A neurovita short interfering peptide suitable for neuroprotection and neuroregeneration and uses thereof

A short Neurovita peptide (NVshort) with optimized PDZ-binding motif, fused with a cell-penetrating molecule, addresses solubility and aggregation issues, enhancing its therapeutic efficacy for neurological disorders by promoting neuronal regeneration and protection.

WO2025262278A1PCT designated stage Publication Date: 2025-12-26INST PASTEUR +1
View PDF 10 Cites 0 Cited by

Patent Information

Application Number
PCT/EP2025/067381
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-06-21
Filing Date
2025-06-20
Publication Date
2025-12-26

AI Technical Summary

Technical Problem

Existing long Neurovita peptides used for neuroprotection and neuroregeneration face issues with solubility, yield, and formation of aggregates when fused with cell-penetrating molecules, limiting their potential as therapeutic agents for neurological disorders.

Method used

Development of a short Neurovita peptide (NVshort) comprising 11-15 amino acids with optimized PDZ-binding motif, fused with a cell-penetrating molecule (CPM) such as VHH, to enhance solubility and avoid aggregation, while maintaining neuroprotective and neuroregenerative effects.

Benefits of technology

The NVshort peptide effectively promotes neurite outgrowth and neuronal regeneration, demonstrating improved solubility and stability in physiological fluids, making it suitable for therapeutic applications in neurological disorders.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000048_0001
    Figure IMGF000048_0001
  • Figure 00000053_0000
    Figure 00000053_0000
  • Figure 00000053_0001
    Figure 00000053_0001
Patent Text Reader

Abstract

The invention relates to a Neurovita peptide short fragment encoding a PDZ-binding motif (PBM) inhibiting the PDZ domain of the human MAST2 & MAST1 enzymes. The invention also relates to polypeptides comprising this Neurovita short peptide, notably peptides further comprising a cell-penetrating molecule (CPM), and uses thereof.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] A NEURO VITA SHORT INTERFERING PEPTIDE SUITABLE FOR NEUROPROTECTION AND NEUROREGENERATION AND USES THEREOF

[0002] FIELD OF THE INVENTION

[0003] The invention relates to a Neurovita peptide short fragment encoding a PDZ-binding motif (PBM) inhibiting the PDZ domain of the human MAST2 & MAST1 enzymes. The invention also relates to polypeptides comprising this Neurovita short peptide, notably peptides further comprising a cell-penetrating molecule (CPM), and uses thereof.

[0004] DESCRIPTION OF THE PRIOR ART

[0005] The protein-protein interactions (PPIs) play a crucial role in cell metabolism by promoting scaffold and contact between proteins such as enzymes and their substrate ligands. Among the different PPIs types, many are mediated by PDZ domains allowing the interaction of two distinct proteins through the recognition of the PDZ encoded by one protein by the PDZ Binding Motives (PBM) present on the second protein, often located at the C-terminus.

[0006] Although PDZ domains are frequent in nature, they have been described as difficult to target with high affinity / high specificity in pharmacological approaches. However, the structures of several PDZ / PBM interactions have been solved by Nuclear Magnetic Resonance (NMR) or crystallography, making the PDZ / PBM interaction now druggable. PDZ / PBM interactions can be modulated by blocking agents and therefore developed as drug targets (Dev KK. Making protein interactions druggable: targeting PDZ domains. Nat Rev Drug Discov. 2004 Dec;3(12): 1047-56). In this context, blocking peptides, such as interfering peptides have been developed to modulate the PDZ / PBM interactions of proteins that are often involved in neurological disorders (Christensen N, Calyseva J, Fernandes E, Liichow S, Clemmensen L, Haugaard-Kedstrom L, et al. PDZ Domains as Drug Targets. Adv Ther. 2019 Apr 24;2: 1800143). Hence, modulation of PDZ interactions with interfering peptides is a powerful strategy for developing therapeutical approaches for neurological diseases.

[0007] One interfering peptide showing great interest is the Neurovita peptide. Its C-terminal PBM domain blocks the interaction of the PDZ domain of the Microtubule Associated Serine Threonine kinase 2, MAST2, and kinase 1, MAST1 with the PBM domain of its ligand PTEN. It is sufficient to launch a cascade of signalling pathway (PI3K / Akt / mTOR) allowing the activation of survival and protein translation mechanisms in neurons, and to function as a neuroprotective and neuroregenerative biomolecule, allowing to keep injured nerves alive (neurosurvival) and to induce axon regrowth after injury (neuroregeneration) (WO2010 / 116258 and WO 2013 / 068430).

[0008] It has been demonstrated in application WO2010 / 116258 that the nature of the amino acid residues at positions 491 (H / L) and 521 (Q / E) of the G protein of rabies viruses is important for the effects on neuron survival and on neurite outgrowth. The G protein of a virulent rabies virus strain presenting a H residue at position 491 and a Q residue at position 521 is non-apoptotic and favors neurite outgrowth. In contrast, the G protein of an attenuated rabies virus strain presenting a L residue at position 491 and a E residue at position 521 is apoptotic and does not promote neurite outgrowth.

[0009] Furthermore, WO 2013 / 068430 proposed to use as therapeutic peptide the whole cytoplasmic domain of the G protein of rabies virus comprising a PBM formed by two anchors (a C-terminal QTRL in position -3, -2, -1, 0 and a sequence of 2 residues (serine, S and tryptophan, W) linked by a flexible part (Terrien et al, 2012) and a cytoplasmic part upstream of the PBM, said cytoplasmic part upstream of the PBM containing 20 to 40 amino acids, preferably 31 amino acids, for example the peptide as defined in SEQ ID NO:2 or a variant having at least 80% identity with SEQ ID NO:2 of WO 2013 / 068430. Thus, the Neurovita polypeptide described in WO 2013 / 068430 contains at least 31 amino acids (at least 20 amino acids for the upstream part of the PBM and 11 amino acids for the C-terminal PBM).

[0010] More generally, all biological assays involving the Neurovita peptides in the past have been carried out by using long polypeptide containing between 30-44 amino acids of the cytoplasmic domain of the pro-survival rabies virus G protein (including the PBM in the C-terminal part). Of note, the biological effect of several long polypeptides (Neurovita 1, 44 amino acid long, Neurovita 2 (42 amino acids long) and Neurovita 3 (42 amino acids long), were tested in W02013 / 068430, and the same long peptides were still preferred few years later as shown in Khan et al, Structure-based optimization of a PDZ-binding motif within a viral peptide stimulate neurite outgrowth, J. Biol. Chem. 2019, 294(3) 13755-13768. This is because the cytoplasmic domain of the G protein from which the Neurovita peptide is derived is a protein that is known to be intrinsically disordered. As a result, it was expected that, by reducing its size too much, the conformation of its C-terminal part would be modified, and the resulting peptide would thus lose the biological activity of the whole cytoplasmic domain of the rabies virus G protein. Examples of such observations were described in the art, see e.g., Flanagan et al., 1992 (Flanagan JM, Kataoka M, Shortle D, Engelman DM. Truncated staphylococcal nuclease is compact but disordered. Proc Natl Acad Sci USA. 1992 89(2):748-752) and more recently An et al., 2020 (An SY, Ka D, Kim I, Kim EH, Kim NK, Bae E, Suh JY. Intrinsic disorder is essential for Cas9 inhibition of anti-CRISPR AcrIIA5. Nucleic Acids Res. 2020 48(13):7584- 7594).

[0011] Moreover, the yield of production of a fusion of the Neurovita peptide with a VHH, as a Cell Penetrating Molecule (CPM), was too low for drug development. Moreover, the fusion was found to form aggregates when contacted with physiological fluids such as the vitreous humor of the eye.

[0012] There is thus still a need to provide a therapeutically active molecule based on the Neurovita peptide.

[0013] SUMMARY

[0014] In a first aspect, the present invention provides a Neurovita polypeptide comprising or consisting of the NVshort peptide of sequence:

[0015] XnSWXVXXQQTRL (SEQ ID NO:4), wherein X is any amino acid and n is an integer comprised between 0 and 4 (i.e., n is 0, 1, 2, 3, or 4), and wherein the sequence of the Neurovita polypeptide is not SEQ ID NO:1, 2, or 3.

[0016] In an embodiment, the NVshort polypeptide has a sequence selected in the group consisting of SEQ ID NOs:5-ll

[0017] In an embodiment, the polypeptide of the invention further comprises at least one cellpenetrating molecule (CPM) and optionally a homing molecule. Preferably, the NVshort polypeptide has a basic isoelectric point.

[0018] In an embodiment, the polypeptide of the invention consists of a fusion protein between the NVshort peptide of sequence RIISSWEVHGQQTRL (SEQ ID NOY) and a VHH CPM.

[0019] Preferably, said CPM is chosen in the group consisting of: A heavy chain polypeptide of a VHH camelid antibody, whose sequence is mutated to contain at least one disulfide bond and a CDR3 containing three or more mutations as compared with SEQ ID NO: 15, so as to inactivate the antibody function of said VHH camelid antibody,

[0020] A Rabies virus Derived Peptide (RDP) whose sequence displays at least 90% similarity with SEQ ID NO:21, and in which the only cysteine amino acid has been substituted by another amino acid, or

[0021] A protein transduction domain of the HIV trans-activator of transcription L-TAT having at least 90% similarity with SEQ ID NO:25.

[0022] More preferably, said CPM and / or Neurovita peptides are separated by a linker.

[0023] In an embodiment, the polypeptide of the invention contains: a. the VHHNPX CPM having the SEQ ID NO: 19 or a variant thereof, whose sequence displays at least 90%, preferably at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% similarity with SEQ ID NO: 19, said variant comprising i) the CDRs of SEQ ID NO: 13, SEQ ID NO: 14 and SEQ ID NO: 16 as CDR1-3 respectively, and ii) at least one disulfide-bridge formed by two cysteines, and b. the NVshort polypeptide of sequence RIISSWEVHGQQTRL (SEQ ID NO:7).

[0024] In an embodiment, the polypeptide of the invention has the sequence SEQ ID NO:28.

[0025] Preferably, the polypeptide of the invention is soluble in vitreous humor, non-aggregated, and able to bind and block with high affinity the PDZ domain of the human MAST1 and MAST2 proteins in neuronal cells.

[0026] In another aspect, the invention provides a vector, preferably a viral vector, DNA or mRNA, encoding the polypeptide described above.

[0027] In another aspect, the invention relates to a pharmaceutical composition comprising the polypeptide or the vector described above.

[0028] In another aspect, the invention relates to the pharmaceutical composition described above for its use as a medicament. Preferably, the pharmaceutical composition is used for preventing and / or treating a disease or condition involving the Peripheral Nervous System (PNS) or the Central Nervous System (CNS) or the evolution of such disease or condition, such as optic neuropathies (glaucoma, NAION), motor neuron diseases (ALS), muscular diseases (Duchenne Disease) or neurodegenerative diseases (Parkinson disease, Alzheimer’s Disease). More preferably, said disease or condition is a neurodegenerative disease, or a cell damage-associated condition such as stroke or injury including optic nerve disease, retinal diseases, muscular diseases, motor neuron disease.

[0029] FIGURE LEGENDS

[0030] Figure 1 shows the structure of the VHH-NV fusion protein of the prior art, as described in W02013 / 068430 and in WO2016 / 038122 and in 2 publications: Khan Z et al, 2019 and da Costa A et al, 2020. The term “RDP” designates a short polypeptide derived from the RABV G protein extracellular domain, which interacts with the alpha 7 subunit of nAchR . In the fusion proteins of the prior art, the polypeptide RDP contained a cysteine (Synthetic peptides corresponding to sequences of snake venom neurotoxins and rabies virus glycoprotein bind to the nicotinic acetylcholine receptor. Proteins 2, 298-307, (1987); Lentz, T. L., Wilson, P T., Hawrot, E. & Speicher, D. W. Amino acid sequence similarity between rabies virus glycoprotein and snake venom curare mimetic neurotoxins. Science 226, 847-848, (1984); Donnelly- Roberts, D. L. & Lentz, T. L. Synthetic peptides of neurotoxins and rabies virus glycoprotein behave as antagonists in a functional assay for the acetylcholine receptor. Pept Res 2, 221-226 (1 89)). The term “VHH” designates an alpaca single chain antibody which can cross the bloodbrain barrier. It is derived from the VHH A12 described by Li T et al, 2017. In the fusion proteins of the prior art, the CDR3 is native. The “strep tag” is a streptavidin tag used to monitor the presence and the expression of the molecule in cells. The term “Neurovita long” stands for the neuroprotective and neurodegenerative biomolecule called “Neurovita 3” (or “NV3-Cyto”) derived from the cytoplasmic domain of RABV G protein, as displayed on figure 11 of W02013 / 068430.

[0031] Figure 2 shows how the removal of RDP improves the production of the fusion protein in recombinant bacteria E. coli. The HISRDP- VHH-NV and HIS-VHH-NV constructs leading to the expression of(,HIS-RDP VHH-NV (C3. lb) and the expression of sHIS- VHH-NV lacking RDP (C3.3) constructs were produced in T7 shuffle Express bacteria. Cultures were harvested after 4h or after over-night (ON). Bacteria were lysed and centrifuged to separate pellet (whole cell fraction) from supernatant (soluble fraction). The fractions were separated on SDS PAGE under denaturating conditions and stained with Coomassie Blue. Left lanes correspond to C3.1b bacteria production. Right lanes correspond to C3.3 (no RDP) production. Molecular weight was run on both sides of the gel. Product Of Interest (POI) (here the VHH-NV) could be detected at the expected molecular weight (18kDa) in whole cell and soluble fraction of the C3.3 bacteria cultures and not in the C3.1 bacteria cultures. Note that, in the two fusion proteins C3. lb and C3.3, the encoded VHH lacks disulfide bonds.

