CD24-binding antibodies

Abstract

Provided herein are CD24 binding antibodies, and methods of making and using the same. These antibodies may be useful for the treatment of a disease or condition such as cancer.

Description

Attorney Docket No.: PHST-005 / 01 WO 344821 -2023CD24-BINDING ANTIBODIESCROSS REFERENCE TO RELATED APPLCATIONS

[0001] Illis application claims priority to U. S. Provisional Patent Application No. 63 / 725,444, filed on November 26, 2024, the content of which are incorporated by reference herein in its entirety.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

[0002] The contents of the electronic sequence listing (PHST 005 01WO_SeqList_ST26.xml; Size: 91,660 bytes; and Date of Creation: November 20, 2025) are herein incorporated by reference in its entirety.BACKGROUND

[0003] CD24 is a heavily gly cosylated protein with a small protein core that is linked to the plasma membrane via a glycosyl-phosphatidylinositol anchor. Although CD24 is found in many normal tissues and cell types, CD24 is highly expressed or overexpressed in many human cancers, including at least breast, ovarian, cholangiocarcinoma, renal cell, lung, and colorectal solid cancers, as well as in lymphomas. In cancer, CD24 is thought to be a regulator of cell migration, invasion and proliferation, and its expression is associated -with cancer sternness and poor prognosis. More recently CD24 has been identified on tumor cells as a phagocytic inhibitor that provides a “do not eat me” signal by binding Siglec-10 on macrophages. It is drought that this mechanism underlies CD24’s role in tumor immunity. By protecting tumor cells from phagocytosis, CD24 helps them escape immune surveillance by direct macrophage attack and suppresses downstream activation through cross-presentation of cancer-specific antigens to the adaptive immune system.

[0004] Targeting the CD24-Siglec-10 binding axis, which lies at the interface between tumor cells and the immune system, remains challenging due to tire complex biology and lack of effective tools. Accordingly, there is an unmet need for antibodies which target the CD24. Provided herein are antibodies and related uses that address this need.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023SUMMARY

[0005] In one aspect, provided herein is a CD24-specific antibody comprising a heavy chain complementarity determining region (CDRH) 1, a CDRH2, a CDRH3, a light chain complementarity determining region (CDRL) 1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence set forth in:a) SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58;b) SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64;c) SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;d) SEQ ID NO: 65, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74;e) SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79;f) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83;g) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83;h) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83;i) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83; orj) SEQ ID NO: 53, SEQ ID NO: 87, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83.

[0006] In another aspect, provided herein is a CD24-specific antibody comprising:a) a heavy chain variable region (VII) comprising the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the ammo acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and aAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;b) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 29, or an amino acid sequence composing at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;c) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;d) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively;Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 e) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively;f) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;g) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;h) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and aAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;i) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence composing at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;j) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 45, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;k) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRLl, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 l) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 49, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; orm) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 51, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

[0007] in some embodiments, the CD24-specific antibodies of the disclosure comprise:n) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising tire sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein tire VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;o) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 29, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the ammo acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70%Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;p) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;q) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the ammo acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively;r) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively;Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 s) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID MO: 37, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;t) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;u) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;v) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and aAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;w) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 45, or an amino acid sequence composing at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;x) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;y) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 49, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRLl, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; orAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 z) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID MO: 51, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain vanable region (VL) comprising the amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

[0008] In some embodiments, a CD24-specific antibody of the disclosure is humanized.

[0009] in some embodiments, a CD24-specific antibody of the disclosure is full length antibodies.

[0010] In some embodiments, a CD24-specific antibody of the disclosure is an antigen-binding antibody fragment.

[0011] In some embodiments, a CD24-specific antibody of the disclosure comprises a Fc domain, and the Fc domain is selected from the group consisting of a human IgGl, IgG2, IgG3, and IgG4 heavy chain sequence.

[0012] In some embodiments, the binding of a CD24-specific antibody of the disclosure does not disrupt the interaction between CD24 and Siglec-10.

[0013] In some embodiments, the binding of a CD24-specific antibody of tire disclosure disrupts the interaction between CD24 and Siglec-10.

[0014] In some embodiments, a CD24-specific antibody of the disclosure binds human CD24 and cynomolgus monkey CD24.

[0015] In some embodiments, a CD24-specific antibody of the disclosure comprises a binding affinity to CD24 lower than about 500 nM.

[0016] in another aspect, provided herein is a pharmaceutical composition comprising a CD24-specific antibody of tire disclosure, and optionally a pharmaceutically acceptable carrier.

[0017] In yet another aspect, provided herein is a nucleic acid encoding a CD24-specific antibody of the disclosure.

[0018] In yet another aspect, provided herein is a vector comprising a nucleic acid of the disclosure.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 |0019] In yet another aspect, provided herein is a method of treating a disease or condition in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a CD24-specific antibody of the disclosure or a pharmaceutical composition of the disclosure.

[0020] In some embodiments of the methods of the disclosure, the disease or condition comprises cancer.

[0021] In some embodiments, the cancer comprises a solid cancer. In some embodiments, the solid cancer is a carcinoma or a sarcoma. In certain embodiments, tlie carcinoma is selected from the group consisting of bladder, breast, colon, kidney, liver, lung, ovary, endometrium, pancreas, stomach, cervix, thyroid and skin. In exemplary embodiments, the sarcoma is fibrosarcoma or rhabdomyosarcoma.

[0022] In some embodiments, the cancer comprises a hematological cancer. In some embodiments, the hematological cancer is selected from the group consisting of acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Burkett's lymphoma; acute myelogenous leukemia, chronic myelogenous leukemia, and promyelocytic leukemia. In some embodiments, the cancer is selected from the group consisting of melanoma, neuroblastoma, glioma, tumors of the central nervous system, and tumors of the peripheral nervous system.

[0023] In some embodiments of the methods of the disclosure, the route of administration is intravenous or subcutaneous administration.

[0024] In some embodiments of the methods of the disclosure, the subject is human.

[0025] In some embodiments of the methods of the disclosure, the antibody or pharmaceutical composition is administered in combination with another drag or therapy. In certain embodiments, the drag or therapy comprises chemotherapy, hormonal therapy, biological therapy, immunotherapy, radiation therapy, or surgery'.

[0026] Also provided herein is an use of a CD24-specific antibody of the disclosure or a pharmaceutical composition of the disclosure in the manufacture of a medicament for the treatment of a disease or condition. In some embodiments, the disease or condition composes cancer. In some embodiments, tire medicament is administered through intravenous or subcutaneous administration.

[0027] Also provided herein is a CD24-specific antibody of the disclosure or a pharmaceutical composition of the disclosure for use in the treatment of a disease or condition. In someAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 embodiments, the disease or condition comprises cancer. In some embodiments, the medicament is administered through intravenous or subcutaneous administration.BRIEF DESCRIPTION OF THE DRAWINGS

[0028] FIG. 1 shows yeast display affinity maturation of PHRHL-26. Data is presented as a histogram depicting the relative number of events (Y axis) against CD24 staining intensity (X axis).

[0029] FIG. 2 shows binding curves for antibody variants of PHRHL-305 discovered by yeast display, with varying concentrations of CD24.

[0030] FIGS. 3A-3B show sequence alignments of yeast display-derived clones from heavy chain (FIG, 3A) and light chain (FIG, 3B) libraries.

[0031] FIG. 4 shows analytical SEC profiles of antibody variants.

[0032] FIG. 5 shows phagocytosis of BT474 breast ductal carcinoma cells in the presence of antibodies of the disclosure.

[0033] FIG. 6 shows phagocytosis of MFM-223 breast carcinoma cells in the presence of antibodies of the disclosure.

[0034] FIG. 7 shows phagocytosis of OVCAR-8 ovarian cancer cells in the presence of antibodies of the disclosure.

[0035] FIG. 8 shows phagocytosis of NCI-1563 non-small cell lung adenocarcinoma cells in the presence of antibodies of the disclosure.

[0036] FIG. 9 shows phagocytosis of NCI-H292 lung mucoepidermoid carcinoma cells in the presence of antibodies of the disclosure.

[0037] FIG. 10 shows phagocytosis of HT29 colorectal adenocarcinoma cells in the presence of antibodies of the disclosure.DETAILED DESCRIPTIONI. Definitions

[0038] Unless defined otherwise, all terms of art, notations, and other technical and scientific terms or terminology used herein are intended to have the same meaning as is commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and / or forAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.

[0039] As used herein, the articles “a” and “an” refer to one or to more than one (i.e. to at least one) of the grammatical object of tire article. By way of example, “an antibody” means one antibody or more than one antibody.

[0040] As used herein, the term “about” will be understood by persons of ordinary skill in the art and will vary' to some extent on the context in which it is used. In some embodiments, the term “about” when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass art-accepted variations based on standard errors in making such measurements. In some embodiments, the term “about” when referring to such values, is meant to encompass variations of ±10% from the specified value.

[0041] As used herein, “affinity” refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Tire affinity of a molecule for its partner can generally be represented by the equilibrium dissociation constant (KD) (or its inverse equilibrium association constant, KA). Affinity can be measured by common methods known in the art.

[0042] As used herein, “antibody” is meant in a broad sense and includes immunoglobulin molecules including monoclonal antibodies including murine, human, humanized and chimeric antibodies, antibody fragments, bispecific or multispecific antibodies formed from at least two intact antibodies or antibody fragments, dimeric, tetrameric or multimeric antibodies, single chain antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity.

[0043] Immunoglobulins can be assigned to five major classes, namely IgA, IgD, IgE, IgG, and IgM, depending on the heavy chain constant domain amino acid sequence. IgG antibodies further sub-classified to IgGl, IgG2, IgG3, and IgG4. Antibody light chains of any vertebrate species can be kappa (K) or lambda (A), based on the amino acid sequences of their constant domains.

[0044] As used herein, “constant domain” refers to a portion of an immunoglobulin molecule that formed by the Fc domain of the heavy chain (CHI, CH2, and CH3). In some instances, the term “constant domain” is meant to additionally include the CL region of the light chain.

[0045] As used herein, “antigen binding fragment” or “antibody fragment” refers to a portion of an immunoglobulin molecule that retains the heavy chain and the light chain antigen bindingAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 site, such as a heavy chain complementarity determining regions (HCDR) 1 (HCDR1), 2 (HCDR2), and 3 (HCDR3), a light chain complementarity determining regions (LCDR) 1 (LCDR1), 2 (LCDR2), and 3 (LCDR3), a heavy chain variable region (VH), or a light chain variable region (VL). Antibody fragments include, but are not limited to, a single-chain Fv (scFv) comprising VH and VL domains of an antibody wherein these domains are present in a single polypeptide chain, a Fab fragment (a monovalent fragment comprising a VI, and a VH) and a F(ab) 2 fragment (a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region). VH and VL domains can be engineered and linked together via a synthetic linker to form various types of single chain antibody designs. Antibody fragments are obtained using well known techniques and the fragments are characterized in the same manner as are intact antibodies.

[0046] An antibody variable region comprises a framework region interrupted by the CDR antigen binding sites. Hie term “framework,” or “FR” or “framework sequence” refers to the remaining sequences of a variable region other than those sequences defined to be antigen binding sites. Because the antigen binding site can be defined by various terms as described above, the exact amino acid sequence of a framework depends on how the antigen-binding site is defined, FRs are located between CDRs, for example, with FR-H1 located before HCDR1, FR-H2 located between HCDR1 and HCDR2, FR-H3 located between HCDR2 and HCDR3 and so forth.

[0047] The term “CDR” denotes a complementarity determining region as defined by at least one manner of identification to one of skill in the art. The precise amino acid sequence boundaries of a given CDR or FR can be readily determined using any of a number of well- known schemes, including those described by Rabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (“Kabat” numbering scheme); Al-Lazikani et al., (1997) JMB 273, 927-948 (“Chothia” numbering scheme); MacCallum et al., J. Mol. Biol. 262:732-745 (1996), “Antibody -antigen interactions: Contact analysis and binding site topography,” J. Mol. Biol. 262, 732-745.” (“Contact” numbering scheme); Lefranc M P et al., “IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains,” Dev Comp Immunol, 2003 January7; 27(l):55-77 (“IMGT” numbering scheme); Honegger A and Pluckthun A, “Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool,” J Mol Biol, 2001 Jun. 8; 309(3):657-70, (“Aho”Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 numbering scheme); and Martin et al., “Modeling antibody hypervariable loops: a combined algorithm,” PINAS, 1989, 86(23):9268-9272, (“AbM” numbering scheme).

[0048] Tire boundaries of a given CDR or FR may van' depending on the scheme used for identification. For example, the Kabat scheme is based on structural alignments, while the Chothia scheme is based on structural information.

[0049] In some embodiments, CDRs can be defined in accordance with any of the Chothia numbering schemes, the Kabat numbering scheme, tire IMGT numbering scheme, a combination of Kabat, IMGT, and Chothia, the AbM definition, and / or the contact definition.

[0050] As used herein, the term “specifically binds” to a target molecule, such as an antigen, means that a binding molecule, such as a single domain antibody, reacts or associates more frequently, more rapidly, with greater duration, and / or with greater affinity with a particular target molecule than it does with alternative molecules. As such, “specific binding” does not necessarily require (although it can include) exclusive binding.

