1454, and 1433, respectively;(iiiiiiiii) 1424, 1425, 1423, 1453, 1454, and 1433, respectively;(jjjjjjjjj) 1426, 1427, 1428, 1455, 3915, and 1433, respectively;WSGR Docket No.53676-772.601 (kkkkkkkkk) 1429, 1425, 1423, 1453, 1454, and 1433, respectively;1421, 1422, 1423, 1453, 1454, and 1449, respectively;(mmmmmmmmm) 1424, 1425, 1423, 1453, 1454, and 1449, respectively;(nnnnnnnnn) 1426, 1427, 1428, 1455, 3915, and 1449, respectively;(ooooooooo) 1429, 1425, 1423, 1453, 1454, and 1449, respectively;(ppppppppp) 1458, 1425, 1423, 1431, 1432, and 1433, respectively;(qqqqqqqqq) 1459, 1427, 1428, 1434, 3915, and 1433, respectively;(rrrrrrrrr) 1460, 1425, 1423, 1431, 1432, and 1433, respectively;(sssssssss) 1436, 1422, 1423, 1431, 1432, and 1449, respectively;(ttttttttt) 1437, 1425, 1423, 1431, 1432, and 1449, respectively;(uuuuuuuuu) 1438, 1427, 1428, 1434, 3915, and 1449, respectively; or(vvvvvvvvv) 1439, 1425, 1423, 1431, 1432, and 1449, respectively.
231. The composition, the method, or the combination therapy of any one of claims 228-230, whereinthe Nectin-4 binding moiety comprises a. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1001 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003; b. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1200 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201; c. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1200 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003; d. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1202 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201; e. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1202 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;f. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1202 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1203;g. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1204 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;h. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1204 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;i. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1205 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;j. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1205 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1003;k. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1206 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;l. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;WSGR Docket No.53676-772.601m. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1228 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;n. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4014;o. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1228 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4014;p. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;q. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1247;r. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1249 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;s. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4004 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1259;t. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1262 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;u. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1270 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;v. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1278 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:4001;w. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1285 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1201;x. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1407;y. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1410;z. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1413;aa. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1416;WSGR Docket No.53676-772.601bb. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 4016 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1419;cc. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;dd. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1435 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;ee. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1440 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;ff. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1444 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;gg. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;hh. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1448;ii. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1450 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,WSGR Docket No.53676-772.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430;jj. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1435 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;kk. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1440 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;ll. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1450 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1447;mm. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1440 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1448;nn. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1452;oo. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1420 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1456;pp. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1457 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1430; orWSGR Docket No.53676-772.601 qq. a VH having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1435 and a VL having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:1448.
232. The composition, the method, or the combination therapy of any one of claims 228-231, whereinthe Nectin-4 binding moiety comprises a VH comprising a HC CDR1, a HC CDR2, and a HC CDR3 comprising the HC CDR1 sequence, the HC CDR2 sequence, and the HC CDR3 sequence of any one of SEQ ID NOs: 1001, 1200, 1202, 1204, 1205, 1206, 4004, 1228, 4016, 1249, 1262, 1270, 1278, 1285, 4016, 1420, 1435, 1440, 1444, 1450, and 1457, wherein the HC CDR1 sequence, the HC CDR2 sequence, and the HC CDR3 sequence are determined according to the Kabat. IMGT or Chothia numbering scheme.
233. The composition, the method, or the combination therapy of any one of claims 228-232, whereinthe Nectin-4 binding moiety comprises a VL comprising a LC CDR1, a LC CDR2, and a LC CDR3 comprising the LC CDR1 sequence, the LC CDR2 sequence, and the LC CDR3 sequence of any one of SEQ ID NOs: 1003, 1201, 1203, 4001, 4014, 1247, 1259, 1407, 1410, 1413, 1416, 1419, 1430, 1447, 1448, 1452, and 1456, wherein the LC CDR1 sequence, the LC CDR2 sequence, and the LC CDR3 sequence are determined according to the Kabat, IMGT or Chothia numbering scheme.
234. The composition, the method, or the combination therapy of any one of claims 138-233, whereinthe first agent comprises the multifunctional molecule of any one of claims 1-99.
235. The composition, the method, or the combination therapy of any one of claims 138-234, whereinthe first agent and / or the second agent is a polypeptide molecule.
236. The composition, the method, or the combination therapy of any one of claims 138-235, whereinthe multifunctional molecule is a multispecific molecule.
237. A pharmaceutical composition comprising the composition of any one of claims 138 and 142-236,and a pharmaceutically acceptable carrier, excipient, or diluent.
238. The method or the combination therapy of any one of claims 139-237, wherein the administering iseffective to treat the condition or disease in the subject.
239. The method or the combination therapy of any one of claims 139-238, wherein the condition ordisease is cancer.
240. The method or the combination therapy of claim 239, wherein the cancer is a solid tumor, ahematological cancer, a metastatic cancer, a soft tissue tumor, or any combination thereof.