[0032] Figure 3 shows that RDPc forms dimers and aggregates, but not RDPs. Three constructs of RDP -NVshort (ML49c, MG49c, and ML49s) were chemically synthesized. ML49c results of the fusion of RDPc with NVshort ML49c-APBM (or MG49c) corresponds to a ML49c lacking the C-terminal PBM, while ML49s results of the fusion of a modified RDP, RDPs, with NVshort. RDPs contains a serine instead of the cysteine. Gels were run and immunoblotted. NVs was detected using a Neurovita-specific rabbit antibody. A) Under denaturing conditions (left gel), semi-denaturating conditions (middle gel) ML49c forms both monomers and dimers. This is still observed with ML49c-APBM, indicating that PBM is not involved in the dimer formation. In native conditions (Right gel) ML49c forms a smear of aggregates. B) An in vitro test performed in 384 well plates was set up to test the solubility of compounds upon contact with rabbit vitreous humor. Solubilization of ML49c and ML49s in 60nM MES buffer 300mM NaCl, was obtained in pH 6.5 condition and addition of 7.5% DMSO. 2ul of each compound or vehicle were added to 5pl of rabbit vitreous. After Ih incubation at 37°C, the presence of aggregates was detected with the camera of the DLS (Dynamic Light scattering) station.

[0033] Figure 4 shows that NVshort is as efficient as NViong in promoting neurite outgrowth in vitro in NGF-pretreated neuroscreen cells. The property of NVshort and those of NViong to promote neurite outgrowth were compared in a 72h-assay on Neurotrophic factor (NGF) pretreated neurosreen cells (a subclone of rat PC12, see Khan Z et al, 2019). RKM is a Streptag- VHH-NV fusion protein encoding NViong (42 amino acids), RK2M is a Streptag- VHH-NV fusion protein encoding NVshort (15 amino acids) and AAA RK2M is a Streptag- VHH-NV fusion protein encoding NVshort (15 amino acids) and containing a linker formed by 3 Alanines inserted between the VHH sequence and the Neurovita sequence. Whatever the concentrations (0.22pM to 0.055pM), no difference in promoting neurite outgrowth could be observed between constructs encoding NViong or NVshort. In addition, the insertion of a 3A linker between VHH and Neurovita sequences does not alter the VHH-NVshort neurite outgrowth function.

[0034] Figure 5 shows that the insertion of a disulfide bridge in VHH increases solubility and avoid aggregates formation upon contact with vitreous humor. Using the in vitro test of detection of aggregate formation upon contact with rabbit vitreous, it was observed that the compound VHH-NV- whose VHH does not contain any disulfide bridge (“VHH w / o DS”- lower lane of the figure) triggers aggregate formation at each of the tested concentrations (9pM - 36pM). In contrast, when the disulfide bridge was allowed to form after insertion of two cysteines (C22 and C95) (“VHH with DS”, in upper lane), no aggregates could be observed. Insertion of the disulfide bridge results in increased solubility (130mg / mL in phosphate buffer).

[0035] Figure 6 shows the in vitro cell entry of the CPM-NVshort NVshort (7pmol) after 3h- contact with ARPE19 cells once NVshort has been vectorized with the CPM VHHNPX (NPX461) or with the CPM LTAT (LTAT-NV). After wash and PFA fixation, cells were incubated with a NVshort-specific guinea-pig antibody, followed by an Alexa 555- conjugated antibody directed against guinea-pig IgG. Slides were mounted with Fluoromount G containing DAPI (marker of nucleus) and analyzed by confocal microscopy imaging. The image on the left, illustrates that NVshort vectorized by LTAT enters the cytoplasm where it forms aggregates that accumulate in perinuclear regions (arrows). The image on the right, shows that NVshort vectorized with VHHNPX enters into the cytoplasm (stars) without forming aggregates. The non-treated condition (CT) shows no cytoplasm staining. N indicates the cell nucleus. Size marker is 50pm.

[0036] Figure 7 is a scheme showing the structure of the retina. An intravitreal injection allows delivery of therapeutics into the inner part of retina, in particular in the first layer of cells, consisting mainly of retinal ganglion cells (RGC) whose axons form the optic nerve. After intravitreal injection, compound has to cross the vitreous humor, (a gel at pH 7.5), escapes enzymatic degradation and engulfment by macrophages located in the vitreous, and finally crosses the inner limitans membrane at the vitreo-retinal interface before to reach the RGCs located in the RGC layer (RGL in the scheme). CPM-NVs is delivered by the intravitreal route to target the RGCs.

[0037] Figure 8 shows that both NPX461 (VHHNpx-NVshort) and NPX452 (VHHNpx-NVlong) are efficiently addressed to retina RGCs layer following intravitreal injection of the mouse eye. (A) 10, 50, 125, or 250 pmol of NPX461 or NPX452 are injected and 6 hours later an immunoanalysis of flatmount retina was performed with the Neurovita-specific antibody (SYCO22). The calculated half maximal intensity of fluorescence (IC50), 6pmol for NPX461 (VHHNPX-NV short) and 1 Opmol for NPX452, (VHHNpx-NVlong) are very close, indicating that NVlong and NVshort are similarly detected in the retina, and that the shortening of NV does not alter retina targeting (B) 250 pmol of NPX461 or NPX452 are injected in the vitreous and the presence of the NV polypeptide is assessed 3h, 8h, 24h or 30h after the injection with a specific NV antibody (SYCO22). The graph shows that the duration of the Neurovita detection in retina RGC layer is similar after NPX461 injection than after NPX452 injection, indicating that the shortening of NV has no impact on NVshort peptide detection in the retina.

[0038] Figure 9 shows the ex vivo effect of NPX461 on axon regeneration in retina explants. It shows that the number of axons is significantly enhanced with NPX461 as compared with positive and negative control compounds.

[0039] Figure 10 shows the in vivo preclinical properties of the VHH-NVshort of the invention (NPX461) in the mouse model of optic neuropathies, the optic nerve compression (ONC) model (A) on RGC protection and (B) on optic nerve regeneration.

[0040] DETAILLED DESCRIPTION OF THE INVENTION

[0041] The purpose of the invention described herein is to reduce the size of NV and to propose solutions to solve the issues of solubility, yield, formation of aggregates of NV-fused to CPM in order to transform the VHH-NV molecule with high therapeutic potential into an investigational drug candidate.

[0042] In spite of the teaching of the art, the present inventors have surprisingly shown that a very short fragment of the cytoplasmic domain retains the PBM biological activity of the G protein. In particular, the PBM on its own is sufficient for the regeneration and protection of neurons. Accordingly, shorter peptides can be used for the regeneration of axons and protection of cells, in particular neurons, as long as these peptides contain the C-terminal PBM of type NV3 (SEQ ID NO: 12) or a functional variant thereof (herein called “Neurovita short peptides”).

[0043] The Neurovita peptide (NV)

[0044] Prehaud et al. (Attenuation of rabies virulence: takeover by the cytoplasmic domain of its envelope protein, Sci Signal. 2010 Jan 19;3(105):ra5) reported that the C-terminal region of the cytoplasmic domain of the G protein of rabies viruses is involved in the binding of the G protein to the PDZ domain of the human MAST2 and MAST1 protein. This C-terminal region comprises a motif called PDZ-BM or PBM (PDZ binding motif) which has the sequence SEQ ID NO: 12.

[0045] Subsequent analysis showed that the NV PBM is a non-classical PBM formed by two subsites (anchors), with a first anchor (QTRL residues in -4, -3, -2, and -1 from the C-terminus) binding the canyon on the surface of MAST-2 PDZ, and 2 residues SW (serine-tryptophan) in C- terminal position -10 and -9 forming a second anchor. For efficient binding to the MAST-2 PDZ, the two anchoring sub-sites should be separated by 5 amino acids (Terrien et al, 2012, Khan et al, 2019). In the present invention, the PBM of Neurovita has been optimized (the cytoplasmic domain comprising this optimized PBM is called Neurovita 3 in Khan et al., 2019).

[0046] As used herein, the term “Neurovita protein” or “Neurovita long peptide” or “NVlong” designates the cytoplasmic tail domain of the pro-survival rabies virus G protein, said domain having a high affinity for the PDZ domain of the human MAST2 and MAST1 protein. This long peptide has been fully described in the previous applications of the same inventors, namely WO2010 / 116258 and WO 2013 / 068430, which are incorporated herein by reference.

[0047] It can be the “Neurovita 3” long polypeptide described in the prior art document W02013 / 068430, which has the SEQ ID NO:1.

[0048] It can also be the mutated polypeptide having the SEQ ID NO:2, in which 5 amino acids have been mutated as compared with SEQ ID NO:1, in order to keep intact the value of the isoelectric point (pl), once it has been fused to a VHH to allow delivery into the cell cytoplasm.

[0049] It can also be the mutated polypeptide having the SEQ ID NO:3, in which 5 amino acids have been mutated as compared with SEQ ID NO:1, and in which one amino acid has been mutated as compared with SEQ ID NO:2, so that the pl value is even more adequate.

[0050] These particular long Neurovita polypeptides have the following sequences:

[0051] SEQ ID NO:1: RRVNRSEPTQHNLRGTGREVSVTPQSGKIISSWEVHGQQTRL (42 amino acids)

[0052] SEQ ID NO:2: AAVNASEPTQHNLRGTGAEVSVTPQSGAIISSWEVHGQQTRL (the 5 underlined amino acids have been mutated as compared with SEQ ID NO: 1)

[0053] SEQ ID NO:3: AAVNASEPTQHNLRGTGAEVSVTPQSGRIISSWEVHGQQTRL (the 5 underlined amino acids have been mutated as compared with SEQ ID NO: 1) NVshort

[0054] All biological assays involving the Neurovita polypeptides in the past have been carried out by using the long Neurovita polypeptides as defined above, containing between 30-44 amino acids of the cytoplasmic domain of the pro-survival rabies virus G protein. This is because the cytoplasmic domain of the G protein from which the Neurovita polypeptide was derived was known to be intrinsically disordered and it was expected that, by reducing its size too much, the conformation of its C-terminal part would be so modified that the resulting peptide would lose its biological activity (see other examples in Flanagan, 1992 and more recently So Young An, 2020).

[0055] In this context, the present inventors nevertheless decided to reduce the size of the Neurovita polypeptide to avoid that non-essential parts thereof could be recognized by the immune system of the patient because they originate from a viral protein.

[0056] As used herein, the term “Neurovita short peptide” or “NVshort” thus designates a functional fragment of the cytoplasmic domain of the pro-survival rabies virus G protein, that has been deprived of all non-essential residues and in which the C terminal PBM (original sequence called Neurovita 1) has been optimized into PBM of type Neurovita 3 as described in Kahn et al, 2019. The present inventors reveal in the examples below, for the first time, that the 11-15 amino acids long NVshort sequences encoding a PDZ-binding motif (PBM) of type Neurovita 3, is efficient on its own in various biological assays (figures 4, and 8-10), even when it is separated from the 25-33 amino acids also present in the N-terminal part of the cytoplasmic domain of this G protein. In particular, NVshort is able to induce neurite elongation as well as the NVlong peptide (Figure 4). Surprisingly, NVshort fused to a VHH as a CPM displays a longer remanence in the retina after in vivo administration than NVlong fused to the same VHH (Figure 8).

[0057] In a first aspect, the present invention relates to the “NVshort peptide” which consists in the C- terminal fragment of 11-15 amino acids of the “NVlong” polypeptide encoding a PBM of Neurovita 3 type (SEQ ID NO: 12) disclosed above, or a variant thereof. In other words, the “NVshort ” peptide of the invention corresponds to the “NVlong” polypeptide disclosed above, in which the 25, 26, 27, 28, 29, 30, 31, 32 or 33 consecutive N-terminal amino acids have been deleted. In other words, the NV short peptide of the invention is a 11 - 15 amino acid-long peptide comprising a PBM of Neurovita 3 type (SEQ ID NO: 12) and does not contain the 25 to 33 amino acids long N-terminal part of the cytoplasmic domain of the rabies virus G protein, or a variant of this peptide.

[0058] The NVshort peptide of the invention necessarily comprises the first anchor (QTRL) of the Neurovita peptide onto MAST-2 PDZ, and two SW (Serine-Tryptophan) residues that form the second anchor of the Neurovita peptide onto the MAST-2 PDZ. In the peptide of the invention, these two anchoring subsites are separated by 5 amino acids (Terrien et al, 2012, Khan et al, 2019). In a preferred embodiment, the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively.

[0059] Preferably, the value of the pl of the molecule-once the variant peptide has been fused to a Cell Penetrating Molecule, in particular a VHH, is preserved.

[0060] In a preferred embodiment, the NVshort peptide of the invention corresponds to the long Neurovita peptide having the SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO:3 in which the 27 N-terminal amino acids upstream of the PBM have been removed, or a variant thereof in which the 15 amino acid in C-terminal position, preferably 7 amino acid of the 15 amino acid in C- terminal position, can be substituted by any amino acid, preferably similar aa, and / or deteted provided that: i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively.

[0061] According to this preferred embodiment, the NVshort peptide has the sequence:

[0062] XnSWXVXXQQTRL (SEQ ID NO:4), wherein X is any amino acid and n is an integer comprised between 0 and 4 (i.e., n is 0, 1, 2, 3, or 4).

[0063] Preferably, the value of the pl of the molecule-once the NVshort peptide has been fused to a Cell Penetrating Molecule, in particular a VHH, is preserved. In a preferred embodiment, the present invention targets a Neurovita short peptide (NVshort) having the sequence:

[0064] - SEQ ID NO:5, or a variant thereof in which the 15 amino acids in C-terminal position, preferably 7 amino acid of the 1 amino acid in C-terminal position, can be substituted by any amino acid, preferably similar aa, and / or deleted provided that: i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively.

[0065] Preferably, the value of the pl of the molecule-once the NVshort peptide has been fused to a Cell Penetrating Molecule, in particular a VHH, is preserved.