[0051] As used herein, percent (%)identity as it relates to amino acid sequences are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in another peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary’, to achieve the maximum percent sequence identity,. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or MEGALIGN (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.

[0052] The term “isolated” as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature or produced. For example, a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in w hich it w as produced. When a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide. Similarly, a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell inAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 which it was produced. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated.”

[0053] Tire term “effective amount” as used herein means an amount of a pharmaceutical composition which is sufficient to significantly and positively modify the symptoms and / or conditions to be treated (e.g., provide a positive clinical response).

[0054] As used herein, a composition refers to any mixture of two or more products, substances, or compounds. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous, or any combination thereof.

[0055] As used herein, the term “pharmaceutically acceptable” refers to a material, such as a carrier or diluent, which does not abrogate the biological activity or properties of a therapeutic compound, and is relatively nontoxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.

[0056] As used herein, the term “pharmaceutical composition” refers to a mixture of at least one targeted antibody of the disclosure with other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and / or excipients. Multiple techniques of administering the antibodies and pharmaceutical compositions of the disclosure exist in the art including, but not limited to, intravenous, oral, aerosol, parenteral, ophthalmic, pulmonary, and topical administration.

[0057] As used herein, the terms “treat,” “treating,” or “treatment” refer to ameliorating a disease or disorder, e.g., slowing or arresting or reducing the development of the disease or disorder or reducing at least one of the clinical symptoms thereof. For purposes of this disclosure, ameliorating a disease or disorder can include obtaining a beneficial or desired clinical result that includes, but is not limited to, any one or more of: alleviation of one or more symptoms, diminishment of extent of disease, preventing or delaying spread (for example, metastasis, for example metastasis to the lung or to the lymph node) of disease, preventing or delaying recurrence of disease, delay or slowing of disease progression, amelioration of the disease state, inhibiting the disease or progression of the disease, inhibiting or slowing the disease or its progression, arresting its development, and remission (whether partial or total).

[0058] The terms “individual” and “subject” are used interchangeably herein to refer to an animal; for example a mammal. The terms include human and veterinary animals. In some embodiments, methods of treating animals, including, but not limited to, humans, rodents.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory¬ animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are provided. The animal can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric. In some examples, an “individual” or “subject” refers to an animal in need of treatment for a disease or disorder. In some embodiments, the animal to receive the treatment can be a “patient,” designating the fact that the animal has been identified as having a disorder of relevance to the treatment, or being at adequate risk of contracting the disorder. In particular embodiments, the animal is a human, such as a human patient.

[0059] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. II. CD24-Specific Antibodies

[0060] Described herein are novel antibodies that specifically bind CD24. There are several single nucleotide polymorphisms and allelic variations in CD24 that give rise to CD24 variants, and that are associated with immune outcomes. Tire antibodies provided herein may bind one or more of these variants. Tire term “CD24” as used herein is inclusive of all variants and isoforms of CD24, regardless of species.

[0061] The human CD24 protein has been characterized to have at least two isoforms. The amino acid sequence of the mature form of one of the isoforms of human CD24 is:SETTTGTSSNSSQSTSNSGLAPNPTNATTKAA (SEQ ID NO: 200); this sequence does not include a signal peptide or C -terminus displaced by GPI anchor).

[0062] In some embodiments, the antibodies of the disclosure bind particular epitopes of CD24.

[0063] in some embodiments, the antibodies of the disclosure binds to non-glycosylated CD24. In other embodiments, the antibodies of the disclosure bind to glycosylated CD24 either in recombinant form or on the surface of the cell. In some embodiments, the antibodies of the disclosure bind to all CD24 glycoforms. In other embodiments, the antibodies of the disclosure are capable of binding to different CD24 glycoforms with varying affinities. In other embodiments, the antibodies of the disclosure are non-binders of certain CD24 glycoforms.

[0064] In some embodiments, the binding of the antibodies of the disclosure to CD24 induces or enhances phagocytosis in a glycosylation dependent manner. In other embodiments, theAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 binding of the antibodies of the disclosure to CD24 induces or enhances phagocytosis in a glycosylation independent manner.

[0065] In some embodiments, the binding of the antibodies of the disclosure to CD24 induces or enhances phagocytosis in a sialylation dependent manner. In other embodiments, the binding of the antibodies of the disclosure to CD24 induces or enhances phagocytosis in a sialy lation independent manner.

[0066] In some embodiments, the antibodies of the disclosure disrupt the binding of CD24 to Siglec-10, for example on macrophages. That is, in some embodiments, the CD24 antibodies provided herein compete with Siglec-10 for binding to CD24. In other embodiments, the antibodies provided herein do not disrupt the binding of CD24 to Siglec-10, that is they do not compete with Siglec-10 for binding to CD24. In other embodiments, the antibodies provided herein compete with a molecule other than Siglec-10 for the binding of CD24.

[0067] In some embodiments, the antibodies of the disclosure bind human CD24, In some embodiments, the antibodies of the disclosure may cross-read with a cynomolgus (or “cyno”) CD24, or other non-human primate CD24. In other embodiments, the antibodies of the disclosure do not cross-react, or minimally cross with a cyno CD24, or other non-human primate CD24.

[0068] In some embodiments, the CD24 antibodies provided herein are full-length antibodies (comprising an intact tetrameric antibody containing two light chains and two heavy chains, each with a variable region, and a constant region). In some embodiments, the constant region of the full-length CD24 antibodies comprises a human Fc domain, selected from human IgGl, human lgG2, human IgG3, and human IgG4 Fc domains. In some embodiments, the constant region of the full-length CD24 antibodies comprises a mouse Fc domain, selected from mouse IgGl and mouse IgG2a Fc domains. In some embodiments, the constant region of the full-length CD24 antibodies comprises a rat Fc domain, selected from rat IgGl and rat IgG2b Fc domains. In embodiments, the Fc domain of a full-length CD24 antibody is that of a non-human primate, e.g. a cynomolgus monkey Fc domain. In exemplary7embodiments, full length CD24 antibody comprises a human IgGl or comprises a human IgG4. In further embodiments, the Fc domain could be further modified to exhibit lower effector function (e.g. Fc-dead human IgGl ).

[0069] In some embodiments, the Fc domain could be modified to exhibit lower or attenuated effector function (e.g, Fc-dead human IgGl). In some embodiments, the Fc region of the CD24 antibodies may incorporate one or more mutations that attenuate Fc activity, including but notAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 limited to the following mutations and combinations thereof: L234A, L235A, G237A, and N297A.

[0070] In other embodiments, the Fc domain could be modified to enhance effector function. Such enhancement may be achieved through post-translational modifications, such as afocosylation, or through other techniques and modifications aimed at increased binding to Fc receptors or enhancing antibody-mediated cellular cytotoxicity’ (ADCC), antibody-mediated cellular phagocytosis (ADCP), and / or complement-dependent cytotoxicity (CDC).

[0071] In other embodiments, a CD24 antibody of the disclosure comprises a Fc domain, but the antibody is not a full length antibody, e.g. the Fc useful to improve half-life and other pharmacokinetics. For example, an antibody fragment of the disclosure (e.g. a scFv) could be further fused to a Fc domain. In such instances, it is contemplated that the Fc domain could be obtained from human IgGl, human IgG2, human IgG3, human IgG4, mouse IgGl, mouse IgG2a, rat IgGl or rat IgG2b. In exemplary’ embodiments, the Fc domain is obtained from a human IgG 1 or human IgG4. In further embodiments, the Fc domain could be further modified to have lower effector function (e.g. Fc-dead human IgGl).

[0072] In some embodiments, provided herein are antibodies comprising a Kn to CD24 of at least about 0.1 nM, at least about 0.5 nM, at least about 1 nM, at least about 5 nM, at least about 10 nM, at least about 50 nM, at least about 100 nM, at least about 500 nM, at least about 1 pM, at least about 1.5 pM, or at least about 2 pM.

[0073] Sequences for exemplary’ CD24 antibodies of the disclosure are shown in Tables 1-3 below.