241. The method or the combination therapy of claim 239 or 240, wherein the cancer is the solid tumorselected from the group consisting of melanoma, pancreatic cancer, breast cancer, colorectal cancer, lung cancer, skin cancer, ovarian cancer, liver cancer, and any combination thereof.WSGR Docket No.53676-772.601242. The method or the combination therapy of claim 239 or 240, wherein the cancer is thehematological cancer selected from the group consisting of Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma, acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome, multiple myeloma, T-cell lymphoma, acute lymphocytic leukemia, and any combination thereof.
243. The method or the combination therapy of claim 242, wherein the Non-Hodgkin’s lymphoma isselected from the group consisting of B cell lymphoma, diffuse large B cell lymphoma (DLBCL), follicular lymphoma, chronic lymphocytic leukemia (B-CLL), mantle cell lymphoma, marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia, and any combination thereof.
244. The method or the combination therapy of claim 243, wherein the T-cell lymphoma is peripheralT-cell lymphoma.
245. The method or the combination therapy of any one of claims 139-244, wherein the cancer ischaracterized by a cancer antigen present on the cancer.
246. The method or the combination therapy of claim 245, wherein the cancer antigen is a tumorantigen, a stromal antigen, or a hematological antigen.
247. The method or the combination therapy of claim 245 or 246, wherein the cancer antigen is selectedfrom the group consisting of CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRvIII), ganglioside G2 (GD2), ganglioside GD3, TNF receptor family member B cell maturation (BCMA), Tn antigen ((Tn Ag) or (GalNAcα-Ser / Thr)), prostate-specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, Receptor tyrosine-protein kinase ERBB2 (Her2 / neu), Mucin 1, cell surface associated (MUC1), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100 / pmel17), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GM1, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDN6), thyroid stimulating hormone receptor (TSHR), G protein-coupledWSGR Docket No.53676-772.601 receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, CD179a, anaplastic lymphoma kinase (ALK), Polysialic acid, placenta- specific 1 (PLAC1), hexasaccharide portion of globoH glycoceramide (GloboH), mammary gland differentiation antigen (NY-BR-1), uroplakin 2 (UPK2), Hepatitis A virus cellular receptor 1 (HAVCR1), adrenoceptor beta 3 (ADRB3), pannexin 3 (PANX3), G protein-coupled receptor 20 (GPR20), lymphocyte antigen 6 complex, locus K 9 (LY6K), Olfactory receptor 51E2 (OR51E2), TCR Gamma Alternate Reading Frame Protein (TARP), Wilms tumor protein (WT1), Cancer / testis antigen 1 (NY-ESO-1 / LAGE-1), Cancer / testis antigen 2 (LAGE-1a), Melanoma-associated antigen 1 (MAGE-A1), ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML), sperm protein 17 (SPA17), X Antigen Family, Member 1A (XAGE1), angiopoietin-binding cell surface receptor 2 (Tie 2), melanoma cancer testis antigen-1 (MAD-CT-1), melanoma cancer testis antigen-2 (MAD-CT-2), Fos-related antigen 1, tumor protein p53 (p53), p53 mutant, prostein, Survivin, telomerase, prostate carcinoma tumor antigen-1, melanoma antigen recognized by T cells 1, Rat sarcoma (Ras) mutant, human Telomerase reverse transcriptase (hTERT), sarcoma translocation breakpoints, melanoma inhibitor of apoptosis (ML-IAP), ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene), N-Acetyl glucosaminyl-transferase V (NA17), paired box protein Pax-3 (PAX3), Androgen receptor, Cyclin B1, v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN), Ras Homolog Family Member C (RhoC), Tyrosinase-related protein 2 (TRP-2), Cytochrome P4501B1 (CYP1B1), CCCTC- Binding Factor (Zinc Finger Protein)-Like, Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3), Paired box protein Pax-5 (PAX5), proacrosin binding protein sp32 (OY-TES1), lymphocyte-specific protein tyrosine kinase (LCK), A kinase anchor protein 4 (AKAP-4), synovial sarcoma, X breakpoint 2 (SSX2), Receptor for Advanced Glycation Endproducts (RAGE-1), renal ubiquitous 1 (RU1), renal ubiquitous 2 (RU2), legumain, human papilloma virus E6 (HPV E6), human papilloma virus E7 (HPV E7), intestinal carboxyl esterase, heat shock protein 70-2 mutated (mut hsp70-2), CD79a, CD79b, CD72, Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), Fc fragment of IgA receptor (FCAR or CD89), Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2), CD300 molecule-like family member f (CD300LF), C-type lectin domain family 12 member A (CLEC12A), bone marrow stromal cell antigen 2 (BST2), EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2), lymphocyte antigen 75 (LY75), Glypican-3 (GPC3), Fc receptor-like 5 (FCRL5), FcRH5, PDL1, CD47, prostate specific membrane antigen (PMSA), prostate-specific antigen (PSA), Ron Kinase, c-Met, Immature laminin receptor, TAG-72, BING-4, Calcium-activated chloride channel 2, Cyclin-B1, 9D7, Ep-CAM, EphA3, SAP-1, PRAME, SSX-2, Melan-A / MART-1, TRP1 / gp75, MC1R, β-catenin, BRCA1 / 2, CDK4, CML66, Fibronectin, Ras, TGF-Β receptor, AFP, ETA, MAGE, CA-125, BAGE, GAGE, CDC27, α actinin-4, gangliosides, MART-2, MUC2, MUM1, MUM2, MUM3, NA88-1, NPM, OA1, OGT, RCC, RU11, RU12, SAGE, TRG, TSTA, L1-CAM, gpA33, GM2, VEGFR, Integrins,WSGR Docket No.53676-772.601 carbohydrates, TRAILR1, TRAILR2, RANKL, TGF-beta, hyaluronic acid, collagen, tenascin C, tenascin W, and immunoglobulin lambda-like polypeptide 1 (IGLL1).