[0066] - SEQ ID NO: 6, or a variant thereof in which the 15 amino acids in C-terminal position, preferably 7 amino acid of the 15 amino acid in C-terminal position, can be replaced by any amino acid, preferably similar aa, and / or deleted provided that: i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively.

[0067] Preferably, the value of the pl of the molecule-once the NVshort peptide has been fused to a Cell Penetrating Molecule, in particular a VHH, is preserved.

[0068] - SEQ ID NO: 7, or a variant thereof in which the 15 amino acids in C-terminal position, preferably 7 amino acid of the 15 amino acid in C-terminal position, can be replaced by any amino acid, preferably by similar aa, and / or deteted provided that: i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively.

[0069] Preferably, the value of the pl of the molecule-once the NVshort peptide has been fused to a Cell Penetrating Molecule, in particular a VHH, is preserved.

[0070] In a particular embodiment, said NVshort peptide variant may display the SEQ ID NO:5, 6, or 7 in which the SW, the QTRL amino acids (i.e., the first and second anchors), and the length of the linker (5aa) are maintained, and in which 1, 2, 3, 4, 5, 6, 7 of the other amino acids may be substituted, preferably by similar amino acids, provided that the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively. More particularly, in said variants, 1, 2, 3, or 4 N-terminal amino acid(s) can be deleted from SEQ ID NO:5, 6, or 7 (cf. SEQ ID NO:8-IO).

[0071] In a second aspect, the present invention also relates to a polypeptide containing the NVshort peptide as described above. This polypeptide will be designated as the “Neurovita polypeptide of the invention”

[0072] In some embodiments, the Neurovita polypeptide of the invention only contains the NVshort peptide of the invention, so that the Neurovita polypeptide of the invention consists in the NVshort peptide of the invention as described above. In a preferred embodiment, the Neurovita peptide of the invention does not correspond to a peptide of SEQ ID NO: 1, 2, or 3.

[0073] In other embodiments, the Neurovita polypeptide of the invention contains the NVshort peptide of the invention, and also at least one other peptide(s), for example a Cell Penetrating Molecule (CPM). In this case, the Neurovita polypeptide of the invention can be also referred to as “fusion protein of the invention”.

[0074] In a particular embodiment, the present invention thus provides a Neurovita polypeptide comprising or consisting of the NVshort peptide of sequence:

[0075] XnSWXVXXQQTRL (SEQ ID NO:4), wherein X is any amino acid and n is an integer comprised between 0 and 4 (i.e., n is 0, 1, 2, 3, or 4), and wherein the sequence of the Neurovita polypeptide is not SEQ ID NO: 1, 2, or 3. As explained above, the NVshort variant contained in the Neurovita polypeptide of the invention should contain the four C-terminal amino acids residues of the cytoplasmic domain of the non-apoptotic rabies virus G protein, namely the PBM (having the sequence QTRL) and the SW (serine, tryptophan) residues that form the two anchors of the PBM to the MAST-2 PDZ, and the two anchors should be separated by 5 amino acids (Terrien et al, 2012, Khan et al, 2019). However, it is possible to remove 1, 2, 3 or 4 amino acids on their N-terminal side, as compared with SEQ ID NO:5, SEQ ID NO:6, and SEQ ID NO:7, so that the NVshort variant contained in the Neurovita polypeptide of the invention eventually contains between 11-15 amino acids.

[0076] Thus, in a preferred embodiment, the Neurovita polypeptide of the invention contains or consists in a NVshort peptide having the sequence SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, or SEQ ID NO: 11 corresponding respectively to the 14, 13, 12, 11 C-terminal amino acids of SEQ ID NO:3, or variants thereof preferably displaying:

[0077] The sequence of said NVshort peptide corresponding to a sequence of 14 amino acids of SEQ ID NO: 8 which can be replaced by any amino acid, preferably by similar amino acids, provided that i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively;

[0078] - The sequence of said NVshort peptide corresponding to a sequence of 13 amino acid of SEQ ID NOV: which can be replaced by any amino acid, preferably by similar amino acids, provided that i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively;

[0079] The sequence of said NVshort peptide corresponding to a sequence of 12 amino acid of SEQ ID NO: 10: which can be replaced by any amino acid, preferably by similar amino acids, provided that i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively;

[0080] The sequence of said NVshort peptide corresponding to a sequence of the 11 amino acid in C-terminal position SEQ ID NO:11 : which can be replaced by any amino acid, preferably by similar amino acids, provided that i) the first and second anchors described above are not mutated, ii) the two anchors are separated by 5 amino acids, and iii) the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively.

[0081] Preferably, the value of the pl of the molecule-once the NVshort peptide described above has been fused to a Cell Penetrating Molecule, in particular a VHH, is preserved.

[0082] Thus, in a particular embodiment, the Neurovita polypeptide of the invention contains or consists in a NVshort peptide variant whose sequence is the SEQ ID NO:5, 6, or 7, in which the SW and QTRL amino acids are maintained, and in which 1, 2, 3, 4, 5, 6, 7 of the other amino acids may be substituted, preferably by similar amino acids, the two anchors are separated by 5 amino acids, and the residues at positions -8 and -5 from the C-terminus of the peptide are V and Q, respectively. More particularly, in said variants, 1, 2, 3, or 4 N-terminal amino acid(s) can be deleted from SEQ ID NO:5, 6, or 7 (cf. SEQ ID NO:8-10).

[0083] In a particular embodiment, the Neurovita polypeptide of the invention contains or consists in a NVshort peptide that has a sequence selected in the group consisting of SEQ ID NOs:5-l l . Preferably, the Neurovita polypeptide of the invention contains or consists in a NVshort peptide that has SEQ ID NO: 7

[0084] In a preferred embodiment, the Neurovita polypeptide of the invention comprises a NVshort peptide and a CPM, preferably a VHH, more preferably VHHNPX, and has a basic isoelectric point (pl), allowing the molecule to cross the Blood Brain Barrier (BBB) and the cell membranes. A protein is said to have a basic pl when the latter is higher than 7, more preferably equal to or higher than 8 and even more preferably equal to or higher than 8.5 or equal to or higher than 9. Accordingly, the Neurovita polypeptide of the invention has preferably a pl equal to or higher than 8, more preferably equal to or higher than 8.5 and even more preferably equal to or higher than 9. Also, the Neurovita polypeptide of the invention has a pl equal to or lower than 11, more preferably equal to or lower than 10.5 and even more preferably equal to or lower than 10, in order to avoid non-specific binding to the target cells non-specifically. Preferred ranges for the pl of the Neurovita polypeptide of the invention are therefore of 8.5-11, 8.5-10, 9-10 and 9-10.5. Fusion proteins [CPM- NVshort]

[0085] In order to be conveyed into the cytoplasm of the cells where it is active, the Neurovita short peptide of the invention is preferably fused to a Cell Penetrating Molecule or to any other delivery system that has been described in the art, e g. to bypass the Blood Brain Barrier (BBB) and convey cargo molecules into target cells.

[0086] This means that the polypeptides of the invention may contain, apart from the NVshort peptide as described above, any peptide or other delivery systems known in the art that may address said peptide toward and inside target cells such as neurons.

[0087] Therefore, in a particular embodiment, the polypeptide of the invention contains the NVshort peptide as described above and a Cell Penetrating Molecule (CPM) that will mediate the vectorization of the NVshort peptide in the cytoplasm of target cells, where MAST1 / MAST2, the target proteins of the interfering peptide NV, are located. The polypeptide may further comprise a homing molecule.

[0088] In a particular embodiment, the polypeptide of the invention comprising the NVshort peptide described herein and a CPM, and optionally a homing molecule, has a basic isoelectric point.

[0089] CPM=VHH

[0090] In a more particular embodiment, the polypeptide of the invention contains the NVshort peptide as described above and a camelid VHH antibody heavy chain as CPM.

[0091] A VHH antibody (also called camelid single domain antibody, single domain VHH antibody, VHH or nanobodies®) is an antibody that comprises the variable domain of a camelid antibody that contains two heavy chains and lacks the two light chains usually found in antibodies. The VHH is an antibody with three complementarity determining regions (CDR). The VHH has the following structure from N-terminus to C-terminus: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, where FR1 to FR4 refer to framework regions 1 to 4, respectively, and where CDR1 to CDR3 refer to complementarity determining region 1 to 3.

[0092] The heavy chain polypeptide of a VHH Alpaca antibody (native VHH A12, cf. Li T, Vandesquille M, Bay S, Dhenain M, Delatour B, Lafaye P. Selection of similar single domain antibodies from two immune VHH libraries obtained from two alpacas by using different selection methods. Immunol Lett. 2017 188:89-95) has been isolated from an immunized alpaca phage display. It has a basic pl of 9.78, that is important to convey the peptide cargoes across the cell membrane and the BBB.

[0093] The full sequence of the VHH is provided in WO2016 / 038122 and is put forth herein as SEQ ID NO:20. Its native CDRs (Complementary Determining Regions) are SEQ ID NO: 13, 14 and 15 for CDRl-3 respectively:

[0094] VHH CDR1 : IDVINNMA (SEO ID NO: 13)

[0095] VHH CDR2: TITSGFSTNY (SEQ ID NO: 14)

[0096] VHH CDR3: = KVHLIRLGAARAYDY (SEO ID NO: 15)

[0097] The polypeptide of the invention is preferably a fusion protein comprising or consisting of the polypeptide of sequence RIISSWEVHGQQTRL (SEQ ID NOV) and a VHH CPM.

[0098] An optimized, VHH, VHHNPX, is especially advantageous for the purposes of the present invention. In particular, VHHNPX when fused to the NVshort polypeptide allows the fusion protein i) to be correctly folded, ii) to be produced in eukaryotic and prokaryotic cells, iii) to remain soluble in contact with physiological fluids, iv) to cross the cell membrane, and v) to deliver NVshort into the cytoplasm where it can reactivate intrinsic neuron survival and axon regeneration pathways by disrupting critical complexes formed between the PDZ of MAST2 / 1 kinases and their ligands.

[0099] In addition to safety considerations, the recognition by the VHH antibody A12 of an (unidentified) antigen could decrease the efficacy of the molecular cargo and therefore lower its therapeutic activity. Because the nature of protein / epitope recognized by the VHH chain has not been identified (see Li et al, 2017), the inventors decided to inactivate antibody function of the VHH by changing several amino acids in the CDR3 domain. In a preferred embodiment, the inventors therefore propose to use VHH chain in which the sequence of the CDR3 has been mutated to inactivate any remaining antibody function of VHH and thereby avoid all unwanted cross reaction or off-target side effects once administered in vivo.

[0100] For example, it is possible to use a VHH in which the CDR3 sequence contains more than two mutated amino acids as compared with SEQ ID NO: 15. The inventors tested five different variants of CDR3 for which the antigen recognition was abolished. Among these five variants, the best production of VHHNPx-NVshort was obtained when the VHHNPX comprises CDR3.4 (SEQ ID NO: 16).

[0101] Thus, the inventors propose to bind the NVshort peptide of the invention with a VHH chain in which the sequence of the CDR3 is mutated into KVHLG'G'G'GAAG'AG'GY (SEQ ID NO: 16), or any variant thereof displaying at least 90% similarity with SEQ ID NO: 16 and containing more than two mismatches as compared with SEQ ID NO: 15.

[0102] In a particular embodiment, the VHH chain used in the Neurovita polypeptide of the invention is the mutated VHH displaying the sequence SEQ ID NO: 17:

[0103] EVOLQASGGGLAQPGGSLRLSVTVSGSIDVINNMAWYRQAPGNARELVATITSGFST NYASSVKGRFTISRDNAKKAVYLQMNSLKPEDTADYYSKVHLGGGGAAGAGGYW GQGTQVTVS

[0104] The present inventors also propose to mutate the sequence of the VHH chain so as to promote intrachain disulfide bridge formation, in order to ensure proper folding of the polypeptide during its production and no precipitation when it is in contact with physiological fluids such as vitreous humor. The insertion of an intramolecular disulfide bridge in the VHH sequence solves the solubility problems. The inventors observed that, when disulfide-bond forming cysteines are added in the sequence of the VHH antibody, the fusion protein containing the modified VHH sequence folds properly and, upon contact with the vitreous humor, does not precipitate any more (figure 5). Insertion of an intramolecular disulfide bridge in the VHH leads to a fusion protein that does not precipitate during its production process and can therefore be produced with high yields, and that does not form aggregates in vitreous humor (figure 5).

[0105] Thus, in another embodiment, the VHH chain used in the polypeptides of the invention contains at least two disulfide-bond forming cysteines. More particularly, these disulfide-bond forming cysteines can be located in position 22 and 96, as reflected in SEQ ID NO: 18.

[0106] In other terms, the VHH chain used in the polypeptides of the invention is preferably mutated to contain at least one disulfide bond to ensure proper folding and a CDR3 containing three or more mutations as compared with SEQ ID NO: 15, to inactivate the antibody function of said VHH camelid antibody. In a preferred embodiment, the VHH chain used in the polypeptides of the invention contains at least two disulfide-bond forming cysteines and a mutated CDR3 sequence as described above. In this particular embodiment, VHHNPX has for example the SEQ ID NO: 19. The present disclosure also provides a variant of VHH-NPX, wherein the variant has a sequence displaying at least 90% similarity with SEQ ID NO: 19, the variant has the same pl as the VHH-NPX of SEQ ID NO:20 or of SEQ ID NO: 19, preferably of sequence SEQ ID NO: 19, and the variant comprises i) the CDRs of SEQ ID NO: 13, SEQ ID NO: 14 and SEQ ID NO: 16 as CDR1-3 respectively, and ii) at least one disulfide-bridge formed by two cysteines.

[0107] Said VHHNPX variant has preferably a basic pl comprised between 8.5-11, 8.5-10, 9-10 and 9- 10.5.

[0108] In this case, the Neurovita polypeptide of the invention can have the sequence displayed in SEQ ID NO:28 (also herein called NPX461).