[0074] Table 1 provides exemplary' heavy chain (HC) and light chain (LC) amino acid sequences of the CD24 antibodies of the disclosure. Antibody complementarity determining regions (CDRs) (as determined by Kabat) are indicated in bold.Table 1: Exemplary HC / LC sequences of CD24 antibodiesAntibody Light chain (LC) Heavy chain (HC) sequenceID sequence PIIRIIL- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 300 GYYWSWVRQHPGKGLEWIGHFYDSGNTY KPASISCRSSQSLVYSD YNPSLKSRVTISVDTSKN QFSLKLSSVTAAD GN TYLSWFQQRPGQ SP TAVYYCAGTGIDFDYWGQGTLVTVSSAKTT RRLIYKVSNRDFGVPD PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPE RFSGSGSGTDFTLKISRAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Antibody Light chain (LC) Heavy chain (HC) sequenceID sequence PVTVTWNSG SLS SG VI ITFPAVLQSDLYTLS S VEAEDVGVYYCMQGT SVTVPSSTWPSQTVTCNVAHPASSTKVDKKI HWPPTFGQGTKVEIKR VPRDCGCKPCICTVPEV S S VFIFPPKPKD VLTI ADAAPTVSIFPPS SEQLT TLTPKVTCVVVDISKDDPEVQFSWFVDDVE SGG A S WCFLNNFYPK VHTAQTKPREEQFNSTFRSVSELPIMHQDWL DINVKWKIDGSERQNG NGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP VLNSWTDQDSKDSTYS Q VYTIPPPKEQMAKDKV SLTCMITNFFPEDIT MSSI LI LI KDEY ERHN VEWQWNGQPAENYKNTQPIMDTDGSYFVY SYTCEATHKTSTSPIVK SKLNVQKSNWEAGNTFTCSVLHEGLHNHHT SFNRNEC (SEQ ID NO: EKSLSHSPGK (SEQ ID NO: 1) 2)PHRHL- QVQLVQSGAEVKKPGASVKVSCKASGYPFK D1VMTQSPLSLPVTPGE 301 TYDFNWVRQATGQGLEWMGWMNPNSGN PASISCRSSQSLLHSNG TGYAQKFQGRVTMTRDTSISTAYMDLNSLK YNFLDWYLQKPGQSPQ SDDTAVYYCARGNWGLDYWGQGTLVTVSS LLIYLGSNRASGVPDRF AKTTPPSVYPLAPGSAAQTNSMVTLGCLVK SGSVSGTDFTMKISRVE GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL AADVGVYYCMQVLQT YTLSSSVTVPSSTWPSQTVTCNVAHPASSTK PLTFGGGTKVEIKRAD VDKKIVPRDCGCKPCICTVPEVSSVF1FPPKP AAPTVS1FPPS SEQLTSG KDVLTITLTPKV TCV V VDISKDDPEVQFS WF GASVVCFLNNFYPKDIN VDDVEVHTA QTKPREEQFNSTFR SVSELPIM VKWKIDGSERQNGVI. N HQDWLNGKEFKCRVNSAAFPAPIEKTISKTK SWTDQDSKDSTYSMSS GRPKAPQVYTIPPPKEQMAKDKVSLTCMITN TLTLTKDEYERHNSYT FFPEDITVEWQWNGQPAENYKNTQPIMD ID CEATHKTSTSPIVKSFN GSYFVYSKLNVQKSNWEAGNTFTCSVLHEG RNEC (SEQ ID NO: 4) LHNHHTEKSLSHSPGK (SEQ ID NO: 3)PIIRIIL- QVQLVESGGGLVKPGGSLRLSCAASGFTFSD DVVMTQSPLSLPVTLG 302 YYMSWIRQAPGKGLEWVSYITGDGRTIYY QPASISCRSSQSLVNSD ADSVKGRF TISRDNAKN SLYLQMNSLRAED GNIYLNWFQQRPGQ SP TAXWYCAGTGTTRDFWGQGTLWTVSSAKT RRLIYKVSNRDSGVPD TPPSVYPLAPGSAAQTNSMVTLGCLVKGYFP RFSGSGSGTDFTLKISRAtorney Docket No.: PHST-005 / 01 WO 34482 I -2023 Antibody Light chain (EC) Heavy chain (HC) sequenceID sequence EPVTVTWNSGSLSSGVHTFPAVLQSDLYTLS VEAEDVGVYYCMQGS SSVTVPSSTWPSQTVTCNVAHPASSTKVDKK HWPLTVGGGTKVEIKR IVPRDCGCKPCICIVPEVSSVFIFPPKPKDVLT AD AAPIVSIFPPS SEQLT ITLTPKVTCVVVDISKDDPEVQFSWFVDDVE SGG A S WCFLNNFYPK VHTAQTKPREEQFNSTFRSVSELPIMHQDWL DINVKWKIDGSERQNG NGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP VLNSWTDQDSKDSTYS Q VYTIPPPKEQMAKDKV SLTCMITNFFPEDIT MSSI LI LI KDEY ERHN VEWQWNGQPAENYKNTQPIMDTDGSYFVY SYTCEATHKTSTSPIVK SKLNVQKSNWEAGNTFTCSVLHEGLHNHHT SFNRNEC (SEQ ID NO: EKSLSHSPGK (SEQ ID NO: 5) 6)PHRHL- QVQLVESGGGLVKPGGSLRLTCAASGFTFSD DVVMTQSPLSLPVTLG 303 YYMSWIRQAPGKGLEWLSYFSGSGSIRYYA QPASISCWSSRSLVHSD DSVKGRFTISRDNAKNSLFLQMNSLRAEDTA GRTYLTWFQQRPGQSP VYYCARDDDNWGQGTLVTVSSAKTTPPSVY RRLIYKVSNRDSGVPD PLAPGSAAQTNSMVTLGCLVKGYFPEPVTVT RFSGSGSGTDFTLKISR WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVP VEAEDVGVYYCLQGS SSTWPSQTVTCNVAHPASSTKVDKKIVPRDC HWPFTFGPGTKVDIKR GCKPCICTVPEVSSVFIFPPKPKDVLTITLTPK ADAAPTVSIFPPS SEQLT VICVVVDISKDDPEVQFSWFVDDVEVHTAQ SGGASVVCFLNNFYPK TKPREEQFNSTFRSVSELPIMHQDWLNGKEF DINVKWKIDGSERQNG KCRVNSAAFPAPIEKTISKTKGRPKAPQWTI VLNSWTDQDSKDSTYS PPPKEQMAKDKVSLTCMITNFFPEDITVEWQ MSSTLTLTKDEYERHN WNGQPAENYKNTQPIMDTDGSYFVYSKLNV SYTCEATHKTSTSPIVK QK SNWEAGNTFTC S VLHEGLHNHHTEK SLS SFNRNEC (SEQ ID NO: HSPGK (SEQ ID NO: 7) 8)PHRFIL- EVQLVESGGGLVQPGGSLRLSCAASGFTFNT DVVMTQSPLSLPVILGQ 304 YWMSWVRQAPGKGLEWVANIKKDGSEKY PASISCRSSQSLVYSDG YVDSVKGRFTISRDNAKNSLYLQMNSLRAE N TYLNWFQQRPGQ SPR DTAVYYCARDGEDNWGQGTL / VTVSSAKTT RLIYKVSNRDSGVPDRF PPSWPLAPGCGDTTGSSVTLGCLVKGYFPE SGSGSGTDFTLKISRVEAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Antibody Light chain (LC) Heavy chain (HC) sequenceID sequenceS V TVTWNSG SLSS SVHTFPALLQSGLYTMS S AEDVGVYYCMQGSFI S VTVPS STWPSQTVTCS VAHPAS STTVDKKL WPPVTFGGGTKVEIKR EPSGPIS IINPCPPCKECHKCPAPNLEGGPS VF ADAAPTVSIFPPS SEQLT IFPPNIKDVLMISLTPKVTCVVVDVSEDDPDV SGG A S WCFLNNFYPK QISWFVNNVEVHTAQTQTHREDYNSTIRVVS DINVKWKIDGSERQNG TLPIQHQDWMSGKEFKCKVNNKDLPSPIERT VLNSWTDQDSKDSTYS ISKIKGLVRAPQVYILPPPAEQLSRKDVSLTC MSSI LI LI KDEY ERHN LVVGFNPGDISVEWTSNGHTEENYKDTAPV SYTCEATHKTSTSPIVK LDSDGSYF1YSKLNMKTSKWEKTDSFSCNVR SFNRNEC (SEQ ID NO: HEGLKNYYLKKTISRSPGLDLDDICAEAKDG 10) ELDGIWTTITIFISLFLLSVCYSASVTLFKVK WIFSSVVELKQKISPDYRNMIGQGA (SEQ IDNO: 9)PHRHL- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 305 GYYWSWVRQHPGKGLEWIGHFYDGGNTY KPASISCRSSQSLVYSD YNPSLKSRVTISVDTSKN QFSLKLSSVTAAD GN TYLSWFQQRPGQ SP TAVYYCAGTGPDFDYWGQGTLVTVSSAKT RRLIYKVSNRDFGVPD TPPSVYPLAPGSAAQTNSMVTLGCLVKGYFP RFSGSGSGTDFTLKISW EPVTVTWNSGSLSSGVHIFPAVLQSDLYTLS VEAEDVGVYYCMQGT SSVTVPSSTWPSQTVTCNVAHPASSTKVDKK HWPPTFGQGTKVEIKR IVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLT AD AAPTVSIFPPS SEQLT ITLTPKVTCVVVDISKDDPEVQFSWFVDDVE SGGASVVCFLNNFYPK VHTAQTKPREEQFNSTFRSVSELPIMHQDWL DINVKWKIDGSERQNG NGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP VLNSWTDQDSKDSTYS QVYTIPPPKEQMAKDKVSLTCMITNFFPEDIT MSSTLTLTKDEYERI IN VEWQWNGQPAENYKNTQPIMDTDGSYFVY SYTCEATHKTSTSPIVK SKLNVQKSNWEAGNTFTCSVLHEGLHNHHT SFNRNEC (SEQ ID NO: EKSLSHSPGK (SEQ ID NO: 11 ) 12)PHRHL- QVQLQESGPGLVKPSQIT. SLTCTVSGGSISSG DVVMTQSPLSLPVTLG 306 G YYWSWVRQI IPGKGLEWIGHF YDGGNT Y KPASISCRSSQSLVYSDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Antibody Light chain (LC) Heavy chain (HC) sequenceID sequence YNPSLKSRVHSVDTSKNQFSLKLSSVTAAD GNTYLSWFQQRPGQSP TAVYYCAGTGPDFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISW PVTVSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKR VESKYGPPCPPCPAPEFLGGPSVFLFPPKPKD TVAAPSVFIFPPSDEQL TLMISRTPEVTCVVVDVSQEDPEVQFNWYV KSGTASVVCLLNNFYP DGVEVHNAKTKPREEQFNSTYRVVSVLTVL REAKVQWKVDN ALQ S HQDWLNGKEYKCKVSNKGLPSSIEKTISKAK GNSQESVTEQDSKDST GQPREPQVY TLPPSQEEMTKNQVSLTCLVKG Y SLS STLTLSKAD YEKH FYPSDIAVEWESNGQPENNYKTTPPVLDSDG KVYACEVTHQGLSSrW SFFLYSRLTVDKSRWQEGNVFSCSVMHEAL TKSFNRGEC (SEQ ID HNHYTQKSLSLSLG (SEQ ID NO: 13) NO: 14)PHRHL- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 307 GYYWSWVRQHPGKGLEWIGHFYDGGNTY KPASISCRSSQSLVYSD YNPSLKSRVTISVDTSKN QFSLKLSSVTAAD GN TYLSWFQQRPGQ SP TAVYYCAGTGPVFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISR PVTVSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVWPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKR VESKYGPPCPPCPAPEFLGGPSVFLFPPKPKD TVAAPSVFIFPPSDEQL TLMISRTPEVTCVVVDVSQEDPEVQFNWYV KSGTASVVCLLNNFYP DGVEVHNAKIKPREEQFNS TYRVVSVLTVL REAKV QWKVDN ALQ S HQDWLNGKEYKCKVSNKGLPSSIEKTISKAK GNSQESVTEQDSKDST GQPREPQVYTLPPSQEEMTKNQVSLTCLVKG YSLS STLTLSKADYEKH FYPSDIAVEWESNGQPENNYKTTPPVLDSDG KVYACEVTHQGLSSPV SFFLYSRLTVDKSRWQEGNVFSCSVMHEAL TKSFNRGEC (SEQ ID HNHYTQKSLSLSLG (SEQ ID NO: 15) NO: 16)PHRHL- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 308 GYYWSWVRQHPGKGLEWIGHFYDGGNTY KPASISCRSSQSLDYSDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Antibody Light chain (LC) Heavy chain (HC) sequenceID sequence YNPSLKSRVHSVDTSKNQFSLKLSSVTAAD GNTYLSWFQQRPGQSP TAVYYCAGTGPVFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISR PVTVSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKR VESKYGPPCPPCPAPEFLGGPSVFLFPPKPKD TVAAPSVFIFPPSDEQL TLMISRTPEVTCVVVDVSQEDPEVQFNWYV KSGTASVVCLLNNFYP DGVEVHNAKTKPREEQFNSTYRVVSVLTVL REAKVQWKVDN ALQ S HQDWLNGKEYKCKVSNKGLPSSIEKTISKAK GNSQESVTEQDSKDST GQPREPQVY TLPPSQEEMTKNQVSLTCLVKG Y SLS STLTLSKAD YEKH FYPSDIAVEWESNGQPENNYKTTPPVLDSDG KVYACEVTHQGLSSrW SFFLYSRLTVDKSRWQEGNVFSCSVMHEAL TKSFNRGEC (SEQ ID HNHYTQKSLSLSLG (SEQ ID NO: 17) NO: 18)PHRHL- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 309 GYYWSWVRQHPGKGLEWIGHFYDGGNTY KPASISCRSSQSLAYSD YNPSLKSRVTISVDTSKN QFSLKLSSVTAAD GN TYLSWFQQRPGQ SP TAVYYCAGTGPVFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISR PVTVSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKR VESKYGPPCPPCPAPEFLGGPSVFLFPPKPKD TVAAPSVFIFPPSDEQL TLMISRTPEVTCVVVDVSQEDPEVQFNWYV KSGTASVVCLLNNFYP DGVEVHNAKIKPREEQFNS TYRVVSVLTVL REAKV QWKVDN ALQ S HQDWLNGKEYKCKVSNKGLPSSIEKTISKAK GNSQESVTEQDSKDST GQPREPQVYTLPPSQEEMTKNQVSLTCLVKG YSLS STLTLSKADYEKH FYPSDIAVEWESNGQPENNYKTTPPVLDSDG KVYACEVTHQGLSSPV SFFLYSRLTVDKSRWQEGNVFSCSVMHEAL TKSFNRGEC (SEQ ID HNHYTQKSLSLSLG (SEQ ID NO: 19) NO: 20)PHRHL- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 310 GYYWSWVRQHPGKGLEWIGHFYDGGNTY EPASISCRSSQSLVYSDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Antibody Light chain (LC) Heavy chain (HC) sequenceID sequence YNPSLKSRVTISVDTSKNQFSLKLSSVTAAD GNTYLSWFQQRPGQSP TAVYYCAGTGPVFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISR PVTVSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKR VESKYGPPCPPCPAPEFLGGPSVFLFPPKPKD TVAAPSVFIFPPSDEQL TLMISRTPEVTCVVVDVSQEDPEVQFNWYV KSGTASVVCLLNNFYP DGVFVHNAKTKPREEQFNSTYRVVSVLTVL REAKVQWKVDN ALQ S HQDWLNGKEYKCKVSNKGLPSSIEKTISKAK GNSQESVTEQDSKDST GQPREPQVY TLPPSQEEMTKNQVSLTCLVKG Y SLS STLTLSKAD YEKH FYPSDIAVEWESNGQPENNYKTTPPVLDSDG KVYACEVTHQGI. SSPV SFFLYSRLTVDKSRWQEGNVFSCSVMHEAL TKSFNRGEC (SEQ ID HNHYTQKSLSLSLG (SEQ ID NO: 21) NO: 22)PHRHL- QVQLQESGPGLVKPSQALSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 311 GYYWSWVRQHPGKGLEWIGHFYDGGNTY KPASISCRSSQSLVYSD YNPSLKSRVTISVDTSKN QFSLKLSSVTAAD GN TYLSWFQQRPGQ SP TAVYYCAGTGPVFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISW PVTVSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVWPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKRV (SEQ ID NO: 23) TVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYP REAKV QWKVDN ALQ S GNSQESVTEQDSKDST YSLS STLTLSKADYEKI I KVYACEVTHQGLSSPV TKSFNRGEC (SEQ ID NO: 24)PHRHL- QVQLQESGPGLVKPSQTTSLTCTVSGGSISSG DVVMTQSPLSLPVTLG 312 G YYWSWVRQI IPGKGLEWIGYF YDGGNTY KPASISCRSSQSLVYSDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Antibody Light chain (LC) Heavy chain (HC) sequenceID sequence YNPSLKSRVTISVDTSKNQFSLKLSSVTAAD GNTYLSWFQQRPGQSP TAWYCAGTGPDFDYWGQGTLVTVSSAST RRLIYKVSNRDFGVPD KGPSVFPLAPCSRSTSESTAALGCLVKDYFPE RFSGSGSGTDFTLKISW PVWSWNSGALTSGVHTFPAVLQSSGLYSLS VEAEDVGVYYCMQGT SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKR HWPPTFGQGTKVEIKRV (SEQ ID NO: 25) TVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYP REAKVQWKVDN ALQ S GNSQESVTEQDSKDST Y SLS STLTLSKAD YEKH KVYACEVT1-1QGLSSPV TKSFNRGEC (SEQ ID NO: 26)

[0075] in some embodiments, provided herein is a CD24 antibody comprising:a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70% sequence identity thereto; and a 1 ight chain (LC) comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence comprising at least 70% sequence identity thereto;b) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence comprising at least 70% sequence identity thereto;c) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence comprising at least 70% sequence identity thereto;d) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC)Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence comprising at least 70% sequence identity thereto;e) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence comprising at least 70% sequence identity thereto;f) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence comprising at least 70% sequence identity thereto;g) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence comprising at least 70% sequence identity thereto;h) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 15, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence comprising at least 70% sequence identity thereto;i) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence comprising at least 70% sequence identity thereto;j) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 19, or an ammo acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence comprising at least 70% sequence identity thereto;k) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence comprising at least 70% sequence identity thereto;l) a heavy' chain (HC) comprising the amino acid sequence of SEQ ID NO: 23, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chainAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 (LC) comprising the amino acid sequence of SEQ ID NO: 24, or an amino acid sequence comprising at least 70% sequence identity thereto; orm) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising tire amino acid sequence of SEQ ID NO: 26, or an amino acid sequence comprising at least 70% sequence identity thereto,

[0076] In some embodiments, provided herein is a CD24 antibody comprising a heavy chain (HC) and a light chain (LC), wherein the HC comprises the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70%, 71%, 72%, Ti, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a VL, wherein the HC consists of tire amino acid sequence of SEQ ID NO: 1, and the LC consists of the amino acid sequence of SEQ ID NO: 2,

[0077] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%. 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%. 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a VL, wherein the HC consists of the amino acid sequence of SEQ ID NO: 3, and the LC consists of the amino acid sequence of SEQ ID NO: 4.