248. The method or the combination therapy of claim 239 or 240, wherein the cancer antigen is Nectin-4.
249. The method or the combination therapy of claim 239 or 240, wherein the cancer is a Nectin-4associated cancer.
250. The method or the combination therapy of any one of claims 239, 240, and 249, wherein the cancercomprises breast cancer, lung cancer, pancreatic cancer, head and neck cancer, bladder cancer, urothelial cancer, endometrial cancer, glioma, liver cancer, renal cancer, stomach cancer, testis cancer, thyroid cancer, ovarian cancer, gallbladder cancer, gastric cancer, esophageal cancer, hepatocellular cancer, epithelial cancer, or any combination thereof.
251. The method or the combination therapy of any one of claims 239, 240, 249, and 250, wherein thecancer comprises gastric cancer, pancreatic cancer, ovarian cancer, or any combination thereof.
252. The method or the combination therapy of claim 239 or 240, wherein the cancer comprises a solidcancer selected from the group consisting of colon cancer, breast cancer, renal cancer, melanoma, prostate cancer, lung cancer, rectal cancer, colorectal cancer, cervical cancer, and any combination thereof.
253. The method or the combination therapy of any one of claims 239-252, wherein the cancercomprises an anti-PD1 therapy resistant cancer.
254. The method or the combination therapy of claim 253, wherein the cancer comprises an anti-PD1therapy resistant solid cancer.
255. The method or the combination therapy of any one of claims 239-254, wherein the cancercomprises an HPV-positive cancer.
256. The method or the combination therapy of claim 255, wherein the cancer comprises an HPV-positive solid cancer.
257. The method or the combination therapy of any one of claims 239-256, wherein the cancercomprises a cancer with a high tumor mutation burden.
258. The method or the combination therapy of any one of claims 239-257, further comprisingadministering a second therapeutic agent or therapy to the subject.
259. The method or the combination therapy of claim 258, wherein the second therapeutic agent ortherapy comprises a chemotherapeutic agent, a biologic agent, a hormonal therapy, radiation, or surgery.
260. The composition, the method, or the combination therapy of any one of claims 138-259, whereinthe first agent and / or the second agent independently comprises a construct, an agent, a multifunctional molecule or a multispecific molecule comprising a sequence having at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of any one construct selected from theWSGR Docket No.53676-772.601 constructs, agents, multifunctional molecules or a multispecific molecules as described herein or as listed in Table 25, 28, or 29.
261. The composition, the method, or the combination therapy of any one of claims 138-260, whereinthe first agent and / or the second agent independently comprises a construct, an agent, a multifunctional molecule or a multispecific molecule comprising any one construct, agent, multifunctional molecule or multispecific molecule selected from the constructs, agents, multifunctional molecules or a multispecific molecules as described herein or as listed in Table 25, 28, or 29.
262. A method of treating a disease or condition in a subject in need thereof comprising administering tothe subject a first agent and a second agent, wherein (a) the first agent comprises (i) a TCRβV-binding domain and (ii) a molecule that binds to a co- stimulatory receptor of a T cell, and (b) the second agent comprises an antibody drug conjugate comprising (i) a tumor associated antigen (TAA)-binding domain and (ii) a cytotoxic drug.
263. The method of claim 262, wherein the cytotoxic drug is an auristatin, a maytansinoid, acalicheamicin or a derivative thereof, a duocarmycin or a derivative thereof, a pyrrolobenzodiazepine (PBD), or a topoisomerase inhibitor.
264. The method of claim 263, wherein the cytotoxic drug is monomethyl auristatin E (MMAE) ormonomethyl auristatin F (MMAF).
265. The method of claim 263, wherein the cytotoxic drug is mertansine (DM1) or ravtansine (DM4).
266. The method of claim 263, wherein the cytotoxic drug is Adozelesin, Bizelesin, Carzelesin,Duocarmycin SA, or Duocarmycin MA.
267. The method of claim 263, wherein the cytotoxic drug isanthramycin, sibiromycin, tomaymycin, orSG3199.
268. The method of claim 263, wherein the cytotoxic drug is Irinotecan, Topotecan, Etoposide,Teniposide, Doxorubicin, or Epirubicin269. The method of any one of claims 263-268, wherein the TAA-binding domain of the second agent isan anti-Nectin 4 binding domain.