[0109] CPM = L-TAT

[0110] In the context of the invention, it is also possible to associate the NVshort peptide as described above to the CPM called “L-TAT”, which is known to be the levogyre form (L) of the protein transduction domain of the HIV-1 derived trans-activator of transcription. This CPM has the sequence GRKKRRQRRR (SEQ ID NO:25) and is different to the typical YGRKKRRQRRR (SEQ ID NO:24) of the prior art in that it lacks the N-terminal Y amino acid residue (see EP1811033). Unlike the native L-TAT CPM of SEQ ID NO: 24, the L-TAT of SEQ ID NO: 25 does not address the molecular cargo to the cell nucleus.

[0111] The NVshort peptide of the invention can also be associated to a variant of SEQ ID NO:25, whose sequence displays at least 90% similarity with SEQ ID NO:25.

[0112] The L-TAT CPM used in the polypeptide of the invention has therefore preferably a sequence displaying at least 90% homology or similarity with SEQ ID NO:25. It is preferably the L-TAT of SEQ ID NO:25.

[0113] The sequence of the polypeptide of the invention can be for example as displayed on SEQ ID NO:26.

[0114] It is also possible to combine NVshort with a RDP (e.g., mutated as described below) acting as a homing molecule, and with a L-TAT CPM (e.g., mutated as described above) to target nAChR- expressing cells and to enter in these cells in the endocytic / lysosomal pathway by means of L- TAT.

[0115] Association with homing molecules

[0116] Optionally, the Neurovita polypeptide of the invention can also contain a homing molecule that will make the polypeptide of the invention (containing NVshort and optionally the CPM) cross the Blood Brain Barrier and / or target or address this polypeptide toward cells of interest.

[0117] As used herein, a “homing molecule” is a molecule which is capable of addressing a cargo to a specific organ. Homing molecules are known in the art (see e.g., Yu H. et al, Drug Delivery 2020, Vol.27, N°l, 1425-1437). Anumber of other delivery systems have been described in the art (Milletti F. Cell-penetrating peptides: classes, origin, and current landscape. Drug Discov Today. 2012 Aug;17(15-16):850-60; Zhao et al, Cell 181, 2020).

[0118] In another particular embodiment, the homing molecule is the Rabies virus Derived Peptide (RDP). According to this specific embodiment, the polypeptide of the invention contains the NVshort peptide as described above and RDP.

[0119] RDP is the Rabies virus Derived Peptide derived from the G protein of the CVS-NIV sequence It is able to carry molecular cargo into neuronal cells and increase the specificity of peptides toward nAChR expressing cells only (see WO2016 / 038122 when the cargo is the long Neurovita peptide).

[0120] Any RDP sequences can be used in this respect, in particular those recited page 43 of WO2016 / 038122 (see the SEQ ID NO:1, SEQ ID NO:32, SEQ ID NO:33 and SEQ ID NO:34 of WO2016 / 038122). A particular sequence is for example given as SEQ ID NO:21 in the enclosed sequence listing.

[0121] Preferably, the RDP sequence comprises a mutation compared to SEQ ID NO:21. More preferably, this mutation is a substitution, e.g., by a serine, of the cysteine residue at position 15 of the sequence of SEQ ID NO:21. Indeed, this substitution prevents the aggregation of a Neurovita peptide-containing fusion protein (figure 3B). Therefore, it is particularly advantageous to associate the Neurovita peptide of the invention with a mutated RDP, as described herein in order to avoid the protein aggregation induced by the domain and therefore to enhance the production yield and the biological activity of the Neurovita peptide. This is surprising because it was thought so far that the cysteine in neuron cell -targeting peptides derived from a Rabies virus G protein was required to maintain its biological activity (Lentz et al., 1984,1987 and 1989). Therefore, all the RDPs carrying Neurovita polypeptides in the past contained a cysteine residue (see in particular SEQ ID NO: 1, SEQ ID NO:32, SEQ ID NO:33 and SEQ ID NO:34 of WO2016 / 038122).

[0122] In a preferred embodiment, the Neurovita short peptide of the invention is therefore fused to a RDP sequence that does not contain any cysteine residue, nor any amino acid that may create unwanted disulfide bridge(s). For example, the cysteine residue contained in the sequence of said RDP can be replaced by a serine residue.

[0123] The RDP used in the polypeptide of the invention has thus preferably a sequence displaying at least 90% similarity with SEQ ID NO:21, and in which the only cysteine amino acid has been substituted by another amino acid. Of note, this homologous or similar sequence of RDP should be chosen so that the resulting peptide retains the loop structure of SEQ ID NO:21, in order to favor anchoring to nAChR receptors at the surface of target cells.

[0124] In a more preferred embodiment, the mutated RDP used in the polypeptides of the invention has the sequence YTIWMPENPRLGMSSDIFTNSRGKRASKG (SEQ ID NO:22) or a variant thereof displaying at least 90%, preferably at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% similarity with SEQ ID NO:22, but not containing any cysteine residue. Of note, this variant sequence should be chosen so that the resulting peptide retains the loop structure of SEQ ID NO:22, in order to favor anchoring to nAChR receptors at the surface of target cells.

[0125] Said RDP variant has preferably a basic pl comprised between 8.5-11, 8.5-10, 9-10, 9-10.5, and 10-11.

[0126] The sequence of the polypeptide of the invention can be for example as displayed on SEQ ID NO:23 (RDP-AAA- NVshort).

[0127] In another aspect, the present invention also relates to the mutated RDP of SEQ ID NO:22 or a variant thereof displaying at least 90%, preferably at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% similarity with SEQ ID NO:22, but not containing any cysteine residue, on its own. It is nevertheless possible to combine NVshort with a RDP (e.g., mutated as described above) acting as a homing molecule and with a VHH CPM (e.g., mutated as described above) to target nAChR-expressing cells and to enter in these cells in non-endocytic / lysosomal pathway by means of the VHHNPX.

[0128] It is also possible to combine NVshort with a RDP (e.g., mutated as described above) acting as a homing molecule with a L-TAT CPM (e.g., mutated as described above) to target nAChR- expressing cells and to enter in these cells in the endocytic / lysosomal pathway by means of L- TAT.

[0129] To conclude, the polypeptide of the invention can contain the NVshort peptide as described above and a CPM such as: VHHNPX, SEQ ID NO: 19 or L-TAT SEQ ID NO:25, (as exemplified in figure 6) or any variant thereof disclosed above. The polypeptide of the invention can also contain more than one CPM / homing molecule, for example a combination of RDP and VHH or of RDP and L-TAT, as disclosed above.

[0130] Linkers

[0131] In case a CPM is included in the polypeptide of the invention, or in case two or more CPM / homing molecule are used, said CPM / CAM (s) and the NVshort peptide are preferably separated with a linker.

[0132] Advantageously, linkers are used between the NVshort peptide of the invention and the CPM / homing molecule associated thereto. Accordingly, the last N-terminal residue of the NVshort peptide can be linked by a peptide bond to the first C-terminal residue of a peptide linker, the last N-terminal residue of which being linked to the first C-terminal residue of the CPM / homing molecule. In this particular embodiment, a peptide linker consisting of one to ten amino acids, preferably of one to five amino acids, more preferably of one to three amino acids can be added between the CPM / homing molecule and the NVshort peptide, or between the two CPM / homing molecule. In a most preferred embodiment, the linker has the three amino acid sequence “AAA”.

[0133] Polynucleotides of the invention

[0134] In another aspect, the present invention also targets the polynucleotides encoding the peptides, polypeptides and fusion proteins disclosed above. These polynucleotides are preferably integrated in vectors, in particular in expression vectors. The term "vector", as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors"). In general, expression vectors of utility in recombinant DNA techniques are in the form of plasmids. In the present specification, "plasmid" and "vector" may be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such forms of expression vectors, such as bacterial plasmids, YACs, cosmids, retrovirus, EBV-derived episomes, and all the other vectors that the skilled man will know to be convenient for ensuring the expression of the peptides, polypeptides and fusion proteins of the invention.

[0135] Selection of an appropriate vector will depend mainly on the size of the nucleic acids to be inserted into the vector and the particular host cell to be transformed with the vector. Each vector contains various components, depending on its function (e.g., expression of heterologous polynucleotide) and its compatibility with the particular host cell in which it resides. The vector components generally include but are not limited to: an origin of replication, a selection marker gene, a promoter, a ribosome binding site (RBS), a signal sequence, the heterologous nucleic acid insert and a transcription termination sequence. Said vectors or cassettes of the invention preferably contain regulatory sequences allowing the expression of the polypeptides of the invention in a host cell, preferably in a bacterial host cell, e g., a Escherichia coli bacterium. These regulatory sequences are for example a promoter, which is inducible or constitutive. Promoters suitable for use with prokaryotic hosts include E. coli promoters such as lac, trp, tac, trc and ara, viral promoters recognized by E. coli such as lambda and T5 promoters, and the T7 and TTlac promoters derived from T7 bacteriophage.

[0136] In another aspect, the invention provides vectors comprising polynucleotides of the invention encoding the peptides, polypeptides and fusion proteins of the invention. In order to express them, these vectors are “expression vectors”, in which the sequences encoding the peptides, polypeptides and fusion proteins of the invention are operatively linked to transcriptional and translational sequences. These vectors may remain free (i.e., non-integrated into a host cell genome), or may become integrated ("stably” or “temporary” incorporated) into the host cell genome, either as a result of the original transformation of the host cells, or as the result of subsequent recombination and / or repair events. Still, they remain “heterologous” as compared to the host cell and its natural genome. As used therein, the term “operably linked" sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.

[0137] The invention therefore relates to a vector, preferably a viral vector, DNA, or mRNA, encoding the Neurovita polypeptide or the Neurovita short peptide of the invention, as defined above.

[0138] Pharmaceutical compositions

[0139] As shown in the examples below, the polypeptide of the invention NVshort once it has been fused to VHHNPX, is soluble in vitreous humor, non-aggregated, able to enter cell, be localized in the cytoplasm where it can bind and block with high affinity the PDZ domain of the human MAST1 / MAST2 enzymes in cells.

[0140] In another aspect, the invention relates to a pharmaceutical composition comprising the Neurovita polypeptides, including the fusion proteins, of the invention, or the polynucleotides encoding same, which are as disclosed above, and a pharmaceutically acceptable carrier. These pharmaceutical compositions comprising the Neurovita polypeptides of the invention, including the fusion proteins of the invention, or the polynucleotides encoding same, are hereafter called “pharmaceutical compositions of the invention”.

[0141] In these pharmaceutical compositions, the Neurovita polypeptides, including fusion proteins, of the invention or polynucleotides are preferably formulated in an effective amount. An "effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired result, such as prevention or treatment of the target disease. A “therapeutically effective amount” means an amount sufficient to influence the therapeutic course of said target disease. A therapeutically effective amount is also one in which any toxic or detrimental effects of the agent are outweighed by the therapeutically beneficial effects. As used herein, the term "pharmaceutically acceptable carrier" refers to a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any conventional type. A "pharmaceutically acceptable carrier" is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation; suitable carriers include, but are not limited to, phosphate buffered saline solutions, distilled water, emulsions such as an oil / water emulsions, various types of wetting agents, sterile solutions and the like, dextrose, glycerol, saline, ethanol, and combinations thereof Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like. Carriers for parenteral administration include aqueous solutions of dextrose, mannitol, mannose, sorbitol, saline, pure water, ethanol, glycerol, propylene glycol, peanut oil, sesame oil, polyoxyethylenepolyoxypropylene block polymers, and the like.

[0142] As used herein the term "pharmaceutically acceptable excipient” refers to a substance that is used as a carrier or for the manufacturing of the administrable form of polypeptide(s) of the invention. Suitable excipients include fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize, wheat, rice, or potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and / or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as crosslinked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. Thus, for oral use of the polypeptide(s) of the invention, a solid excipient can be used, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores. Examples of excipients for coating of dragee or tablet are concentrated sugar solutions which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.

[0143] In particular, when the composition of the invention is intended to be administered in the eye (see below), the preferred excipients are those authorized by the FDA for eye injection, namely: Calcium chloride, carboxymethylcellulose sodium, hyaluronate sodium, hydrochloric acid, magnesium chloride, magnesium stearate, microcrystalline cellulose, poly(dl-lactic-co-glycolic acid, poly(dl-lactic-co-glycolic acid, polysorbate 80, polyvinyl alcohol, potassium chloride, sodium acetate, sodium bicarbonate, sodium chloride, sodium hydroxide, sodium phosphate, trisodium citrate dihydrate.

[0144] Therapeutic uses

[0145] The polypeptides of the invention, including the fusion proteins, of the invention (as described above) are characterized by the fact that they are under a functional form, not only in vitro but also in vivo when injected to a subject in need thereof.

[0146] A “subject” in the present invention can be any mammal (human or animal). Preferably, it is a human being.

[0147] By “functional”, it is herein meant that the polypeptides of the invention exhibit a significant biological activity. Said “biological activity” corresponds in this case to the inactivation of the MAST2 / PTEN pathway, by binding with high affinity the PDZ domain of the human MAST2 protein and sterically block the PDZ domain of the human MAST2 protein, especially in neuronal cells.

[0148] Importantly, this significant biological activity is due to the fact that the polypeptides, including fusion proteins, are soluble in the physiological fluids, e.g., in vitreous humor. As a matter of fact, the present results show that, contrary to the VHH-Neurovita peptides of the prior art, the polypeptides, including fusion proteins, of the invention do not aggregate when put in contact with these fluids (figure 5). The polypeptides, including fusion proteins, of the invention are moreover “stably” soluble, as they remain non-aggregated for a long-term in solution.

[0149] In addition, the polypeptides, including fusion proteins, of the invention are designed to target and enter various eukaryotic cells such as neuron cells, due to the CPM they contain. The polypeptides, including fusion proteins, of the invention can therefore be qualified as “cellpenetrating Neurovita peptides”. After intravitreal delivery, they preferably penetrate neuron cells, such as RGCs in the retina.