[0078] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 91%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, in some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 5, and the LC consists of the amino acid sequence of SEQ ID NO: 6.|0079] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 8, or an ammo acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 7, and the LC consists of the amino acid sequence of SEQ ID NO: 8.

[0080] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein tire HC comprises the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 9, and the LC consists of the amino acid sequence of SEQ ID NO: 10.

[0081] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%. 75%, 76%, 77%, 78%, 79%, 80%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of tire amino acid sequence of SEQ ID NO: 11, and the LC consists of the amino acid sequence of SEQ ID NO: 12.

[0082] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC composes the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 13, and the LC consists of the amino acid sequence of SEQ ID NO: 14.

[0083] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 15, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of tire amino acid sequence of SEQ ID NO: 15, and the LC consists of the amino acid sequence of SEQ ID NO: 16.

[0084] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 17, or an amino acidAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence comprising at least 70%, 71%, 72?% 73%, 74%, 75%. 76%, 77%, 78%. 79%, 80%, 81%. 82%, 83%, 84?% 85?% 86%, 87?% 88%, 89%, 90%, 91%, 92?% 93%, 94%, 95?% 96%, 97%, 98?% or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 17, and the LC consists of the amino acid sequence of SEQ ID NO: 18.

[0085] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence comprising at least 70%, 71%, 72?% 73%, 74%, 75?% 76%, 77%, 78?% 79%, 80%, 81%, 82%, 83%, 84?% 85%, 86%, 87?% 88%, 89%, 90?% 91%, 92%, 93?% 94%, 95%, 96%, 97?% 98?% or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence comprising at least 70%, 71?% 72%, 73%, 74?% 75%, 76%, 77?% 78%, 79%, 80?% 81%, 82%, 83?% 84%, 85%, 86?% 87%, 88%, 89%, 90?% 91?% 92%, 93?% 94?% 95%, 96?% 97?% 98%, or 99?% sequence identity’ thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 19, and the LC consists of the amino acid sequence of SEQ ID NO: 20.

[0086] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83?% 84%, 85%, 86?% 87?% 88%, 89?% 90%, 91%, 92?% 93%, 94%, 95?% 96%, 97?% 98%, or 99?o sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence comprising at least 70?% 71%, 72?% 73%, 74%, 75?% 76%, 77%, 78?% 79%, 80?% 81?% 82?% 83%, 84?% 85?% 86?% 87?% 88?% 9%, 90%, 91%, 92?% 93%, 94%, 95?% 96? 97%, 98?% or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 21, and the LC consists of the amino acid sequence of SEQ ID NO: 22,Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 |0087] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 23, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 24, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%. 96%, 97%, 98%. or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of the amino acid sequence of SEQ ID NO: 23, and the LC consists of the amino acid sequence of SEQ ID NO: 24.

[0088] In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC comprises the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the LC comprises the amino acid sequence of SEQ ID NO: 26, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a HC and a LC, wherein the HC consists of tire amino acid sequence of SEQ ID NO: 25, and the LC consists of the amino acid sequence of SEQ ID NO: 26.

[0089] In some embodiments, provided herein is a CD24 antibody comprising:a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising tire amino acid sequence of SEQ ID NO: 2, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%. 78%, 79%, 80%, 81%, 82%, 83%. 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; andAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively.b) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively.c) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77?% 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%. 97%, 98%, or 99?i> sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence comprising at least 70?<>, 71%, 72%, 73?% 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively.d) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence comprising at least 70?% 71%, 72%, 73?% 74%, 75%, 76?% 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90?% 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88?% 89%, 90%, 91 %, 92%, 93%, 94?4>, 95%, 96%, 97?4>, 98%, or 99% sequence identity' thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising theAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively.e) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity' thereto; wherein the HC comprises a CDRHI, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively.I a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence comprising at least 70?% 71%, 72%, 73%. 74%, 75%, 76%. 77%, 78%, 79%. 80%, 81%, 82%. 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%. 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.g) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74?4>, 75%, 76%, 77?4>, 78%, 79%, 80%, 81%, 82%. 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95?% 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identityAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.h) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 15, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%. 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%. 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.i) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74?% 75%, 76%, 77%. 78%, 79%, 80%. 81%, 82%, 83%. 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.j) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74?4>, 75%, 76%, 77'%. 78%, 79%, 80%, 81%, 82%. 83%, 84%, 85%. 86%, 87%, 88%. 89%, 90%, 91?% 92%, 93%, 94%, 95%, 96%. 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence comprising at least 70?% 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%,Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.k) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.l) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 23, or an amino acid sequence comprising at least 70?% 71%, 72%, 73?% 74%, 75%, 76?% 77%, 78%, 79%, 80%, 81?% 82%, 83%, 84?% 85%, 86%, 87?% 88%, 89%, 90?% 91%, 92%, 93?% 94%, 95%, 96%, 97?% 98%, or 99?4 sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 24, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88?% 89%, 90%, 91?% 92%, 93%, 94?% 95%, 96%, 97?% 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; orm) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80?% 81%, 82%, 83?% 84%, 85%, 86?% 87%, 88%, 89?% 90%, 91%, 92?% 93%, 94%, 95%, 96?% 97%, 98%, or 99% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 26, or an amino acid sequence comprising at least 70?%Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

[0090] Table 2 provides exemplary heavy chain variable (VII) and light chain variable (VL) sequences of the CD24 antibodies of the disclosure. Antibody complementarity determining regions (CDRs) (as determined by Rabat) are indicated in bold.Table 2: Exemplary VH / VL sequences of CD24 antibodiesHeavy chain variable region (VII) Light chain variable region (VL)sequence sequence QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEW1GHF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDSGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISRV SLKLSSVTAADTAVYYCAGTGIDFDY EAEDVGVYYCMQGTHWPPTFGQGTK WGQGTLVTVSS (SEQ ID NO: 27) VEIK (SEQ ID NO: 28) QVQLVQSGAEVKKPGASVKVSCKASG DIVMTQSPLSLPVTPGEPASISCRSSQSL YPFKTYDFNWVRQATGQGLEWMGW LHSNGYNFLDWYLQKPGQSPQLLIYL MNPNSGNTGYAQKFQGRVTMTRDTS GSNRASGVPDRFSGSVSGTDFTMKISR ISTAYMDLNSLKSDDTAVYYCARGNW VEAADVGVYYCMQVLQTPLTFGGGT GLDYWGQGTLVTVSS (SEQ ID NO: 29) KVEIK (SEQ ID NO: 30) QVQLVESGGGLVKPGGSLRLSCAASGF DVVMTQSPLSLPVTLGQPASISCRSSQS TFSDYYMSWIRQAPGKGLEWVSYITG LVNSDGNIYLNWFQQRPGQSPRRLIYK DGRTIYYADSVKGRFTISRDNAKNSLY VSNRDSGVPDRFSGSGSGTDFTLKISRV LQMN SLRAEDTAVY YCAGTGTTRDF EAEDVGVYYCMQGSHWPLTVGGGTK WGQGTLVTVSS (SEQ ID NO: 31) VEIK (SEQ ID NO: 32) QVQLVESGGGLVKPGGSLRLTCAASGF DVVMTQSPLSLPVTLGQPASISCWSSRS TFSDYYMSWIRQAPGKGLEWLSYFSG LVHSDGRTYLTWFQQRPGQSPRRL1Y SGSIRYYADSVKGRFT1SRDNAKNSLF KVSNRDSGVPDRFSGSGSGTDFTLKISRAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Heavy chain variable region (VH) Light chain variable region (VL)sequence sequence LQM?< SLRAEDTAVYYCARDDDN\VGQ VEAEDVGVYWCLQGSHWPFTFGPGTK GTLVTVSS (SEQ ID NO: 33) VD1K (SEQ ID NO: 34) EVQLVESGGGLVQPGGSLRLSCAASGF DVVMTQSPLSLPVILGQPASISCRSSQS TFNTYWMSWVRQAPGKGLEWVANIK LVYSDGNTYLNWFQQRPGQSPRRLIY KDGSEKYYVDSVKGRFTISRDNAKNS KVSNRDSGVPDRFSGSGSGTDFTLKISR LYLQMNSLRAEDTAVYYCARDGEDN VEAED VG VYYCMQG SHWPP VTFGGG WGQGTLVTVSS (SEQ ID NO: 35) TKVEIK (SEQ ID NO: 36) QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISW SLKLS SVTA ADTA VYYCAGTGPDFD Y VEAEDVGVYYCMQGTHWPPTFGQGT WGQGTLVTVSS (SEQ ID NO: 37) KVEIK (SEQ ID NO: 38) QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISW SLKLSSVTAADTAVYYCAGTGPDFDY VEAEDVGVYYCMQGTHWPPTFGQGT WGQGTLVTVSS (SEQ ID NO: 39) KVEIK (SEQ ID NO: 40) QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISRV SLKLSSVTAADTAVYYCAGTGPVFDY EAED VGVY YCMQGTHWPPTFGQGTK WGQGTLVTVSS (SEQ ID NO: 41) VEIK (SEQ ID NO: 42) QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LDYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISRV SLKLSSVTAADTAVYYCAGTGPVFDY EAED VG VYYCMQGTH WPPTFGQGTK WGQGTLVTVSS (SEQ ID NO: 43) VEIK (SEQ ID NO: 44) QVQLQESGPGL VKPSQTLSLTC TVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LAYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISRVAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 Heavy chain variable region (VH) Light chain variable region (VL)sequence sequence SLKLS SVTA ADTA VYYCAGTG P VFD Y EAEDVGVYYCMQGTHWPPTFGQGTK WGQGTLVTVSS (SEQ ID NO: 45) VEIK (SEQ ID NO: 46) QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGEPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRF SGSGSGTDFTLK1SRV SLKLSSVTAADTAVYYCAGTGPVFDY EAFDVGVYYCMQGTllAVPPTFGQGTK WGQGTLVTVSS (SEQ ID NO: 47) VEIK (SEQ ID NO: 48) QVQLQESGPGLVKPSQALSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGHF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISW SLKLSSVTAADTAVYYCAGTGPVFDY VEAEDVGVYYCMQGTHWPPTFGQGT WGQGTLVTVSS (SEQ ID NO: 49) KVEIK (SEQ ID NO: 50) QVQLQESGPGLVKPSQTLSLTCTVSGG DVVMTQSPLSLPVTLGKPASISCRSSQS SISSGGYYWSWVRQHPGKGLEWIGYF LVYSDGNTYLSWFQQRPGQSPRRLIYK YDGGNTYYNPSLKSRVTISVDTSKNQF VSNRDFGVPDRFSGSGSGTDFTLKISW SLKLSSVTAADTAVYYCAGTGPDFDY VEAEDVGVYYCMQGTHWPPTFGQGT WGQGTLVTVSS (SEQ ID NO: 51) KVEIK (SEQ ID NO: 52)

[0091] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 27, and the VL consists of the amino acid sequence of SEQ ID NO: 28.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 |0092] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 29, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 29, and the VL consists of the amino acid sequence of SEQ ID NO: 30.

[0093] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 31, and the VL consists of the amino acid sequence of SEQ ID NO: 32.

[0094] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%. 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein theAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 VH consists of the amino acid sequence of SEQ ID NO: 33, and the VL consists of the amino acid sequence of SEQ ID NO: 34.

[0095] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VI.,, wherein the VH comprises the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 35, and the VL consists of the amino acid sequence of SEQ ID NO: 36.

[0096] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 37, and tire VL consists of the amino acid sequence of SEQ ID NO: 38,

[0097] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. InAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein die VH consists of the amino acid sequence of SEQ ID NO: 39, and the VL consists of the amino acid sequence of SEQ ID NO: 40,

[0098] in some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%. 85%, 86%, 87%. 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 41, and the VL consists of the amino acid sequence of SEQ ID NO: 42.

[0099] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%. 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the ammo acid sequence of SEQ ID NO: 43, and the VL consists of the amino acid sequence of SEQ ID NO: 44.

[0100] in some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 45, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%. 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the ammo acid sequence of SEQ ID NO: 45, and the VL consists of the amino acid sequence of SEQ ID NO: 46.