[0150] It was shown in WO2016 / 038122 that Neurovita peptides fused at the C-terminal extremity of a VHH or VHH-comprising polypeptide are efficiently delivered across the Blood Brain Barrier (BBB), when they display a basic isoelectric point (pl). As explained above, most of the polypeptides, including fusion proteins, of the invention display a basic pl. These polypeptides, including fusion proteins, are therefore able to cross the Blood Brain Barrier (BBB). Accordingly, they should reach the brain after being injected intravenously, intrathecaly or intranasaly.

[0151] The polypeptides, including fusion proteins, of the invention as well as the Neurovita short peptides, of the invention are moreover preferably less immunogenic so as not to be toxic to the treated subject when administered in vivo. As a matter of fact, the short form of the Neurovita peptide and some of the mutations introduced in the CPMs lower the size of the resulting fusion protein at its minimum, and impair the aggregation of the polypeptide, avoiding to trigger any unwanted side effects. Also, their stable solubility in physiological fluids ensure that they will not aggregate in vivo after injection.

[0152] As shown in the examples below, the polypeptides, including fusion proteins, of the invention target retina cells and persist in the mouse eye after injection, where they can promote neurosurvival and / or neuroprotection and allow the repair of neuron cells after an axon injury.

[0153] In one aspect, the invention therefore relates to the NVshort peptides or to the polypeptides, including fusion proteins, of the invention or the polynucleotides encoding same, for their use as a medicament. Also, the invention relates to the pharmaceutical composition of the invention, containing said NVshort peptides or said polypeptides, including fusion proteins, for its use as a medicament.

[0154] In one particular aspect, the present invention targets polypeptides, including fusion proteins, as defined above, or the polynucleotides encoding same, or pharmaceutical compositions comprising same, in order to prevent and / or treat diseases involving the nervous system (central nervous system and / or peripheral nervous system), such as neurodegenerative diseases, muscular dystrophies, or cell damage-associated conditions such as stroke or injury including optic nerve diseases, retina diseases, muscular diseases, motor neuron diseases, or the evolution of such disease or condition. The invention also provides therapeutic methods using the NVshort peptides of the invention, the polypeptides, including fusion proteins, containing same, the polynucleotides encoding same, or pharmaceutical compositions comprising same, for use for preventing and / or treating neurodegenerative diseases or cell damage-associated conditions, preferably affecting the brain. The invention also provides the NVshort peptides of the invention, the polypeptides, including fusion proteins, containing same, the polynucleotides encoding same, or pharmaceutical compositions comprising same, for use in the manufacture of a medicament, especially a medicament for use in the therapy of neurodegenerative diseases or cell damage-associated conditions, preferably affecting the brain or the muscle. This therapy comprises advantageously the intravenous, intravitreal, intranasal injections or any other routes of injection, appropriate for the target disease, of the NVshort peptides of the invention, the polypeptides, including fusion proteins, containing same, the polynucleotides encoding same, or pharmaceutical compositions comprising same, in patients in need thereof.

[0155] In another particular aspect, the present invention targets the use of the NVshort peptides, polypeptides, including fusion proteins, of the invention, the polynucleotides encoding same, or pharmaceutical compositions comprising same, in order to prevent and / or treat diseases involving the nervous system (central or peripheral), such as neurodegenerative diseases, or cell damage-associated conditions such as stroke or injury including optic nerve disease, retina diseases, motor neuron disease, or muscular dystrophies, such as Duchenne disease or the evolution of such disease or condition. The invention also provides therapeutic methods using the NVshort peptides, polypeptides, including fusion proteins, of the invention, the polynucleotides encoding same, or pharmaceutical compositions comprising same, for use for preventing and / or treating neurodegenerative diseases or cell damage-associated conditions, preferably affecting the nervous system or the muscles. The invention also provides the NVshort peptides, polypeptides, including fusion proteins, of the invention, the polynucleotides encoding same, or pharmaceutical compositions comprising same, for use in the manufacture of a medicament, especially a medicament for use in the therapy of neurodegenerative diseases or brain cell damage-associated conditions. This therapy comprises advantageously the most appropriate route of injection (such as intravitreal injection, intrathecal injection, intra- meningeal, intranasal or intravenous injection) of the polypeptides of the invention, the polynucleotides encoding same, or pharmaceutical compositions comprising same, in patients in need thereof.

[0156] The Neurovita peptides of the invention, the polypeptides, including fusion proteins, of the invention, the polynucleotides encoding same, or pharmaceutical compositions comprising same are preferably for use as a neuro-regenerative (regrowth of injured axons, restoration of synapses) and / or neuro-protective agent (protection of neurons and other cells expressing the target molecules MAST2 / MAST1 from apoptosis or decrease of viability).

[0157] The Neurovita peptides of the invention, the polypeptides, including fusion proteins, of the invention, the polynucleotides encoding same, or pharmaceutical compositions comprising same are preferably for use in the treatment and / or palliation and / or prevention of a disease, disorder or condition, which alters the Central Nervous System (CNS) and / or the Peripheral Nervous System (PNS), for example as a preventive therapy and / or palliation. The “Nervous System" as used herein, is composed of the Central Nervous System "CNS" and the Peripheral Nervous System “PNS”. The term CNS is herein intended as meaning the brain, and the two first cranial nerves: the olfactory and optic nerves, and the spinal cord. The PNS is the vast network of spinal and the 10 cranial nerves linking the body to the brain and spinal cord. The PNS is subdivided into the autonomic nervous system (sympathetic NS and parasympathetic NS) and the somatic nervous system. The PNS consists of sensory neurons running from stimulus receptors to the CNS and motor neurons running from the CNS to the muscle and glands.

[0158] According to an embodiment of the invention, said disease or disorder is or involves a neurodegenerative disease or disorder (for example, a chronic neurodegenerative disease or disorder), such as Alzheimer's disease, Parkinson's disease, ALS, Huntington disease, multiple sclerosis (MS) or rare genetic disease. According to an embodiment of the invention, said condition is or involves a neurodegenerative condition, such as aging. According to an embodiment of the invention, said disease or condition involving the CNS or the CNS is an optic neuropathy (e.g. glaucoma, NAION).

[0159] According to an embodiment of the invention, said disease, disorder or condition is or involves a physical or ischemic injury of the nervous system, such as seizure, stroke, trauma, epilepsy.

[0160] According to an embodiment of the invention, said disease, disorder or condition involves the presence of a chemical neurotoxic agent and / or of an oxidative stress.

[0161] Host cells of the invention

[0162] For the VHH-NV proteins which large size exclude their production by chemical synthesis, the polynucleotides of the invention and vectors comprising same are used in vitro for the transformation of suitable host cells which are also encompassed by the present invention. The term "host cell", as used herein, is intended to refer to a cell into which a recombinant expression vector has been introduced to express the peptides or polypeptides including fusion proteins, of the invention.

[0163] The invention therefore also relates to host cells, in particular eukaryotic and prokaryotic cells, containing the vector of the invention or the polynucleotides disclosed above. These cells are used to produce the peptides or polypeptides, including fusion proteins, of the invention. Among the host cells which can be used in this respect, mention may of course be made of microbial cells, but also yeast cells, as well as animal cells, in particular mammalian cells, and insect cells.

[0164] Preferably, said host cell is a prokaryote, for example, E. coli, or a eukaryote, for example, a single-cell eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell). Examples of host cells include the COS-7 line of monkey kidney cells (ATCC CRL 1651), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media or CHO strain DX-B11, which is deficient in DHFR, HeLa cells, BHK (ATCC CRL 10) cell lines, the CVl / EBNAcell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70), human embryonic kidney cells such as 293, 293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL- 60, U937, HaK or Jurkat cells. Typically, a host cell is a cultured cell that can be transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.

[0165] These host cells have been transfected or transformed with the polynucleotides encoding the sequences of the peptides or polypeptides, including fusion proteins, of the invention, so as to eventually express them at high yield.

[0166] Transformation can be performed by any known method for introducing polynucleotides into a host cell. Such methods are well known of the man skilled in the art and include dextran- mediated transformation, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide into liposomes, biolistic injection and direct microinjection of DNAinto nuclei.

[0167] For long-term, high-yield production of recombinant peptides or polypeptides, including fusion proteins, stable expression is preferred. In one embodiment of the invention, cell lines which stably express the peptides or polypeptides, including fusion proteins, of the invention may be engineered. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with DNA under the control of the appropriate expression regulatory elements, including promoters, enhancers, transcription terminators, polyadenylation sites, and other appropriate sequences known to the person skilled in art, and a selectable marker. Following the introduction of the foreign DNA, engineered cells may be allowed to grow for one to two days in an enriched media, and then are moved to a selective media. The selectable marker on the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into a chromosome and be expanded into a cell line. Other methods for constructing stable cell lines are known in the art. In particular, methods for site-specific integration have been developed. According to these methods, the transformed DNA under the control of the appropriate expression regulatory elements, including promoters, enhancers, transcription terminators, polyadenylation sites, and other appropriate sequences is integrated in the host cell genome at a specific target site which has previously been cleaved (US 5,792,632; US 5,830,729; US 6,238,924; WO 2009 / 054985; WO 03 / 025183; WO 2004 / 067753). A number of selection systems may be used, including but not limited to the Herpes simplex virus thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase, glutamate synthase selection in the presence of methionine sulfoximide and adenine phosphoribosyltransferase genes in tk, hgprt or aprt cells, respectively. Also, antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate; gpt, which confers resistance to mycophenolic acid; neo, which confers resistance to the aminoglycoside, G-418; and hygro, which confers resistance to hygromycin. Methods known in the art of recombinant DNA technology may be routinely applied to select the desired recombinant clone, and such methods are described, for example, in Ausubel et al., eds., Current Protocols in Molecular Biology, John Wiley & Sons (2003). The expression levels of the peptides or polypeptides, including fusion proteins, of the invention can be increased by vector amplification. When a marker in the vector system is amplifiable, an increase in the level of inhibitor present in the culture will increase the number of copies of the marker gene. Since the amplified region is associated with the sequence encoding the peptide or polypeptide, including fusion protein, of the invention, production of said peptide or polypeptide, including fusion protein, will also increase. Alternative methods of expressing the polynucleotide of the invention exist and are known to the person of skills in the art. For example, a modified zinc finger protein can be engineered that is capable of binding the expression regulatory elements upstream of the nucleic sequence of the invention; expression of the said engineered zinc finger protein (ZFN) in the host cell of the invention leads to increases in peptide or polypeptide, including fusion protein, production. Moreover, ZFN can stimulate the integration of a DNA into a predetermined genomic location, resulting in high- efficiency site-specific gene addition.

[0168] Methods for introducing vectors into host cells are well known to the ordinarily skilled artisan. The host cells are first transformed or transfected with expression vectors or cassettes as those described above, by conventional means (e.g., electroporation). Then peptide or polypeptide, including fusion protein, production is induced by culturing the cells in conventional nutrient media that has been chosen or modified so as to induce promoters, select and / or maintain transformants, and / or express the nucleic sequences encoding the desired peptide or polypeptide, including fusion protein, sequences. The culture conditions, such as media, temperature, pH and the like, can be selected by the skilled artisan without undue experimentation. In general, principles, protocols, and practical techniques for maximizing the productivity of cell cultures can be found in Mammalian Cell Biotechnology: A Practical Approach, M. Butler, ed. (IRL Press, 19 1) and Molecular Cloning: A Laboratory Manual (Michael R. Green and Joseph Sambrook, 2012, Cold Spring Harbor Laboratory Press).

[0169] Particular transfer methods, such as phages, plasmids, and transposons, can be used to deliver and circulate engineered DNA sequences to microbial communities, via processes such as transduction, transformation, and conjugation. An engineered phage could be one possible delivery system for a polypeptide of the invention, by incorporating the nucleic acid encoding said polypeptide into the phage and utilizing the phage to deliver the nucleic acid to a host microbe that would then produce the polypeptide after having the phage deliver the nucleic acid into its genome.

[0170] One could also utilize a transposon delivery system to incorporate nucleic acids encoding a therapeutic polypeptide into a host microbe that is resident in a patient's microbiome (Sheth, et al., Trends in Genetics, 2016, Vol. 32, Issue 4, pgs, 189-200). In this case, the host cell of the invention is therefore a bacterium that is part of the microbiome.

[0171] Production method of the invention

[0172] The peptides or polypeptides, including fusion proteins, of the invention may be prepared by growing a culture of the transformed host cells under culture conditions necessary to express the desired peptides or polypeptides, including fusion proteins. The resulting expressed peptides or polypeptides, including fusion proteins, may then be purified from the culture medium or cell extracts. Soluble forms of the peptides or polypeptides, including fusion proteins, of the invention can be recovered from cell lysates or from the culture supernatant. In a further aspect, the present invention also targets a method for producing the Neurovita peptide or the polypeptides, including fusion proteins, of the invention.

[0173] The method of the invention is thus characterized in that it comprises the following steps: a) growing a host cell of the invention containing a vector encoding the polypeptides, including fusion proteins, or the Neurovita peptide of the invention in an appropriate culture medium and b) recovering or purifying said polypeptide, including fusion protein, or peptide.

[0174] Processes for recovering or purifying the polypeptide, including fusion protein, or peptide of the invention are known to those skilled in the art. For example, said recombinant polypeptide or peptide can be purified from cell lysates, cell extracts and / or from the culture medium supernatant, with methods such as fractionation, chromatography methods, with immunoaffinity techniques using specific monoclonal or polyclonal antibodies, centrifugation, differential solubility or by any other standard technique for the purification of proteins or peptides. Suitable methods of purification will be apparent to a person of ordinary skills in the art.

[0175] Some purification technologies are not recommended by Regulatory Safety agencies (e.g., those relying on nickel chromatography columns), so that it is herein preferred to use alternative techniques that do not use any toxic material. Also, it is preferred to avoid purification methods implying to add His Tag to the produced peptide or polypeptide, as this tag may increase the immunogenicity of the peptide or polypeptide. For these reasons, it is preferred to use for example a Ion Exchange column (IEX) purification technique (Boysen RI et al, Current protocols in Molecular Biology, 2001), which avoids using His-Tag and is authorized by the Regulatory Safety Agencies.

[0176] The present inventors have shown that using IEX purification technique enables to obtain adequate yields of the polypeptides of the invention (the downstream yield was in the range of 25mg of the proteins of interest per Liter of bacterial culture). Implementation of IEX facilitates the downstream purification steps and improve the acceptability of the CMC protocol by the Regulatory Safety Agencies.

[0177] Of note, the polypeptides, including fusion proteins, in particular when the CPM is TAT, and Neurovita peptides of the invention can also be obtained by chemical synthesis, by using any one of the many known synthesis processes, for example those involving partial solid phases, condensation of fragments or conventional synthesis in solution.

[0178] Definitions

[0179] The isoelectric point (pl) of a protein is defined as the pH at which the protein carries no net charge (i.e. the negative charges compensate the positive charges). Methods to determine the pl of a protein, either through experimental determination or through theoretical calculation based on the sequence of the protein, are known to the skilled person. In particular, the pl can be measured experimentally using isoelectric focusing. Alternatively, or in addition, the pl may be calculated using a computer program such as the EMBOSS iep software, available from the European Bioinformatics Institute, Genome Campus, Hinxton, Cambridge CB10 1SD, UK and / or the Compute PI tool from the Expasy software, available from the Swiss Institute of Bioinformatics, Quartier Sorge - Batiment Genopode, 1015 Lausanne, Switzerland.

[0180] A protein is said to have a basic pl when the latter is higher than 7, more preferably equal to or higher than 8 and even more preferably equal to or higher than 8.5 or equal to or higher than 9. Since the pl of a fusion protein (e g. the VHH-Neurovita peptide of the invention, including other CPMs, if any) is relevant to the permeability of the entire construct across the BBB, the pl is to be assessed (measured and / or calculated) for each construct.

[0181] The invention provides peptides, polypeptides or proteins whose amino acid sequences are or contains sequences that are “similar” or “substantially similar” to the reference sequences described herein. “Similarity” of two targeted amino acid sequences can be determined by calculating a similarity score for the two amino acid sequences. As used herein, the “similarity score” refers to the score generated for the two sequences using the BLOSUM62 amino acid substitution matrix, a gap existence penalty of 11, and a gap extension penalty of 1, when the two sequences are optimally aligned. Two amino acid sequences are substantially similar if their similarity score exceeds a certain threshold value. The threshold value can be any integer ranging from at least 1190 to the highest possible score for a particular reference sequence. For example, the threshold similarity score can be 1190, 1200, 1210, 1220, 1230, 1240, 1250, 1260, 1270, 1280, 1290, 1300, 1310, 1320, 1330, 1340, 1350, 1360, 1370, 1380, 1390, 1400, 1410, 1420, 1430, 1440, 1450, 1460, 1470, 1480, 1490, 1500, or higher. If in a particular embodiment of the invention, the threshold score is set at, for example, 1300, and the reference sequence is any of those described herein, then any amino acid sequence that can be optimally aligned with any of those described herein to generate a similarity score of greater than 1300 is be held as “similar” to those described herein. Amino acid substitution matrices and their use in quantifying the similarity between two sequences are well-known in the art and described, e.g., in Dayhoff et al. (Dayhoff M.O., Schwartz R.M., Orcutt B.C. A model of evolutionary change in proteins. In: Dayhoff M.O., editor, vol. 5. Nat. Biomed. Res. Found; Washington. DC: 1978. pp. 345-352. (Atlas of Protein Sequence and Structure), suppl. 3), and in Henikoff et al. (Henikoff S, Henikoff JG. Amino acid substitution matrices. Adv Protein Chem. 2000;54:73- 97.). To generate accurate similarity scores using NCBI BLAST, it is important to turn off any filtering, e.g., low complexity filtering, and to disable the use of composition-based statistics. One should also confirm that the correct substitution matrix and gap penalties are used.

[0182] A “similar” sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a modified polypeptide with no substantial change in physiological, chemical, or functional properties compared to the reference sequence; in such a case, the reference and modified sequences would be considered to be "similar" polypeptides. Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; in one non-limiting example, the conservative amino acid mutation is a conservative amino acid substitution. A conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity). A conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group. By the term "basic amino acid" it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH. Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K). By the term "neutral amino acid" (also "polar amino acid"), it is meant hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms. Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gin or Q). The term "hydrophobic amino acid" (also "non-polar amino acid") is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (He or I), phenylalanine (Phe or F), valine (Vai or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G). "Acidic amino acid" refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).

[0183] EXAMPLES

[0184] I. Material and methods

[0185] Production of VHHNPx-NVshort, VHHxpx-NVIong, L-TAT-NVshort, RDPc-NVshort (ML49C), RDPs-NVshort (ML49S) and RDPc-NVshort APBM (MG49c).

[0186] The construct HIS-Sumo- VHHxpx-NVshort, allowing the production of NPX461 (soluble VHH-NVshort, in which the disulfide bridge was restored and the native CDR3 was replaced by CDR3.4 sequence), was produced in T7 Shuffle Express E. coli. strain. After bacteria lysis and centrifugation, the soluble fraction was purified on affinity chromatography on nickel resin. Cleavage of HIS-Sumo tag was obtained with ULP1 protease at 1 : 10 protease / POI (W / v) ratio. Separation of Sumo tag was obtained by loading the digestion mixture on HIS Trap HP columns in the presence of imidazole in PBS buffer, pH 7.4. Then, Size Exclusion Chromatography (SEC) was performed and the collected fractions were pooled and concentrated by Vivaspin concentrators and dialysed in PBS buffer pH 7.5 (137mM NaCl, 2.7mM KCL, 8mM Na2HPC>4, 2mM KH2PO4). Identical protocol was followed for the production and purification of construct HIS-Sumo- VHHNpx-NVlong (NPX452).

[0187] Alternatively, VHHNPx-NVshort was produced in A. coli. BL21XT7 with a signal peptide PelB to facilitate production in the periplasm. Purification of the production was performed on Amsphere A3 Protein A resin (ISR Light science). Endotoxins were captured on Ion exchange resin (Capto S, Cytiva) and Toxin Eraser resin (Genscript). The product was concentrated using a Vivaspin device and dialysed in PBS buffer pH 7.5 (137mM NaCl, 2.7mM KCL, 8mM Na2HPO4, 2mM KH2PO4). Alternatively, VHHNPx-NVshort was produced in Chinese Hamster Ovarian (CHO) cells by QMCF Technology. Cell culture supernatant was purified by Protein A affinity chromatography with Am sphere A3 column, and HPLC-SEC analysis.

[0188] L-TAT-NVshort, RDPc-NVshort, RDPs-NVshort and RDPc-NVshort APBM were chemically synthesized (96-98% pure) in Acetonitrile (ACN / H20=l / 3) Quality control was performed with MS and HPLC. Lyophilized peptides were suspended either in PBS pH 7.5 for LTAT-NV or MES Buffer pH 6 (20mM, pH6 300mM NaCl), 7.5% DMSO for the RDP-NVshort peptides.

[0189] Western blot analysis after gel electrophoresis detection in semi-native or native conditions (Figure 3A).

[0190] For the semi-native condition, peptides were diluted in NuPAGE LDS buffer (Thermo Fisher Scientific France NP0007) without denaturation. They were not heated. Protein samples (15 pg / pl) were loaded onto NuPAGE Novex 4-12% Bis-Tris gels (Thermo Fisher Scientific France #NP0341) and subjected to electrophoresis in MOPS SDS running buffer (Thermo Fisher Scientific France NP0001). For the native condition, the NativePAGE™ Bis-Tris gel system (Thermo Fisher Scientific France #BN1002BOX) was used. This system contains Coomassie G-250 which confers a net negative charge while maintaining the peptide molecules in their native state without protein denaturation.

[0191] The protein bands were blotted onto PVDF Immobilon-FL membranes (Millipore France #IPFL00010). Membranes were blocked with 4% non-fat dry milk in PBST buffer (PBS with 0.1% Tween 20) and incubated overnight at 4°C with the primary antibody in blocking buffer containing 0.1% Tween 20 (SIGMA USA P1379). The primary antibody was an anti-RABV G-cyto domain guinea pig antibody (SYC022, 1 / 10 000 a custom antibody produced by Eurogentec). The membrane was washed with 0.1% Tween 20 in PBS and the antigen / antibody complex was detected with a horseradish peroxidase (HRP)-conjugated secondary antibody, an HRP-conjugated anti-GuineaPig IgG antibody (Novex, USA, A18775, 1 / 10000). Membranes were washed with PBST and visualized with the ECL western blot kit (Thermo Fisher Scientific France #35055). Gels were imaged at different exposure times with a G-Box (SYNGENE USA).

[0192] In vitro detection of aggregates upon contact with rabbit vitreous humor (Figure 3B and Figure 5) An in vitro test performed on 384 well plates was set up to test the solubility of compounds upon contact with rabbit vitreous humor. Solubilization of CPM-NV diluted in vehicle. The vehicle was either 60nM MES buffer 300mM NaCl pH6, 7.5% DMSO for RDPc-NV, RDPs- NV or LTAT-NV assay, or DPBS, pH 7.5 for assay with VVH-NV with or without disulfide bridge. Each compound (2pl) or vehicle (2pl) were added to 5 pl of rabbit vitreous. After Ih incubation at 37°c, presence of aggregates was detected with the camera of the DLS (Dynamic Light scattering) station.

[0193] In vitro assay of neurite elongation in neuroscreen cells (Figure 4)

[0194] Neuroscreen cells (NS), a subclone of rat PC12 neuronal cells, were obtained from Cellomics (USA) and cultured according to the supplier’s instructions. NS cells were grown in nondifferentiating (NDF) medium (RPMI 1640, Thermo Fisher Scientific France #11875093; 5% fetal bovine serum, FBS; 10% horse serum; 1% 200 mM glutamine, Thermo Fisher Scientific France #25030149 and 1% 100 x Pen-Strep, Thermo Fisher Scientific France #15140148). The differentiating (DF) medium had the same composition with the addition of 200 ng / ml of nerve growth factor (NGF; SIGMA USA #N2513). Neurite outgrowth assay was performed as described in Khan et al, JBC 2019. Briefly, NS cells were seed on 24-well plates (CellBind plasticware, Corning USA # 83-3337) containing NDF medium at a density of 40 000 cells per well. They were cultured overnight at 37°C. The medium was then replaced with DF medium, and the cells were incubated for a further 6 h. They were then treated with CPM-Neurovita (three constructs: RKM containing NVlong, RK2M containing NVshort and AAA-RK2M containing NVshort and a linker were tested) at three dilutions (0.055, 0.137 and 0.22 pM) in DF medium for 1 h. Each condition was assayed in triplicates. The cells were washed once with DF medium and incubated in DF medium for 24 h at 37°C. Seventy-two hours post treatment, the NS cells were fixed by incubation with 3% paraformaldehyde (PFA) in Dulbecco’s phosphate-buffered saline (DPBS, Thermo Fisher Scientific France # 14040141) for 20 min at room temperature and treated for 5 min with 0.1% Triton-X-100 and 50% normal goat serum in DPBS. Neuron-specific anti-pill-tubulin antibody (Promega France # G7121), followed with a Donkey anti-Mouse - Alexa fluor 647 (A31571, Thermo Fisher), 1 / 500 and Hoechst 33342 (Thermo Fisher Scientific France #62249) were used to stain the neurite processes and the nuclei, respectively. NS cells (36 fields, mean of 324 cells per field) were imaged with a Leica DM 5000B UV microscope equipped with a DC 300FX camera (x40 or x20 objective). The images were analyzed using ImageJ 1.38X Software (Wayne Rasband, NIH, USA, http : / / rsb . info , nih , gov / ij / ) and its plug-in NeuronJ

[0195] (http: / / www.imagescience.org / meijering / software / neuronj / ). The effects of bias were minimized by performing the experiment blind, with relabeling of the samples. The “neurite bearing cells” were numbered. A "neurite bearing cell" was defined as a cell that has at least one neurite whose length was three and a half times longer than the diameter of its cell body. Results were expressed as % of “neurite bearing cells” among total cells.

[0196] Information on RKM, R2KM and AAARK2M. (constructs used in Figure 4).

[0197] The sequences RKM, R2KM and AAAR2KM described here were used to establish that NViong and NVshort have similar biological function. Gen Bank (Banklt2739873) numbers: RKM OR506748 (SEQ ID NO:33); RK2M OR506749 (SEQ ID NO:34); AAARK2M OR506750 (SEQ ID NO:35).

[0198] The corresponding genes of the three constructs were synthesized chemically (MWG Operon, Germany) and inserted into the pASK-IBA2C plasmid (IB A, BioTAGnology, Germany) under the control of the tetracycline promoter. The ompA signal sequence added by this plasmid allowed the expression of the protein into the periplasmic space of the bacteria. The signal sequence was cleaved during translocation. The recombinant plasmids were used to transform DH5-a E. coll bacteria (Thermo Fisher Scientific, France). Recombinant bacteria were identified by PCR and glycerol stocks were generated. CPM-Neurovita peptides were expressed and purified from the bacterial periplasm as described by Lafaye et al. ( Lafaye P, Achour I, England P, Duyckaerts C, Rougeon F. Single-domain antibodies recognize selectively small oligomeric forms of amyloid beta, prevent Abeta-induced neurotoxicity and inhibit fibril formation. Mol Immunol. 2009 46(4):695-704.). The periplasmic extract was further purified by chromatography on Strep-Tactin®XT columns (IBA, BioTAGnology, Germany). The molecules were stored in 0.25x PBS at -80°C. CPM expression was monitored by western blotting using a mouse high-affinity anti-Strep Tag IgGl mAb, C23.21 followed by a HRP- conjugated anti mouse IgG antibody (GE Health Care # NA 9310, 1 / 10 000. Gels were revealed with ECL (Thermo Fisher Scientific, France) and pictures were taken on a G-Box (SYNGENE USA). Quantification was obtained with running a standard VHH-StrepTag preparation on each gel.