[0101] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 47, and the VL consists of the amino acid sequence of SEQ ID NO: 48.

[0102] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 49, or an ammo acid sequence comprising at least 70%, 71%, 72%, 73%, 74%. 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 49, and the VL consists of tire amino acid sequence of SEQ ID NO: 50.

[0103] In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH comprises the amino acid sequence of SEQ ID NO: 51, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the VL comprises the amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70%, 71 %, 72%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, provided herein is a CD24 antibody comprising a VH and a VL, wherein the VH consists of the amino acid sequence of SEQ ID NO: 51, and the VL consists of the amino acid sequence of SEQ ID NO: 52.

[0104] In some embodiments, provided herein is a CD24 antibody comprising:a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;b) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 29, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%. 80%, 81%, 82%. 83%, 84%, 85%, 86%, 87%, 88%. 89%, 90%, 91%, 92%, 93%, 94%, 95%. 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the VL comprises a CDRLl, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;c) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity' thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;d) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively;e) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%. 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, or 99% sequence identity' thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively;f) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70%, 71%, 72%, 73 %, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;g) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%. 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%. 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;h) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;i) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity’ thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;j) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 45, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%. 80%, 81%, 82%. 83%, 84%, 85%, 86%, 87%, 88%. 89%, 90%, 91%, 92%, 93%, 94%, 95%. 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;k) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity' thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;l) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 49, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; orm) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 51, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%. 88%, 89%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, or 99% sequence identity' thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

[0105] Also included are variants thereof that bind to CD24, for example, variants having 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions, additions, and / or deletions in one or more framework regions of any one or more of the foregoing VH and / or VL sequences.

[0106] Table 3 provides exemplary combinations of six CDRs of the CD24 antibodies of the disclosure.Table 3: Exemplary CDR combinations of CD24 antibodiesIICDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 SGGYYWS HFYDSGNT TGIDFDY CRSSQSLV YKVSNRD CMQGTHW(SEQ ID NO: YYNPSLKS (SEQ ID NO: YSDGNTYL (SEQ ID NO: PPT (SEQ ID 53) (SEQ ID NO: 55) (SEQ ID NO: 57) NO: 58)54) 56)IYDFN WMNPNSG GNWGLDY CRSSQSLL YLGSNRA CMQVLQTP(SEQ ID NO: NTGYAQKF (SEQ ID NO: HSNGYNFL (SEQ ID NO: LT (SEQ ID 59) QG (SEQ ID 61) (SEQ ID NO: 63) NO: 64)NO: 60) 62)DYYMS YITGDGRTI TGTTRDF RSSQSLVN KVSNRDS MQGSHWP(SEQ ID NO: YYADSVK (SEQ ID NO: SDGNIYLN (SEQ ID NO: LT (SEQ ID 65) G (SEQ ID 67) (SEQ ID NO: 69) NO: 70)NO: 66) 68)DYYMS YFSGSGSIR DDDN (SEQ WSSRSLVH KVSNRDS LQGSHWPF (SEQ ID NO: YYADSVK ID NO: 72) SDGRTYLT (SEQ ID NO: T (SEQ ID 65) G (SEQ ID (SEQ ID NO: 69) NO: 74)NO: 71) 73)IYWMS NIKKDGSE DGEDN RSSQSLVY KVSNRDS MQGSHWP(SEQ ID NO: KYYVDSV (SEQ ID NO: SDGNIYLN (SEQ ID NO: PVT (SEQ 75) KG (SEQ ID 77) (SEQ ID NO: 69) ID NO: 79) NO: 76) 78)SGGYYWS IIFYDGGNT TGPDFDY CRSSQSLV YKVSNRD CMQGTHW(SEQ ID NO: YYNPSLKS (SEQ ID NO: YSDGNTYL (SEQ ID NO: PPT (SEQ ID 53) 80) 82) NO: 83)Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3(SEQ ID NO: (SEQ ID NO:79) 81)SGGYYWS HFYDGGNT TGPVFDY CRSSQSLV YKVSNRD CMQGTHW(SEQ ID NO: YYNPSLKS (SEQ ID NO: YSDGNTYL (SEQ ID NO: PPT (SEQ ID 53) (SEQ ID NO: 84) (SEQ ID NO: 82) NO: 83)79) 81)SGGYYWS HFYDGGNT TGPVFDY CRSSQSLD YKVSNRD CMQGTHW(SEQ ID NO: YYNPSLKS (SEQ ID NO: YSDGNTYL (SEQ ID NO: PPT (SEQ ID 53) (SEQ ID NO: 84) (SEQ ID NO: 82) NO: 83)79) 85)SGGYYWS HFYDGGNT TGPVFDY CRSSQSLA YKVSNRD CMQGTHW(SEQ ID NO: YYNPSLKS (SEQ ID NO: YSDGNTYL (SEQ ID NO: PPT (SEQ ID 53) (SEQ ID NO: 84) (SEQ ID NO: 82) NO: 83)79) 86)SGGYYWS YFYDGGNT TGPDFDY CRSSQSLV YKVSNRD CMQGTHW(SEQ ID NO: YYNPSLKS (SEQ ID NO: YSDGNTYL (SEQ ID NO: PPT (SEQ ID 53) (SEQ ID NO: 80) (SEQ ID NO: 82) NO: 83)87) 81)

[0107] In some embodiments, provided herein is a CD24 antibody comprising a heavy chain complementarity determining region (CDRH) 1, a CDRH2, a CDRH3, a light chain complementarity determining region (CDRL) 1, a CDRL2, and a CDRL3 selected from Table 3.

[0108] in some embodiments, provided herein is a CD24 antibody comprising a heavy chain complementarity determining region (CDRH) 1, a CDRH2, a CDRH3, a light chain complementarity determining region (CDRL) 1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence set forth in:a) SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58;b) SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64;Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 c) SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;d) SEQ ID NO: 65, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74;e) SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79;f) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83;g) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83;h) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83;i) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83; orj) SEQ ID NO: 53, SEQ ID NO: 87, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83.

[0109] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58.

[0110] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64.

[0111] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023

[0112] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRLI, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRLI, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 65, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74.

[0113] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79.

[0114] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83.

[0115] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83.

[0116] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83.

[0117] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83.

[0118] In some embodiments, provided herein is a CD24 antibody comprising a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2,Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence of SEQ ID NO: 53, SEQ ID NO: 87, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83.

[0119] Also provided herein are variants of the foregoing CDRs. In some embodiments, variants bind to CD24 and have 1, 2, or 3 total alterations in any one or more of the individual CDRs, for example, any one or more of the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 sequences described herein. In some embodiments, “alterations” includes amino acid substitutions, additions, and / or deletions.

[0120] In some embodiments, provided herein is a CD24 antibody, wherein:a) the HCDR1 sequence comprises SGGYYWS (SEQ ID NO 53);b) the HCDR2 sequence comprises: X1FYDX2GNTYYNPSLKS (SEQ ID NO: 88), wherein X1=H or Y and X2= G or S.c) the HCDR3 sequence comprises TGX3X4FDY (SEQ ID NO: 89), wherein X3=I or P and X4=D or V;d) the LCDRL1 sequence comprises CRSSQSLX5YSDGNTYL (SEQ ID NO: 90), wherein X5= V, D, or A;e) the LCDRL2 sequence comprises YKVSNRD (SEQ ID NO: 82); andf) the LCDRL3 sequence comprises CMQGTIIWPPT (SEQ ID NO: 83).

[0121] Also provided herein are nucleic acids encoding the antibodies disclosed herein, expression vectors comprising nucleic acids encoding such antibodies, and host cells comprising such vectors. In some embodiments, the vector is a mammalian vector. In some embodiments, the vector is a viral vector.

[0122] Hie CD24 antibodies of the disclosure may be included in antibody drug conjugates, immunotoxins, or radioimmunoconjugates, The CD24 targeting component of such compositions may allow7specific delivery' of the conjugate to the cancer cells or other diseased tissues, w hile limiting exposure of normal cells and tissues and thus preventing off target toxicity.

[0123] The disclosure also provides pharmaceutical compositions comprising any one of the CD24 antibodies disclosed herein, and optionally a pharmaceutical acceptable excipient or carrier. In some embodiments, the pharmaceutical composition is sterile. Hie pharmaceutical compositions may be formulated to be compatible with their intended routes of administration.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 in some embodiments, the pharmaceutical compositions of the disclosure are suitable for administration to a human subject.III. Methods of Use

[0124] The CD24 antibodies of the disclosure, or pharmaceutical compositions comprising such antibodies, may be used to treat or prevent a disease or condition. Accordingly, provided herein are methods of treating or preventing a disease or condition in a subject in need thereof, comprising administering a CD24 antibody of the disclosure, or a pharmaceutical composition comprising the foregoing, to the subject. In some embodiments, the disease or condition comprises cancer, another abnormal proliferative disease, or an immune-related disease. In certain embodiments, the disease or condition comprises cancer. In some embodiments, the subject is a mammal. In certain embodiments, the subject is a human. The subject can be male or female and can be any suitable age, including neonate, infant juvenile, adolescent, adult, and geriatric. In some embodiments, the subject is a neonate. In certain embodiments, the subject is a human neonate and is from 0 days (birth) to 28 days old. In some embodiments, the subject is an infant. In certain embodiments, the subject is a human infant and is from 29 days to less than 2 years old. In some embodiments, the subject is a juvenile. In certain embodiments, the subject is a human juvenile and is from 2 years to less than 12 years old. In some embodiments, the subject is an adolescent. In certain embodiments, the subject is a human adolescent and is from 12 years to less than 22 years old. In some embodiments, the subject is an adult. In certain embodiments, the subject is a human adult and is at least 18, at least 19, at least 20, at least 21, or at least 22 years old. In certain embodiments, the subject is less than 65 years old. In some embodiments, the subject is a geriatric subject. In certain embodiments, the subject is a human geriatric subject and is at least 65 years old.

[0125] In some embodiments, the subject has been diagnosed with a solid tumor.

[0126] In some embodiments, the subject has undergone a surgical procedure; in some embodiments, the subject has not undergone any surgical procedure. In some embodiments, the subject has previously received at least one anticancer agent and / or therapy. Other anticancer agents and / or therapy are further described below. The anticancer agents or therapeutic modalities include currently available and emerging anticancer therapeutics and modalities, including investigational agents and strategies not explicitly listed herein.

[0127] The CD24 antibodies of the disclosure, or pharmaceutical compositions comprising such antibodies, may also be used in the manufacture of a medicament for treating or preventingAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 a disease or condition. Accordingly, provided herein are uses of an antibody of the disclosure or a pharmaceutical composition of tire disclosure in the manufacture of a medicament for the treatment of a disease or condition. Also provided herein is an antibody of the disclosure or a pharmaceutical composition of the disclosure for use in the treatment of a disease or condition. In some embodiments, the disease or condition comprises cancer, another abnormal proliferative disease, or an immune-related disease. In certain embodiments, the disease or condition comprises cancer.

[0128] As used herein, the term "‘cancer” refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells. As used herein, cancer explicitly includes both solid cancers, as well as blood cancers such as leukemias and lymphomas. The term also refers to a disease involving cells that have the potential to metastasize to distal sites.

[0129] The cancer or other abnormal proliferative disease may be (but is not limited to) one or more of the following: carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, pancreas, stomach, cervix, thyroid and skin; including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Burkett's lymphoma; hematopoietic tumors of my eloid lineage, including acute and chroni c myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma; other tumors, including melanoma, neuroblastoma and glioma; and tumors of the central and peripheral nervous system.

[0130] In some embodiments, the cancer comprises a solid cancer. In certain embodiments, the solid cancer is a carcinoma or a sarcoma. In exemplary embodiments, the carcinoma is selected from the group consisting of bladder, breast, colon, endometrium, kidney, liver, lung, ovary, pancreas, stomach, cervix, thyroid and skin. In exemplary’ embodiments, the sarcoma is fibrosarcoma or rhabdomyosarcoma.

[0131] in some embodiments, the cancer comprises a hematological cancer. In certain embodiments, the hematological cancer is selected from the group consisting of diffuse large B-cell lymphoma (DLBCL), B-cell lymphoma, T-cell lymphoma, Burkitt’s lymphoma, Chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia, acute myelogenous leukemia, acute myeloid leukemia (AML), acute lymphocytic leukemia, acute lymphoblastic leukemia (ALL), multiple myeloma, follicular lymphoma, mantle cell lymphoma, Hodgkin lymphoma,Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 non-Hodgkin lymphoma, hematopoietic tumors of lymphoid lineage, hematopoietic tumors of myeloid lineage, promyelocytic leukemia, and myelodysplastic syndromes (MDS).

[0132] In some embodiments, the cancer is relapsed and / or refractory'. These classifications are intended to encompass both primary and metastatic disease, and may include cancers that have failed prior therapies or that exhibit resistance to standard treatments. In some embodiments, the cancer is an advanced cancer. In some embodiments, the cancer is a relapsed cancer. In some embodiments, the cancer is a refractory- cancer. In some embodiments, the cancer is an advanced relapsed cancer. In some embodiments, the cancer is an advanced refractory cancer. In some embodiments, the cancer is an advanced relapsed and / or refractory cancer. In some embodiments, the cancer is an advanced relapsed and / or refractory solid tumor.