[0199] Imaging of CPM-NV entry in fixed human retina ARPE19 cells (Figure 6) 24h cultures of ARPE19 cells, ATCC CRL-2302 (10 000 cells per well of 16 chambers-Labteck) were treated for 3hours with 7pmol of VHHNPX-NV or with 7pmol of L-TAT-NV or not treated (Control condition, CT). After washes and fixation in 4%PFA, cells were stained with NV- specific antibody (SYCO22, guinea-pig antibody, 1 / 10 000). After washes, slides were treated with secondary antibodies [goat anti-guinea pig IgG-Alexa fluor 555 ( A21435, Invitrogen, 1 / 1000), and donkey anti-mouse IgG-Alexa fluor 488, (#A21202, Invitrogen 1 / 1000)]. Slides were mounted with Fluoromount G containing Dapi. Images were made on a LSM Zeiss confocal microscopy and analyzed with Image J.

[0200] In vivo retina and RGC targeting by VHHNPx-NVshort (NPX461) or VHHNPx-NVlong (NPX452) after an intravitreal injection (Figure 8A).

[0201] CPM-NV (10, 50, 125 or 250 pmol of NPX461 or NPX452 in 1 pl) were injected intravitreally in the eye of C57B6 JR mice. Each dilution was tested in 3 eyes. The 4theye was injected with vehicle (PBS). After 6h, mice were anesthetized with 250 pl of xylazine / ketamine injected in peritoneum. An intra-cardiac perfusion of PBS and then 4% PFA(PBS, 35ml at 12ml / min - 4% PFA, 50ml at 12ml / min) was performed to fix tissues. Mice heads were incubated overnight in 4% PFA at 4°C. Retina were dissected. Flat mount retinae were co-stained with SYCO22, 1 / 500, aNV-specific guinea pig antibody directed against the C-terminal of RABV envelope G protein Cyto domain, and with a rabbit antibody (1 / 250) directed against RBPMS) a specific marker of RGC (#1830, RBPMS Phosphosolutions). The secondary species IgG specific antibodies were the goat anti-Rabbit - Alexa fluor 488 (Al 1070, Thermo Fisher), 1 / 500, and the goat antiGuinea pig - Alexa fluor 555 (A21435, Thermo Fisher), 1 / 500 respectively. Retinae were mounted with Fluoromount G containing Dapi. Images were made on a LSM Zeiss confocal microscopy and analyzed with Image J. Intensity of fluorescence in retina was scored manually (scores 0.5-2). Results were presented as Fluorescence Neurovita Intensity in retina 6 hours post injection. Half-maximal Intensity of fluorescence (IC50) was calculated with Graph Pad.

[0202] In vivo kinetic of detection of VHHNPx-NVshort(NPX461) or VHHNPx-NVlong in mouse retina after an intravitreal injection of CPM-NV (Figure 8B)

[0203] CPM-NVs (250 pmol ofNPX452 or NPX461 in 1 pl) were injected intravitreally in the eye of C57B6JR mice. After 3, 8, 24 or 30h, mice were sacrificed. Each time point was tested in 3 eyes. The 4theye was injected with vehicle (PBS) injection. Mice were anesthetized with 250 pl of xylazine / ketamine injected in peritoneum. An intra-cardiac perfusion of PBS and then 4% PFA (PBS, 35ml at 12ml / min - 4% PFA, 50ml at 12ml / min) was performed to fix tissues. Mice heads were incubated over-night in 4% PFA at 4°C. Retina were dissected. Flat mount retinae were co-stained with SYCO22, 1 / 500, a NV-specific guinea pig antibody directed against the C-terminal of RABVG Cyto domain, and with a rabbit antibody (1 / 250) directed against RBPMS) a specific marker of RGC (1830, RBPMS Phosphosolutions #NB521y), 1 / 250. The secondary species IgG specific antibodies were the goat anti-Rabbit - Alexa fluor 488 (Al 1070, Thermo Fisher), 1 / 500, and the goat anti-Guinea pig - Alexa fluor 555 (A21435, Thermo Fisher), 1 / 500 respectively. Retinae were mounted with Fluoromount G containing Dapi. Images were made on a LSM Zeiss confocal microscopy and analyzed with Image J. Intensity of fluorescence in retina RGCs was scored manually (scores 1-3).

[0204] Ex vivo axon regeneration assay on mouse retina explants (Figure 9).

[0205] Retinae were dissected and cut into square pieces (1 mm2) to form retina explants. The retina explants were set up on coverslip previously coated with poly-lysine and laminin, with the inner RGCs layer facing down. CPM-NV (here 1 500 ng of VHHNPx-NVshort, NPX461) or a cocktail of ciliary Neurotrophic factor, CNTF, Brain derived neurotrophic factor, BDNF and Forskolin, (positive control) were added to explants at day 1. A sham condition consists in addition of vehicle alone (here PBS). Treatment was performed a single treatment at day 1. Numbers of axons that regenerate and grow extensions at distances ranging from 50 pm up to 600 pm from center of the explant were numbered after 7 days of culture. Data from independent experiments were pooled. Normalization was made against the CNTF / BDNF / Forskolin condition. Statistical significance was obtained in Two ways Anova Dunnett assay (Graph pad): *p<0.05, ** p<0.01, ***p<0.001 and ****p<0.0001.

[0206] In vivo neuroprotection and regeneration assay in the experimental mouse model of optic nerve compression (Figure 10)

[0207] The neuroprotective and neuroregenerative properties of NPX461 were studied in a mouse model of optic neuropathy, the optic nerve compression (ONC) model. The right optic nerve was crushed less than Ih before injection of NPX461 (5 6 pg) or BDNF (positive control) by the intravitreal (FVT) route. Negative control corresponds to mock injection or vehicle (PBS) injection. Mice were kept 14 days under regular supervision. At day 14, 2pg of CTB-555 (Cholera Toxin subunit B, Alexa Fluor™ 555 Conjugate, Fisher Scientific 11554267, resuspended at 2pg / pL in DPBS1X Ca2+- / Mg2+-) was injected in the right eye. CTB can penetrate RGCs and be transported in their axons forming the optic nerve, allowing axon regrowth visualization by confocal microscopy. Two days later, (at day 16) mice were terminally anesthetized and intracardiacally perfused with 4% Paraformaldehyde. Eyes were harvested and dissected to isolate the retina and the optic nerves.

[0208] Flat mounted retinae were prepared and immunostained with a rabbit antibody (1 / 250) directed against RBPMS) a specific marker of RGC (1830, RBPMS Phosphosolutions #NB521y), 1 / 250, followed by a goat anti -Rabbit - Alexa fluor 488 (Al 1070, Thermo Fisher), 1 / 500). Pictures of immunostained retinae were taken in the periphery (8 pictures) and the midperiphery (4 pictures) of upper and lower retina using a confocal Cell Voyager 1000 microscope (Yokagawa) and a lOx air objective. The RGC counting was performed using the Trackmate plugin on Fiji. The number of RGC was expressed in RGC / mm2and in percentage as compared to control (non-crushed optic nerve =left retina) respectively in each area (periphery / mid- periphery and upper / lower retina). Three retinae of the left eye served as control. Statistical analysis was performed using Graph Pad Prism version 9. Data were expressed as mean ± SEM. Data were analyzed by a Two-way ANOVA with a Tukey’s multiple comparison post hoc test.

[0209] Optic nerves were mounted on slides for confocal microscopy. The optic nerves highlighted by the CTB-555 were acquired using a confocal Nikon Ti2E microscope and a 20x air objective by tile scanning (from the crush site to the longest axon) and Z-stacking (3pm intervals). A Maximum Intensity Projection was done with the Z-stack images. The optic nerve regeneration was evaluated by three parameters: (1) the length of the longest fiber measured by Fiji; (2) the CTB mean intensity and (3) the number of fibers measured on Icy software (de Chaumont F, Dallongeville S, Chenouard N, Herve N, Pop S, Provoost T, Meas-Yedid V, Pankajakshan P, Lecomte T, Le Montagner Y, Lagache T, Dufour A, Olivo-Marin JC. Icy: an open bioimage informatics platform for extended reproducible research. Nat Methods. 2012 9(7):690-6.). On Icy, 10 rectangles of 100pm were drawn from the crush site. One rectangle is placed before the crush to measure the fluorescence before the crush and another one was placed at the end of the picture to measure the background. The CTB mean intensity was automatically measured by Icy in each rectangle, whereas the number of fibers was manually counted. All statistical analysis was performed using Graph Pad Prism version 9. Data were expressed as mean ± SEM. The length of the longest fiber was expressed in pm, data were analyzed by an ordinary Oneway ANOVA with a Tukey’s multiple comparison post hoc test The CTB mean intensity in each ROI (100pm) was normalized to the background and the fluorescence intensity before the crush and was expressed in percentage of maximum CTB intensity. Data were analyzed by a Two-way ANOVA with a Tukey’s multiple comparison post hoc test. The number of fibers was analyzed by a Two-way ANOVA with a Tukey’s multiple comparison post hoc test.

[0210] II. Results

[0211] 2.1 Alteration of RDP sequence to improve yield of CPM-NV production and pharmacological properties.

[0212] A fusion protein comprising NVshort, VHH, and RDP was constructed. However, production of this polypeptide in bacterial cells was very inefficient, as the polypeptide was observed to aggregate.

[0213] A better production can be obtained when the VHH-NV constructs lacks RDP (see Figure 2, comparison on SDS PAGE stained with 2,2,2-Trichloroethanol (TCE) of RDP-VHH-NV and VHH-NV productions). It is therefore advantageous to remove the RDP domain from the construction for improving the production of NV.

[0214] It cannot be excluded that poor production of RDP-VHH-NV is related to the capacity of RDP to form dimers and aggregate triggered by the cysteine encoded in RDP.

[0215] The RDP sequence (YTIWMPENPRLGMSC15DIFTNSRGKRASKG, SEQ ID NO:21) contains one single Cysteine residue (C15, underlined in the RDP sequence; it is herein also called RDPc). The inventors hypothesized that this Cysteine could alter production of the NV fusion protein by triggering the formation of inter-chain sulphide bridges. In order to test this hypothesis, two short polypeptides of 49aa long, ML49c and ML49s were chemically synthesized. The ML49c peptide is formed with a RDP encoding one cysteine (RDPc) and a shortened sequence of NV (NVshort)] while ML49c is formed with a mutated RDP domain called “RDPs” where the Cysteine was replaced by a Serine (serine does not form disulfide bridge) and NVshort. When added to rabbit vitreous humor, ML49c precipitates after being added to eye humor vitreous (pH 7.5) (black dots in the plate-well, Figure 3B), while ML49s does not, indicating that the replacement of C15 by S 15 solves the aggregate formation issue of the RDPc domain. This suggests that C15 might favor the formation of sulphide bridges between molecules. When the ML49c was run on gels in non-denaturation conditions (left part of the Figure 3A), or in native conditions (right part of the Figure 3A), presence of dimers and aggregates was observed (Figure 3 A). In addition, the formation of dimers and aggregates was still observed with ML49cAPBM, an ML49c peptide which PBM, the active part of NV, was deleted, indicating that NV PBM is not involved in the aggregates and dimers formation.

[0216] 2.2. Shorten the pharmacophore size.

[0217] It cannot be excluded that the NV peptide, the pharmacophore, could be recognized by the immune system of the patient because it originates from a viral protein. To minimize this risk, the inventors reduced the size of the pharmacophore. The NVlong sequence encodes not only the PBM, critical for the biological function of NV, but also 27 residual amino acids of the cytoplasmic domain of the rabies virus G protein located upstream the 11 or 15 amino acid PBM domain. Deletion of these 27 aa upstream the PBM of NV leads to a shorten NV sequence called NVshort, (an example thereof has the sequence RIISSWEVHGQQTRL = SEQ ID NO:7).

[0218] To ensure that the shortening of NVlong to NVshort did not alter the biological properties of NV, the capacity of NVshort and NVlong to stimulate neurite outgrowth in a Neuroscreen cells assay was compared. As shown in Figure 4, whatever the dose tested (0.22 pM- 0.055 pM), the ability of VHH-NVshort and of VHH-NVlong to promote neurite elongation were identical.

[0219] In addition, the shortening of NV does not alter the retina RGCs targeting by NV (Figure 8A) nor the duration of detection of NV in retina RGC (Figure 8B).

[0220] Moreover, VHHNPx-NVshort promotes axon regeneration in an ex vivo model of axotomy in retina explants (Figure 9) and in an in vivo preclinical model of mouse optic neuropathies (compression of the optic nerve) (figure 10B). In the same model, VHHNPx-NVshort confers protection of RGCs (Figure 10A).

[0221] Therefore, the length of the pharmacophore can be reduced without losing the biological properties of the NV peptide.

[0222] 2.3. Design of an optimized VHH 2.3-1 Insertion of a disulfide bridge in VHH

[0223] The yield of CPM-NV production was improved after the RDP was removed. However, the VHH-NV molecule was still prone to form aggregates, and precipitates upon contact with the vitreous humor, even in absence of the RDP domain.

[0224] The inventors hypothesized that the insolubility of the molecule and the formation of precipitates in vitreous humor must result from the structure of the VHH itself.

[0225] To overcome this folding issue, the sequence of VHH was modified by replacing two aa (V22 replaced by C22 and S95 replaced by C95) to form an intra-molecular disulfide bridge in canonical position (C22 and C95).