[0133] in some embodiments, the cancer is CD24-positive. CD24 mRNA or protein expression levels can be determined, for example, using a diagnostic assay or any method known in the art.

[0134] The immune-related disease may be (but is not limited to) one or more of the following: sepsis, tissue damage-induced inflammation, rheumatoid arthritis, and multiple sclerosis. In some embodiments, the immune -related disease is sepsis. In some embodiments, the immune-related disease is tissue damage-induced inflammation. In some embodiments, the immune- related disease is rheumatoid arthritis. In some embodiments, the immune-related disease is multiple sclerosis.

[0135] it is also contemplated that cancers caused by aberrations in apoptosis would also be treated by the methods and compositions of the disclosure. Such cancers may include, but are not limited to carcinomas with mutations, follicular lymphomas, hormone dependent tumors of the breast, prostate and ovary, and precancerous lesions.

[0136] In some embodiments, the CD24 antibodies thereof may be included in antibody drug conjugates, immunotoxins, or radioimmunoconjugates. Tire anti-CD24 targeting component of such compositions may allow specific deliver}' of the conjugate to the cancer cells and tissues, while limiting exposure of normal cells and tissues and thus preventing off target toxicity.

[0137] In some embodiments, CD24 antibodies may be used to stimulate cancer cell death through at least one of antibody-mediated cellular cytotoxicity (ADCC) and antibody-mediated cellular phagocytosis (ADCP).

[0138] In other embodiments, antibodies, the antibodies provided herein may also be used for diagnostic purposes. For example, diagnostic antibodies could be used for detecting the presenceAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 of a CD24-mediated disorder, or for detecting CD24 levels in a subject prior to dosing (e.g. as a companion diagnostic).

[0139] In some embodiments, CD24 antibodies may be expressed in a suitable host cell. The suitable host cell may be derived from (but is not limited to) one or more of the following: yeast, insects, amphibians, fish, reptiles, birds, mammals or humans, or fusion tumors. The host cell may be an unmodified cell or cell line, or a genetically modified cell or cell line,

[0140] In other embodiments, the antigen binding domain of the CD24 antibody (e.g., a single chain variable fragment (scFv)) may be linked to T-cell receptor signaling or T-cell receptor activation domains to construct a chimeric antigen receptor (CAR), lire CAR may be expressed in mammalian or non-mammalian cells. In some embodiments the cells are immune cells. In some embodiments the immune cells are T cells (CAR T cells). In other embodiments, the immune cells are NK cells (CAR NK cells).IV. Combination Therapies

[0141] Hie administration of any one of the CD24 antibodies or pharmaceutical compositions comprising such antibodies provided herein may be in combination with any other known drags, agents, treatments, or therapies for diseases or conditions described herein. For example, the CD24 antibodies and pharmaceutical compositions may be used in combination with one or more anticancer agents or therapeutic modalities, including but not limited to, current standard and experimental chemotherapies, hormonal therapies, biological therapies, immunotherapies, radiation therapies, or surgery. The anticancer agents or therapeutic modalities include currently available and emerging anticancer therapeutics and modalities, including investigational agents and strategies not explicitly listed herein. Tire combination regimen may be tailored to the specific cancer types, stage, or treatment objective. Exemplary' combinations, e.g. for the treatment of a cancer, includes one of the CD24 antibodies of the disclosure, administered in conjunction with a cytotoxic agent, such as a platinum-based chemotherapy, and an immunotherapy, such as a T cell checkpoint inhibitor. The combination regimen may be tailored to the specific cancer types, stage, or treatment objective.

[0142] In some embodiments, the additional anticancer agent or therapy is selected from the group consisting of: radiation therapy, surgical intervention, a cytotoxic agent, an immunotherapy, a hormonal therapy, and a biological therapy.

[0143] In some embodiments, the cytotoxic agent is a platinum-based chemotherapeutic, taxane, or anthracy cline.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023

[0144] In some embodiments, the immunotherapy is a checkpoint inhibitor, cytokine or chemokine-based agent, or a T-cell engager.

[0145] In some embodiments, the biological therapy is a monoclonal antibody, bispecific antibody, antibody-drug conjugate (ADC), or fusion protein.

[0146] In some embodiments, the CD24 antibody is administered in combination with an adoptive cell therapy. Non-limiting examples include therapies employing engineered or nonengineered immune cells such as T cells (including CAR-T or TCR-T cells), B cells, natural killer (NK) cells, or macrophages.

[0147] In some embodiments, the CD24 antibody is administered in combination with an anticancer vaccine. Such vaccines may include tumor-associated antigens or neoantigens, and may be administered prophylactically or therapeutically to enhance the antitumor immune response.

[0148] The agents or therapies may be administered sequentially or concurrently, with overlapping or staggered dosing schedules. In some embodiments, the CD24 antibody is administered within a defined time window before, during, or after administration of the additional agent or therapy.V. Administration of CD24 Antibodies

[0149] The CD24 antibodies and pharmaceutical compositions described herein may be administered via any suitable route. The route may be selected based on the clinical context, patient characteristics, or desired pharmacokinetic and pharmacodynamic properties. Non¬ limiting examples of administration routes include intravenous, intramuscular, subcutaneous, topical, oral, transdemial, intraperitoneal, intraorbital, intrathecal, intraventricular, intranasal, transmucosal, through implantation, or through inhalation. Intravenous administration may be carried out via injection or infusion. In some embodiments, the CD24 antibodies of the disclosure are administered intravenously. In some embodiments, the CD24 antibodies of the disclosure are administered intraperitoneally. In some embodiments, the CD24 antibodies of the disclosure are administered subcutaneously. Administration of the CD24 antibodies may be performed with any suitable excipients, carriers, or other agents to provide suitable or improved tolerance, transfer, de lively, and the like.

[0150] In some embodiments, localized delivery may be used to increase therapeutic concentration at the tumor site or to reduce systemic exposure. The use in pediatric settings may involve age-specific dosing formulations, or safety considerations.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023

[0151] In some embodiments, the antibody is administered at the time of initial diagnosis or as a first-line therapy. In some embodiments, the CD24 antibody is administered as monotherapy; while in other embodiments the CD24 antibody is administered in combinations with other agents, as further detailed herein.VI. Kits and Articles of Manufacture

[0152] The disclosure also provides a kit or article of manufacture comprising any one of the antibodies disclosed herein, or any pharmaceutical composition disclosed herein. In some embodiments, the kits may further include instructional materials for carrying out any of the methods disclosed herein. In some embodiments, the kits may further include sterile containers or vials for holding the antibodies and / or pharmaceutical compositions disclosed herein. In some embodiments, the kits may further include sterile delivery' devices for administering the antibodies and / or pharmaceutical compositions disclosed herein. In some embodiments, an article of manufacture comprises any pharmaceutical composition of the disclosure.EMBODIMENTS

[0153] Embodiment 1-1. A CD24-specific antibody comprising the complementarity' determining regions (CDRs) as set forth in:a) SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58;b) SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64;c) SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;d) SEQ ID NO: 65, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74;e) SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79;f) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83;g) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83:Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 h) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83;i) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83; orj) SEQ ID NO: 53, SEQ ID NO: 87, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83,

[0154] Embodiment 1-2. A CD24-specific antibody comprising:a) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70% sequence identity thereto;b) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 29, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70% sequence identity thereto;c) a variable heavy region ( VH) comprising the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70% sequence identity thereto;d) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70% sequence identity thereto;e) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70% sequence identity thereto;f) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70% sequence identity thereto;Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 g) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70% sequence identity thereto;h) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70% sequence identity thereto;i) a variable heavy region ( VH) comprising the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70% sequence identity thereto;j) a variable heavy region (VH) comprising the ammo acid sequence of SEQ ID NO: 45, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70% sequence identity thereto;k) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70% sequence identity thereto;l) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 49, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70% sequence identity thereto; orm) a variable heavy region (VH) comprising the amino acid sequence of SEQ ID NO: 51, or an amino acid sequence comprising at least 70% sequence identity thereto; and a variable light region (VL) comprising tire amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70% sequence identity’ thereto.

[0155] Embodiment 1-3. The CD24-specific antibody of embodiment 1-2, comprising:a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC)Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence comprising at least 70% sequence identity thereto;b) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence comprising at least 70% sequence identity’ thereto;c) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence comprising at least 70% sequence identity thereto;d) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence comprising at least 70% sequence identity thereto;e) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence comprising at least 70% sequence identity thereto;I) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence comprising at least 70% sequence identity thereto;g) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence comprising at least 70% sequence identity thereto;h) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 15, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence comprising at least 70% sequence identity thereto;i) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chainAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 (LC) comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence comprising at least 70% sequence identity thereto;j) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising tire amino acid sequence of SEQ ID NO: 20, or an amino acid sequence comprising at least 70% sequence identity thereto;k) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence comprising at least 70% sequence identity thereto;l) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 23, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 24, or an amino acid sequence comprising at least 70% sequence identity thereto; orm) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 26, or an amino acid sequence comprising at least 70% sequence identity thereto.

[0156] Embodiment 1-4. The antibody of any one of embodiments 1-1 to 1-2, wherein the antibody is humanized.

[0157] Embodiment 1-5. The antibody of any one of embodiments 1-1 to 1-4, wherein the antibody is a full length antibody.

[0158] Embodiment 1-6. Hie antibody of any one of embodiments 1-1 to 1-4, wherein the antibody is an antigen-binding antibody fragment.

[0159] Embodiment 1-7. Tire antibody of any one of embodiments I- 1 to 1-6, wherein the antibody comprises a Fc domain, and the Fc domain is selected from the group consisting of a human IgGl, IgG2, IgG3, and IgG4 heavy chain sequence.

[0160] Embodiment 1-8. The antibody of any one of embodiments 1-1 to 1-7, wherein the binding of the antibody does not disrupt the interaction between CD24 and Siglec-10.

[0161] Embodiment 1-9. Hie antibody of any one of embodiments 1-1 to 1-7, wherein the binding of the antibody disrupts the interaction between CD24 and Siglec-10.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023

[0162] Embodiment I- 10. The antibody of any one of embodiments 1-1 to 1-9, wherein, the antibody binds human CD24 and cynomolgus monkey CD24.

[0163] Embodiment 1-11, The antibody comprising of anyone of embodiments 1-1 to 1-10, wherein the antibody comprises a binding affinity to CD24 lower than about 500 nM.

[0164] Embodiment 1-12. A pharmaceutical composition comprising the antibody of any one of embodiments 1-1-11, and optionally a pharmaceutically acceptable carrier.

[0165] Embodiment 1-13. A nucleic acid encoding for the antibody of any one of embodiments 1-1 to 1-11.

[0166] Embodiment 1-14. A vector comprising the nucleic acid of embodiment 1-13.

[0167] Embodiment 1-15, A method of treating a disease or condition in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the antibody of any one of embodiments 1-1 to 1-11 or the pharmaceutical composition of embodiment 1-12.

[0168] Embodiment 1-16. The method of embodiment 1-15, wherein the disease or condition comprises cancer.

[0169] Embodiment 1-17. lire method of embodiment 1-16, wherein the cancer comprises a solid cancer.

[0170] Embodiment 1-18. The method of embodiment 1-17, wherein the solid cancer is a carcinoma or a sarcoma.

[0171] Embodiment 1-19. The method of embodiment 1-18, wherein the carcinoma is selected from the group consisting of bladder, breast, colon, kidney, liver, lung, ox an. pancreas, stomach, cervix, thyroid and skin.

[0172] Embodiment 1-20. lire method of embodiment 1-18, wherein the sarcoma is fibrosarcoma or rhabdomyosarcoma.

[0173] Embodiment 1-21. The method of embodiment 1-16, wherein the cancer comprises a hematological cancer.

[0174] Embodiment 1-22. The method of embodiment 1-21, wherein the hematological cancer is selected from the group consisting of acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Burkett's lymphoma; acute myelogenous leukemia, chronic myelogenous leukemia, and promyelocytic leukemia.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 |0175] Embodiment 1-23. The method of embodiment 1-16, wherein the cancer is selected from the group consisting of melanoma, neuroblastoma, glioma, tumors of the central nervous system, and tumors of the peripheral nervous system.

[0176] Embodiment 1-24. The method of any one of embodiments 1-15 to 1-23, wherein the route of administration is intravenous or subcutaneous administration.

[0177] Embodiment 1-25. The method of any one of embodiments 1-15 to 1-24, wherein the subject is human.Set II

[0178] Embodiment II- 1, A CD24-specific antibody comprising a heavy' chain complementarity determining region (CDRH) 1, a CDRH2, a CDRH3, a light chain complementarity determining region (CDRL) 1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRI..1, CDRI..2, and CDRL3 comprises, respectively, the amino acid sequence set forth in:a) SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58;b) SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64;c) SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;d) SEQ ID NO: 65, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74;e) SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79;f) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83;g) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83:h) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83;i) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83; orAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 j) SEQ ID NO: 53, SEQ ID NO: 87, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83.