[0226] The sequence of mutated VHH (with the cysteine residues located in C22 and C95 underlined) is (SEQ ID NO: 19):

[0227] EVQLQASGGGLAQPGGSLRLSCTVSGSIDVINNMAWYRQAPGNARELVATITSGFSTN YASSVI<GRFTISRDNAI<I<AVYLQMNSL1<PEDTADYYCI<VHLIRLGAARAYDYWGQG TQVTVS

[0228] Once the disulfide bridge has been inserted, the VHH-NVshort molecule folds properly, and, upon contact with the vitreous humor, does not aggregate and does not precipitate anymore (see Figure 5, upper line).

[0229] Protein was concentrated on Pierce Protein Concentrator PES (MWCO 3 kDa) in PBS buffer pH 7.4 and its concentration was continuously monitored using UV measurements with extinction coefficient specific for the amino acid sequence. Concentration cycles frequency was increasing correspondingly to POIs concentration (10 min to 1 min / cycle, 5 k ref, fixed angle rotor, 4°C, one PES filter / one test). A concentration of 130 mg / ml can be obtained with a VHH- NV encoding a DS.

[0230] Thus, it is also possible to increase the solubility of the VHH-NVshort molecule drastically by inserting an intra-di sulfide bridge in the VHH sequence, to keep the molecule soluble in physiological fluid such as the vitreous humor.

[0231] 2.3.2 Destruction of the antibody function of VHH Although investigations to date have not identified any epitope recognized by the VHH A12, (Li et al., 2017), it cannot be totally excluded that administration of the antibody might lead to binding in vivo and potential side effects. Inactivating the antibody function of VHH would therefore improve therapeutic properties of the compound by further limiting any potential off- target side effects. In addition to safety considerations, the recognition by VHH of an additional (unidentified) antigen could also decrease the efficacy of NV targeting on MAST2 / MAST1 PDZ. Therefore, the putative antibody function carried by the CDR3 domain of VHH was inactivated, by replacing this CDR with a mutated variant devoid of any binding activity. Five variants were created and it was checked in protein data banks (package EBI (UNIPROT Knowledgebase Swissprot, EMBL, Reference Proteome plus), USPTO, EPO, JPO, KIPO, NR 1 and 2) that these variants do not correspond to any existing CDR, strongly suggesting that they are not functional.

[0232] The inventors have therefore mutated the CDR3 domain of VHH A.12 to generate five CDR3 variants.

[0233] 1) CDR3.3 having the sequence KVHLIGLGAAGAGDY = SEQ ID NO:29

[0234] No hits found.

[0235] 2) CDR3.4 KVHLGGGGAAGAGGY = SEQ ID NO : 16

[0236] No hits found.

[0237] 3) CDR3.5 KVHGGGGYDY = SEQ ID NO:30

[0238] No hits found.

[0239] 4) CDR3.6 KGPELR = SEQ ID NO : 31

[0240] No hits found.

[0241] 5) CDR3.7 RLYAEAIY = SEQ ID NO:32

[0242] No hits found in 10 databases

[0243] Among these five variants of CDR3, (SEQ ID NO:29, SEQ ID NO: 16, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32 only one of them, the CDR3.4 variant of SEQ ID NO: 16, offered a good yield production of the VHH-NV. The VHH molecule (VHH mutated to form a single disulfide bridge and encoding the mutated CDR3.4), called VHHNPX corresponds to SEQ ID NO: 19.

[0244] Fusion of VHHNPX with NVshort, leads to the formation of VHHNPx-NVshort, named NPX461 (SEQ ID NO:28) that solves the issues of solubility, yield, formation of aggregates of VHH- NV and removal of offside effect by killing the antibody function of VHH. This series of improvements strengthens the high therapeutic potential of NPX461 as an investigational drug candidate.

[0245] 2.4. Analysis of the biological activity of the peptides of the invention in retinal cells The following polypeptides were generated:

[0246] After Intravitreal (IVT) injection, before reaching the retina, the CPM-NVs of the invention have to overcome: - Precipitation upon contact with vitreous humor (a physiological gel at pH7.5);

[0247] - Degradation by the vitreous humor proteases;

[0248] Outflow (anterior and posterior) to the blood circulation;

[0249] Trapping in the inner limiting membrane (ILM) (see scheme of retina structure in figure 7);

[0250] Once retina is reached, misrouting to retina cells other than Retinal Ganglion Cells (RGCs) can occur (astrocytes, displaced amacrine cells, Muller cells ...)

[0251] The properties of these polypeptides were studied using a series of tests carried out in vitro, ex vivo and in vivo which allowed to verify that they display the following properties:

[0252] Absence of toxicity of the products using in vitro tests (human ARPE-19 cells, Targeting of Retinal Ganglion Cells by VHH-NVs and their persistence after injection into the mouse eye via the intravitreal route (figure 8)

[0253] - Neuroprotective and neuroregenerative properties in appropriate models (ex vivo on mouse retina explants and in vivo in the mouse optic nerve compression model, cf. figure 9).

[0254] It has been observed that NPX461 has no toxicity at 3900pmol (55pg) in ARPE19 cells in vitro (not shown), and that the NPX461 molecule is able to target and penetrate retina cells in vivo (figure 8).

[0255] Regeneration of axons ex vivo in retina explants was greatly enhanced and sustained in presence of 105pmol (1.5pg) of NPX461 (Figure 9).

[0256] It has also been observed that the vectorization of NV with mutated VHH (NPX461) preserves the in vivo biological functions of NV, in so far as it is capable of RGC protection (Figure 10A) and of optic nerve regeneration (Figure 10B).

[0257] The conservation of biological properties of NPX461 confirms that NVshort is sufficient to produce the desired therapeutic effect.

[0258] BIBLIOGRAPHY 1 An, S. Y. et al. Intrinsic disorder is essential for Cas9 inhibition of anti-CRISPR AcrIIA5. Nucleic Acids Res 48, 7584-7594, doi: 10.1093 / nar / gkaa512 (2020).

[0259] 2 Ausubel, F. M. e. a. Current protocols in molecular biology. Current protocols December 4 (2003).

[0260] 3 Boysen, R. I. e. a. HPLC of peptides and proteins: a standard operating conditions. Current protocols in molecular biology, 10.13.11 (2001).

[0261] 4 Butler, M. Mammalian Cell biotechnology: a practical approach. Practical approach 76 (1991).

[0262] 5 Christensen, N. R. et al. PDZ Domains as Drug Targets. Adv Ther (Weinh) 2, 1800143, doi: 10.1002 / adtp.201800143 (2019).

[0263] 6 Dayhoff, M. O. e. a. A model of evolutionary change in proteins. National Biomed. Res. Found. Atlas of protein sequence and structure, 345-352 (1978).

[0264] 7 Dev, K. K. Making protein interactions druggable: targeting PDZ domains. Nat Rev Drug Discov 3, 1047-1056, doi:10.1038 / nrdl578 (2004).

[0265] 8 Donnelly-Roberts, D. L. & Lentz, T. L. Synthetic peptides of neurotoxins and rabies virus glycoprotein behave as antagonists in a functional assay for the acetylcholine receptor. Pept Res 2, 221-226 (1989).

[0266] 9 Eisenberg, D. Three-dimensional structure of membrane and surface proteins. Annu Rev Biochem 53, 595-623, doi: 10.1146 / annurev.bi.53.070184.003115 (1984).

[0267] 10 Eisenberg, D., Weiss, R. M. & Terwilliger, T. C. The hydrophobic moment detects periodicity in protein hydrophobicity. Proc Natl Acad Sci U S A 81, 140-144, doi: 10.1073 / pnas.81.1.140 (1984).

[0268] 11 Flanagan, J. M., Kataoka, M., Shortle, D. & Engelman, D. M. Truncated staphylococcal nuclease is compact but disordered. Proc Natl Acad Sci U S A 89, 748-752, doi: 10.1073 / pnas.89.2.748 (1992).

[0269] 12 Green, M. R. e. a. Molecular cloning: a laboratory manual. Laboratory manuals 4th edition (2012).

[0270] 13 Henikoff, S. & Henikoff, J. G. Amino acid substitution matrices. Adv Protein Chem 54, 73-97, doi:10.1016 / s0065-3233(00)54003-0 (2000). 14 Khan, Z. et al. Structure-based optimization of a PDZ-binding motif within a viral peptide stimulates neurite outgrowth. J Biol Chem 294, 13755-13768, doi: 10.1074 / jbc.RAl 19.008238 (2019).

[0271] 15 Lafaye, P., Achour, I., England, P, Duyckaerts, C. & Rougeon, F. Single-domain antibodies recognize selectively small oligomeric forms of amyloid beta, prevent Abeta- induced neurotoxicity and inhibit fibril formation. Mol Immunol 46, 695-704, doi: 10.1016 / j.molimm.2008.09.008 (2009).

[0272] 16 Lentz, T. L., Hawrot, E. & Wilson, P. T. Synthetic peptides corresponding to sequences of snake venom neurotoxins and rabies virus glycoprotein bind to the nicotinic acetylcholine receptor. Proteins 2, 298-307, doi:10.1002 / prot.340020406 (1987).

[0273] 17 Lentz, T. L., Wilson, P. T., Hawrot, E. & Speicher, D. W. Amino acid sequence similarity between rabies virus glycoprotein and snake venom curaremimetic neurotoxins. Science 226, 847-848, doi: 10.1126 / science.6494916 (1984).

[0274] 18 Li, T. et al. Selection of similar single domain antibodies from two immune VHH libraries obtained from two alpacas by using different selection methods. Immunol Lett 188, 89-95, doi:10.1016 / j.imlet.2017.07.001 (2017).

[0275] 19 Meijering, E. et al. Design and validation of a tool for neurite tracing and analysis in fluorescence microscopy images. Cytometry A 58, 167-176, doi: 10.1002 / cyto.a.20022 (2004).

[0276] 20 Prehaud, C. et al. Attenuation of rabies virulence: takeover by the cytoplasmic domain of its envelope protein. Sci Signal 3, ra5, doi:10.1126 / scisignal.2000510 (2010).

[0277] 21 Sheth, R. U., Cabral, V., Chen, S. P. & Wang, H. H. Manipulating Bacterial Communities by in situ Microbiome Engineering. Trends Genet 32, 189-200, doi: 10.1016 / j .tig.2016.01.005 (2016).

[0278] 22 Terrien, E. et al. Interference with the PTEN-MAST2 interaction by a viral protein leads to cellular relocalization ofPTEN. Sci Signal 5, ra58, doi:10.1126 / scisignal.2002941 (2012).

Claims

CLAIMS1. A Neurovita polypeptide comprising the NVshort peptide of sequence:XnSWXVXXQQTRL (SEQ ID NO:4), wherein X is any amino acid and n is an integer comprised between 0 and 4 (i.e., n is 0, 1, 2, 3, or 4), and wherein the sequence of the Neurovita polypeptide is not SEQ ID NO:1, 2, or 3, and wherein the Neurovita polypeptide comprises a fusion protein between the NVshort peptide of sequence RIISSWEVHGQQTRL (SEQ ID NO:7) and a VHH CPM.

2. The polypeptide of any one of claim 1, further comprising a homing molecule.

3. The polypeptide of claim 2, wherein the polypeptide has a basic isoelectric point.

4. The polypeptide of any of claims 1-3, consisting of a fusion protein between the NVshort peptide of sequence RIISSWEVHGQQTRL (SEQ ID NO:7) and a VHH CPM.

5. The polypeptide of claim 3 or 4, wherein said CPM is a heavy chain polypeptide of a VHH camelid antibody whose sequence is mutated to contain at least one disulfide bond and a CDR3 containing three or more mutations as compared with SEQ ID NO: 15, so as to inactivate the antibody function of said VHH camelid antibody.

6. The polypeptide of any of claims 1-3 or 5, wherein said CPM and / or Neurovita peptides are separated by a linker.

7. The polypeptide of any of claims 1-6, wherein it contains: a. the VHHNPX CPM having the SEQ ID NO: 19 or a variant thereof, whose sequence displays at least 90%, preferably at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% homology or similarity with SEQ ID NO: 19, said variant comprising i) the CDRs of SEQ ID NO: 13, SEQ ID NO: 14 and SEQID NO: 16 as CDR1-3 respectively, and ii) at least one disulfide-bridge formed by two cysteines, and b. the NVshort polypeptide of sequence RIISSWEVHGQQTRL (SEQ ID NO:7).

8. The polypeptide of any of claims 1-5 or 7, wherein it has the sequence SEQ ID NO:28.

9. The polypeptide of any of claims 1-8, wherein it is soluble in vitreous humor, nonaggregated, and able to bind and block with high affinity the PDZ domain of the human MAST1 and MAST2 proteins in neuronal cells.

10. A vector, preferably a viral vector, DNA or mRNA, encoding the polypeptide as defined in any of claims 1-9.

11. A pharmaceutical composition comprising the polypeptide as defined in any of claims 1-9 or the vector of claim 10, for its expression in cells and its use as a medicament.

12. The pharmaceutical composition as defined in claim 11, for preventing and / or treating a disease or condition involving the Peripheral Nervous System (PNS) or the Central Nervous System (CNS) or the evolution of such disease or condition, such as optic neuropathies (glaucoma, NAION), motor neuron diseases (ALS), muscular diseases (Duchenne Disease) or neurodegenerative diseases (Parkinson disease, Alzheimer’s Disease).

13. The pharmaceutical composition for use according to claim 11 or 12, wherein said disease or condition is a neurodegenerative disease, or a cell damage-associated condition such as stroke or injury including optic nerve disease, retinal diseases, muscular diseases, motor neuron disease.

Citation Information

Patent Citations

  • Cell-permeable peptide inhibitors of the JNK signal transduction pathway

    EP1811033A1

  • Nucleotide sequence encoding the enzyme I-SceI and the uses thereof

    US5792632A

  • I Sce I-induced gene replacement and gene conversion in embryonic stem cells

    US5830729A

  • Nucleotide sequence encoding the enzyme I-SceI and the uses thereof

    US6238924B1

  • Random integration of a polynucleotide after in VIVO linearization

    WO2003025183A2