[0179] Embodiment II -2, A CD24-specific antibody composing:a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;b) a heavy chain variable region (VH) comprising tire amino acid sequence of SEQ ID NO: 29, or an amino acid sequence comprising at least 70% sequence identity’ thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;c) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;d) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70% sequence identity’ thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ IDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively;e) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively;f) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence comprising at least 70% sequence identity’ thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;g) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;h) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70% sequence identity’ thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ IDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;i) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;j) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 45, or an amino acid sequence comprising at least 70% sequence identity’ thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;k) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;l) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 49, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70% sequence identity’ thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ IDAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; orm) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 51, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

[0180] Embodiment II-3. The CD24-specific antibody of embodiment II-2, comprising: a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;b) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;c) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and aAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;d) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively;e) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively;f) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;g) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire HC comprises a CDRH1, aAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein tire LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;h) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRHl, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;i) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRHl, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;j) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRHl, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;k) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRHl, aAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein tire LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;l) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 23, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 24, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; orm) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 26, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

[0181] Embodiment II-4. The antibody of any one of embodiments II- 1 to II-3, wherein the antibody is humanized.

[0182] Embodiment II-5. Hie antibody of any one of embodiments II- 1 to 11-4, wherein tire antibody is a full length antibody.

[0183] Embodiment II-6. The antibody of any one of embodiments II- 1 to II-4, wherein the antibody is an antigen-binding antibody fragment.

[0184] Embodiment II-7. The antibody of any one of embodiments II- 1 to II-6, wherein the antibody comprises a Fc domain, wherein the Fc domain is selected from the group consisting of a human IgGl, IgG2, IgG3, and IgG4 heavy chain sequence.

[0185] Embodiment II-8. Hie antibody of any one of embodiments II- 1 to 11-7, wherein the binding of the antibody does not disrupt the interaction between CD24 and Siglec-10,Attorney Docket No,: PHST-005 / 01 WO 344821 -2023

[0186] Embodiment II-9. The antibody of any one of embodiments II- 1 to 11-7, wherein the binding of the antibody disrupts the interaction between CD24 and Siglec-10.

[0187] Embodiment II- 10. The antibody of any one of embodiments II- 1 to II-9, wherein, the antibody binds human CD24 and cynomolgus monkey CD24.

[0188] Embodiment 11-11. The antibody of any one of embodiments II- 1 to II- 10, wherein the antibody comprises a binding affinity’ to CD24 lower than about 500 nM,

[0189] Embodiment 11-12. A pharmaceutical composition comprising the antibody of any one of embodiments II- 1 to II- 11, and optionally a pharmaceutically acceptable carrier.

[0190] Embodiment 11-13. A nucleic acid encoding for the antibody of any one of embodiments II- 1 to II- 11.

[0191] Embodiment 11-14. A vector comprising the nucleic acid of embodiment 11-13.

[0192] Embodiment 11- 15. A method of treating a disease or condition in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the antibody of any one of embodiments II- 1 to II- 11 or the pharmaceutical composition of embodiment 11-12.

[0193] Embodiment 11-16. lire method of embodiment 11-15, wherein the disease or condition comprises cancer.

[0194] Embodiment 11-17. The method of embodiment II- 16, wherein the cancer comprises a solid cancer.

[0195] Embodiment 11-18. The method of embodiment 11-17, wherein the solid cancer is a carcinoma or a sarcoma.

[0196] Embodiment 11-19. The method of embodiment 11-18, wherein the carcinoma is selected from the group consisting of bladder, breast, colon, kidney, liver, lung, ovary, pancreas, stomach, cervix, thyroid and skin,

[0197] Embodiment 11-20. The method of embodiment II- 18, wherein the sarcoma is fibrosarcoma or rhabdomyosarcoma.

[0198] Embodiment 11-21. The method of embodiment 11-16, wherein the cancer comprises a hematological cancer.

[0199] Embodiment 11-22. The method of embodiment II-2I, wherein the hematological cancer is selected from the group consisting of acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Burkett's lymphoma; acute myelogenous leukemia, chronic myelogenous leukemia, and promyelocytic leukemia.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 |0200] Embodiment 11-23. The method of embodiment 11-16, wherein the cancer is selected from the group consisting of melanoma, neuroblastoma, glioma, tumors of the central nervous system, and tumors of the peripheral nervous system.

[0201] Embodiment 11-24. The method of any one of embodiments 11-15 to 11-23, wherein the route of administration is intravenous or subcutaneous administration.

[0202] Embodiment 11-25. The method of any one of embodiments 11-15 to 11-24, wherein the subject is human.

[0203] Embodiment 11-26. Tire method of any one of embodiments 11-15 to 11-25, wherein the antibody or pharmaceutical composition is administered in combination with another drug or therapy.

[0204] Embodiment 11-27. The method of embodiment 11-26, wherein the drug or therapy comprises chemotherapy, hormonal therapy, biological therapy, immunotherapy, radiation therapy, or surgery.

[0205] Embodiment 11-28. Use of the antibody of any one of embodiments II-l to II- 11 or the pharmaceutical composition of embodiment 11-12 in the manufacture of a medicament for the treatment of a disease or condition.

[0206] Embodiment 11-29. The use of embodiment 11-28, wherein the disease or condition comprises cancer.

[0207] Embodiment 11-30. The use of embodiment 11-28 or 11-29, wherein the medicament is administered through intravenous or subcutaneous administration.

[0208] Embodiment II-31. The antibody of any one of embodiments II- 1 to II- 11 or the pharmaceutical composition of embodiment 11-12 for use in the treatment of a disease or condition.

[0209] Embodiment 11-32. The antibody or pharmaceutical composition for use of embodiment II-31, wherein the disease or condition comprises cancer.

[0210] Embodiment 11-33. The antibody or pharmaceutical composition for use of embodiment II-31 or 11-32, wherein the antibody or pharmaceutical composition is administered through intravenous or subcutaneous administration.Attorney Docket No.: PHST-005 / 01 WO 344821 -2023EXAMPLESExample 1: Anti-CD24 antibody development and productionDiscovery of anti-CD24 antibodies

[0211] Anti-CD24 antibodies were raised by immunization of Alloy ATX-GK BL / 6 mice. Briefly, mice were immunized with keyhole limpet hemocyanin (KLH)-conjugated CD24 peptide (NHz-SETTTGTSSNSSQSTSNSGLAPNPTNATT-COOH). Lymph node-derived B cells were used to create hybridoma fusions, which were screened by ELISA and flow cytometry for production of anti-CD24 antibodies. Heavy and light chain cDNA sequences derived from positive clones were determined. One done, PHRHL-305, was selected for further development.Yeast display affinity’ maturation

[0212] Yeast display selections were carried out as previously described with minor modifications, with the antibody displayed in an antigen binding fragment (Fab) format. G. Chao et al. (Nature protocols. 1, 755-68 (2006)). Using the bidirectional GAL1 / GAL10 promoter, the VL+CL domains of the antibody PHRHL-305 were co-expressed with the corresponding VH+CH1 domains, which were in turn expressed as a fusion protein with Aga2p in a yeast display vector that also encoded a TRP1 auxotrophic marker. The VH * CHI gene fragment was inserted at the N-terminus of Aga2p and appended by a myc tag. For mutagenesis, the Fab library was constructed by error prone PCR on the VH fragment using Taq polymerase with the addition of MnCb. to the reaction mixture. The MnCb. concentration was titrated to produce approximately 2 - 3 amino acid mutations (2 - 4 base pair mutations) per VH+CH1 molecule.

[0213] A library’ of mutants was transformed by two-piece homologous recombination in yeast. In short, the EBY100 strain yeast (MA Ta AGA1:: GAIA -A GA DURA3 ura3-52 trpl leu2- A200 / 1A3-A200 pepA. HIS3 prM-A1.6R can\ GAD, ATCC) was grown overnight to stationary phase in YPD medium. Hie yeast were then diluted to an ODsoo of 0.3 and grown until they reached an ODeoo of 1.6 before being collected by centrifugation. The cell pellet was washed once with 50 ml of distilled water and twice with 50 ml of electroporation buffer (1 M sorbitol, 1 mM CaCk). The yeast were then conditioned in 0.1 M lithium acetate and 10 mM dithiothreitol for 20 minutes. After one more wash with electroporation buffer, the yeast were resuspended in 600 pl of electroporation buffer containing 10 pg of digested vector and 40 pg of insert, and transformed with an electroporator at 2.5 kV (Gemini X2, BTX). The library was recovered in YPD for 1 hour at 30 °C and then grown for 24 hours in SDCAA medium (20 g / L glucose, 5 g / LAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 casamino acids, 6.7 g / L yeast nitrogen base without amino acids). The library was then induced in SGCAA medium (18 g / L galactose, 2 g / L glucose, 5 g / L casamino acids, 6.7 g / L yeast nitrogen base without amino acids) at an ODeoo of 1.0 and grown for an additional 48 hours at 20 °C.

[0214] For magnetic selection, yeast cells comprising an approximately 10-fold library' diversity were pelleted and resuspended in PBSA (PBS + 0.1% BSA). Streptavidin magnetic beads (Miltenyi) were coated with a biotinylated decoy protein (Glycophorin A fused with maltose binding protein) for negative selections, or the target protein (CD24 fused with maltose binding protein at 1 pM) for positive selections, and incubated with the library for 1 hour at 4 °C, Selections were carried out by magnetic capture using an LS column (Miltenyi) according to the manufacturer’s protocol.

[0215] For FACS, 10syeast were pelleted and resuspended in PBSA containing biotinylated target protein and incubated for 1 hour at 4 °C. The yeast were washed twice, target binding was detected by AlexaFluor 647-conjugated streptavidin and yeast surface expression by PE-conjugated anti-myc antibody, and high affinity double positive yeast were sorted on a Sony SH800 sorter. Alternating rounds of positive and negative selections were carried out until the library’ was enriched for high affinity variants specific for CD24 binding (FIG. 1). Sequencing of both the bulk library' and individual clones was performed to identify individual mutations producing improved affinity and stability (FIG. 3A-3B). Randomly selected clones were sequenced after 3 rounds of yeast display selections. Hie VH and VL domains were sequenced and aligned. Periods represent identity with the parental reference sequence (top row'). Kabat CDR regions are indicated. Amino acids are numbered sequentially.

[0216] Individual clones were titrated by staining with biotinylated antigen at a range of concentrations, followed by' secondary’ staining with AlexaFluor-647 conjugated streptavidin and analysis by flow cytometry' on aNovocyte (Agilent) or Quanteon (Agilent) (FIG. 2). Yeast expressing variants of PHRHL-305 with the indicated mutations (1MGT numbering) were stained with a range of CD24-MBP concentrations. Surface display-normalized fluorescence intensity of the varients 'as plotted against antigen concentration. Ammo acids DI 14 and T18 are found in the heavy chain; V30, S49 & W93 in the light chain. In some cases, the affinity matured molecules 'ere subjected to further humanization after selection on yeast.Antibody expression & purificationAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 |0217] All antibodies were expressed by transient transfection using the Expi293 expression system (Thermo Fisher Scientific). Separate plasmids with a CMV promoter and H7 peptide leader sequence were constructed for the heavy and light chains, which were transfected at a mass ratio of 1:2 respectively. Antibodies were purified using Protein A affinity chromatography and eluted with 0.1 M glycine-HCl, pH 3. Where the product was < 95% monomer, size exclusion chromatography was performed in PBS using either a Superdex 200 Increase 10 / 300 GL or HiLoad 16 / 600 Superdex 200 pg (Cytiva) (FIG. 4). The resulting antibody solution was aliquoted, flash-frozen in liquid nitrogen, and stored at -80 °C.Example 2: In vitro equilibrium binding affinity measurements

[0218] To determine the linear range of detection for solution equilibrium binding experiments, a solid phase ELISA experiment was performed first. 96-well high binding ELISA plates (Coming) w'ere coated w ith 100 pl of purified antigen (CD24-MBP-Avi-His, 2 pg / ml, Pheast) in PBS (lx PBS, pH 7.4, Gibco) at 4 °C overnight. Plates were washed 3 times with lx PBST (Pierce) using a plate washer (BioTek TS 450). The plates were then blocked for 1 h at room temperature with lx ELISA Assay Buffer (Invitrogen DS98200). Tire antibody was serially diluted in lx Assay Buffer, then 100 pl of each dilution was added into the pre-coated plates and incubated at room temperature for 1 h, followed by washing 3 times with lx PBST. Subsequently, 100 pl of HRP-conjugated goat anti-human IgG Fc (1: 10000 dilution, Abeam) was added to the w dis and incubated at room temperature for 1 h, followed by washing 3 times with lx PBST. A colorimetric signal was detected by addition of 3,3',5,5'-tetramethylbenzidine (TMB, Invitrogen) followed by incubation at room temperature for 1 - 10 min. The reaction was stopped by adding 100 pl of 2 M H2SO4 (ELISA Stop Solution, Invitrogen), The OD values W'ere measured at 450 nm with a microplate reader (BioTek Synergy Hl). Tire optimum antibody concentration for in-solution binding was determined as the ICso calculated from a sigmoidal, 4PL non-linear fit analysis of the binding curve (GraphPad Prism).

[0219] Affinity measurements 'ere made by measuring in-solution equilibrium of unlabeled IgG as described by Friguet et al. (J Immunol Methods. 77, 305-319 (1985)). In a low' binding 96-well plate (Coming), the antigen (CD24-MBP, 200 pM, Pheast) was serially diluted and 100 pl of each dilution was added to 100 pl of a fixed concentration of antibody, as determined from the IC50 described above. A standard curve of the antibody was prepared by serially diluting the antibody and adding it to empty w'ells in the same plate. The plate was allowed to shake at roomAttorney Docket No.: PHST-005 / 01 WO 344821 -2023 temperature overnight to reach binding equilibrium. For all antibody variants tested, iwo replicates of each dilution were performed. The next day, unbound antibody was detected by adding 100 pl of the equilibrated samples to an EUSA plate pre-coated with CD24-MBP-Avi-His. Solid-phase ELISA was performed as described above. Based on the standard curve of the antibody, tire OD450 readings were interpolated to calculate the concentration of unbound antibodies after equilibration and then plotted against the antigen concentration. The monovalent equilibrium dissociation constant (KD) was calculated using the method of Stevens et al. by nonlinear regression (GraphPad Prism). Stevens et al. (Mol Immunol. 24, 1055-1060 (1987)).

[0220] Antibodies were expressed by transient transfection in Expi293 cells, purified by Protein A affinity and analyzed by size exclusion chromatography. Isotype and approximate KD for CD24 binding are reported in Table El. Amino acid sequence positions are indicated according to sequential numbering. N D = “not determined,” N / A = “not applicable,” H3 = heavy chain CDR3; LFR3 = light chain framework region 3; 1. i = light chain CDR1; LFR1 = light chain framework region 1; HFR1 = heavy chain framework region 1; H2 = heavy chain CDR2.Table El. Anti-CD24 antibody expression yields and affinity measurements.Antibody ID KD (nM) Isotype Parental Mutations sequence relative to parental sequence PHRHL-300 N. D. mlgGl N / A N / APHRHL-301 N. D. mlgGl N / A N / APHRHL-302 1.0 mlgGl N / A N / APHRHL-303 N. D. mlgGl N / A N / APURI IL-304 N. D. mIgG2b N / A N / APHRHL-305 47 mlgGl N / A N / APHRHL-306 47 hIgG4 PHRHL-305 None2.2 hIgG4 PHRHL-305 DI 03V (H3), PHRHL-307 W82R (LFR3)7.3 hIgG4 PHRHL-305 DI 03V (H3), W82R (LFR3), PHRHL-308 V30D (LI)5.7 hIgG4 PHRHL-305 D103V (H3), W82R (LFR3), PHRHL-309 V30A (LI)9.2 hIgG4 PHRHL-305 D103V (H3), W82R (LFR3),PURI IL-310 K17E (LFR1)Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 Antibody ID KD (nM) Isotype Parental Mutations sequence relative to parental sequence N. D. N / A PHRHL-305 DI 03V (H3), PHRHL-311 T17A (HFR1)PURI IL-312 N. D. N / A PHRHL-305 II52Y (H2) Example 3: Flow cytometry-based phagocytosis assayMacrophage differentiation and polarization

[0221] Leukocyte reduction system (LRS) chambers from anonymous donors were obtained from the Stanford Blood Center, Human CD14+, CD 16- monocytes were purified from fresh peripheral blood by negative selection (EasySep™, Stemcell Technologies), Unwanted cells were labeled with antibodies complexed to magnetic particles, and the magnetically labeled cells were separated from the untouched monocytes by7using a magnet. Monocytes were stored frozen in liquid nitrogen and were differentiated into macrophages by 7-14 days of culture in IMDM + 10% human serum AB (Fisher Scientific). Folio-wing differentiation, macrophages were stimulated with 50 ng / ml human TGFpl (R& D Systems) and 50 ng / ml human IL- 10 (R& D Systems) for an additional 7-11 days for polarization into suppressive macrophages (M2).Phagocytosis assay

[0222] All in vitro flow cytometry-based phagocytosis assays reported here were performed by co-culturing tumor target cells with M2 macrophages at the indicated ratio for 2-3 hours in a humidified, 5% CO2 incubator at 37 °C in ultra-low-attachment 96-well U-bottom plates (Corning) in serum-free IMDM (Life Technologies). Tumor target cells were engineered to express GFP, or w ere labeled with CellTrace CFSE (Thermo Fisher) immediately before the experiment according to the manufacturer’s instructions. Target cells w7ere harvested from plates using TrypLE Express (Life Technologies) prior to co-culture with macrophages. For all assays, macrophages w7ere also harvested from plates using TrypLE Express. For phagocytosis assays involving treatment with monoclonal antibodies including anti-CD24 (as indicated) and anti-CD47 (Magrolimab), all antibodies or appropriate isotype controls 'ere added at a concentration of 10 pg / ml or 50 pg / ml. After co-culture, phagocytosis assays were stopped by placing plates on ice, centrifuging at 400 x g for 5 min at 4 °C and staining with AlexaFluor-647-labeled anti-CD1 lb (Clone MI / 70, Biolegend) to identify human macrophages. Assays were analyzed on a Novocyte (Agilent) or Quanteon ( Agilent) flow' cytometer, both using a high-throughputAttorney Docket No,: PHST-005 / 01 WO 344821 -2023 autosampler. Phagocytosis was measured as the number of CD1 lb+, GFP+ (or CFSE+) macrophages, quantified as a percentage of the total GDI lb+ macrophages. Each phagocytosis reaction (independent donor and experimental group) was performed in a minimum of technical triplicate. All biological replicates indicate independent human macrophage donors. FIGS. 5-10 demonstrate the resulting % phagocytosis by PHRHL-305 or PHRHL-307 in BT474 breast ductal carcinoma cells (FIG. 5), MFM-223 breast carcinoma cells (FIG. 6), OVCAR-8 ovarian cancer cells (FIG. 7), NCI-1563 non-small cell lung adenocarcinoma cells (FIG. 8), NCI-11292 lung mucoepidermoid carcinoma cells (FIG. 9), and HT29 colorectal adenocarcinoma cells (FIG. 10). lire cells were incubated with human monocyte-derived M2 macrophages at a 1:2 effector-to-target ratio for 2.5 h at 37 °C, Phagocytosis was measured by flow cytometry' as coincidence of CFSE / GFP and CD1 lb staining and displayed as % phagocytosis. “Magro” is Magrolimab, an anti-CD47 therapeutic monoclonal antibody. Each data point represents a different monocyte donor.

Claims

1. Attorney Docket No,: PHST-005 / 01 WO 344821 -20232.CLAIMS1. A CD24-specific antibody comprising a heavy chain complementarity determining region (CDRH) 1, a CDRH2, a CDRH3, a light chain complementarity determining region (CDRL) 1, a CDRL2, and a CDRL3, wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 comprises, respectively, the amino acid sequence set forth in:4.a) SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO:5.57, and SEQ ID NO: 58;6.b) SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO:7.63, and SEQ ID NO: 64;8.c) SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO:9.69, and SEQ ID NO: 70;10.d) SEQ ID NO: 65, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO:11.69, and SEQ ID NO: 74;12.e) SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO:13.69, and SEQ ID NO: 79;14.f) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO:15.82, and SEQ ID NO: 83;16.g) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 81, SEQ ID NO:17.82, and SEQ ID NO: 83;18.h) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO:19.82, and SEQ ID NO: 83;20.i) SEQ ID NO: 53, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 86, SEQ ID NO:21.82, and SEQ ID NO: 83; or22.j) SEQ ID NO: 53, SEQ ID NO: 87, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO:23.82, and SEQ ID NO: 83.

2. A CD24-specific antibody comprising:25.a) a heavy chain variable region (VII) comprising the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 28, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;26.b) a heavy chain variable region (VH) comprising tire amino acid sequence of SEQ ID NO: 29, or an amino acid sequence composing at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 30, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;27.c) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein tire VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;28.d) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 33, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 34, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively; Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 e) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 36, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively;29.f) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 37, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 38, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;30.g) a heavy chain variable region (VH) comprising tire amino acid sequence of SEQ ID NO: 39, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 40, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;31.h) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 41, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 42, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;32.i) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 43, or an amino acid sequence composing at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein tire VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;33.j) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 45, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 46, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein tire VL comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;34.k) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 48, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRLl, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 l) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 49, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; or35.m) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 51, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 52, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the VH comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the VL comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

3. The CD24-specific antibody of claim 2, comprising:37.a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 54, and SEQ ID NO: 55, respectively; and wherein the LC comprises a CDRLI, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58, respectively;38.b) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 3, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 4, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 59, SEQ ID NO: 60, and SEQ ID NO: 61, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 62, SEQ ID NO: 63, and SEQ ID NO: 64, respectively;39.c) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 5, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67, respectively; and wherein tire LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70, respectively;40.d) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 7, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 65, SEQ ID NO: 71, and SEQ ID NO: 72, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 73, SEQ ID NO: 69, and SEQ ID NO: 74, respectively;41.e) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 75, SEQ ID NO: 76, and SEQ ID NO: 77, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 78, SEQ ID NO: 69, and SEQ ID NO: 79, respectively; Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 f) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;42.g) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 13, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 14, or an ammo acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;43.h) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 15, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;44.i) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence Attorney Docket No.: PHST-005 / 01 WO 344821 -2023 set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 85, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;45.j) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 86, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;46.k) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein tire LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively;47.l) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 23, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 24, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 79, and SEQ ID NO: 84, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively; or Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 m) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence comprising at least 70% sequence identity thereto; and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 26, or an amino acid sequence comprising at least 70% sequence identity thereto; wherein the HC comprises a CDRH1, a CDRH2, and a CDRH3 comprising the sequence set forth in SEQ ID NO: 53, SEQ ID NO: 87, and SEQ ID NO: 80, respectively; and wherein the LC comprises a CDRL1, a CDRL2, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83, respectively.

4. The antibody of any one of claims 1 -3, wherein the antibody is humanized.

5. The antibody of any one of claims 1-4, wherein the antibody is a full length antibody.

6. The antibody of any one of claims 1-4, wherein the antibody is an antigen-binding antibody fragment.

7. Tire antibody of any one of claims 1-6, wherein the antibody comprises a Fc domain, wherein the Fc domain is selected from the group consisting of a human IgGl, lgG2, IgG3, and IgG4 heavy chain sequence.

8. Tlie antibody of any one of claims 1-7, wherein the binding of the antibody does not disrupt the interaction between CD24 and Siglec-10.

9. Tlie antibody of any one of claims 1-7, w herein the binding of the antibody disrupts the interaction between CD24 and Siglec-10.

10. Tlie antibody of any one of claims 1-9, w herein, the antibody binds human CD24 and cynomolgus monkey CD24.

11. Tlie antibody of any one of claims 1-10, wherein the antibody comprises a binding affinity to CD24 low er than about 500 nM.

12. A pharmaceutical composition comprising the antibody of any one of claims 1-11, and optionally a pharmaceutically acceptable carrier.

13. A nucleic acid encoding for the antibody of any one of claims 1-11,14. A vector comprising tire nucleic acid of claim 13.

15. A method of treating a disease or condition in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the antibody of any one of claims 1-11 or the pharmaceutical composition of claim 12.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 16. Hie method of claim 15, wherein the disease or condition comprises cancer.

17. The method of claim 16, wherein the cancer comprises a solid cancer.

18. The method of claim 17, wherein the solid cancer is a carcinoma or a sarcoma.

19. The method of claim 18, wherein the carcinoma is selected from the group consisting of bladder, breast, colon, kidney, liver, lung, ovary, endometrium, pancreas, stomach, cervix, thyroid and skin.

20. Tire method of claim 18, wherein the sarcoma is fibrosarcoma or rhabdomyosarcoma.

21. The method of claim 16, wherein the cancer comprises a hematological cancer.

22. The method of claim 21, wherein the hematological cancer is selected from the group consisting of acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Burkett's lymphoma; acute myelogenous leukemia, chronic myelogenous leukemia, and promyelocytic leukemia.

23. Tire method of claim 16, wherein the cancer is selected from the group consisting of melanoma, neuroblastoma, glioma, tumors of the central nervous system, and tumors of the peripheral nervous system.

24. The method of any one of claims 15-23, wherein the route of administration is intravenous or subcutaneous administration.

25. The method of any one of claims 15-24, wherein the subject is human.

26. The method of any one of claims 15-25, wherein the antibody or pharmaceutical composition is administered in combination with another drag or therapy.

27. The method of claim 26, wherein the drug or therapy comprises chemotherapy, hormonal therapy, biological therapy, immunotherapy, radiation therapy, or surgery.

28. Use of the antibody of any one of claims 1- 11 or the pharmaceutical composition of claim 12 in the manufacture of a medicament for the treatment of a disease or condition.

29. Tire use of claim 28, wherein the disease or condition comprises cancer.

30. The use of claim 28 or 29, wherein the medicament is administered through intravenous or subcutaneous administration.

31. Tire antibody of any one of claims 1-11 or the pharmaceutical composition of claim 12 for use in the treatment of a disease or condition.Attorney Docket No,: PHST-005 / 01 WO 344821 -2023 32. The antibody or pharmaceutical composition for use of claim 31, wherein the disease or condition comprises cancer.

33. Tlie antibody or pharmaceutical composition for use of claim 31 or 32, wherein the antibody or pharmaceutical composition is administered through intravenous or subcutaneous administration.

Images