Application of MUSTN1 in promoting weight gain and intramuscular fat deposition of chicken
By applying the MUSTN1 gene and its encoded protein, and using the recombinant adenovirus vector AAV-MUSTN1 for intramuscular injection, chicken weight gain and intramuscular fat deposition were promoted, solving the problem of the negative correlation between growth rate and meat flavor in broiler breeding, and achieving simultaneous improvement in chicken yield and quality.
Patent Information
- Application Number
- CN202511998972.9
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2025-12-29
- Publication Date
- 2026-03-31
AI Technical Summary
Existing technologies in broiler breeding have a problem where growth rate is negatively correlated with meat flavor, especially the decrease in intramuscular fat content, which affects meat flavor and nutritional value.
By overexpressing or increasing the level of the MUSTN1 gene and its encoded protein, and then administering it via intramuscular injection in combination with the recombinant adenovirus vector AAV-MUSTN1, weight gain and intramuscular fat deposition in chickens were promoted.
It significantly increased the intramuscular fat content of chickens, while achieving weight gain, improving meat flavor and nutritional value, and solving the problem of the negative correlation between growth rate and meat flavor.
Smart Images

Figure SMS_1 
Figure SMS_2 
Figure SMS_3
Abstract
Description
Technical Field
[0001] This invention relates to the field of bio-agricultural technology, and in particular to the application of MUSTN1 in promoting weight gain and intramuscular fat deposition in chickens. Background Technology
[0002] Poultry meat is widely popular worldwide. However, the rapid weight gain of commercial broiler chickens during the breeding process often leads to a decrease in intramuscular fat content, affecting the flavor of the meat. Therefore, local chicken breeds with better flavor are increasingly favored by consumers.
[0003] Intramuscular fat (IMF) refers to the fat deposited between muscle fibers and muscle bundles. Its content directly affects the color, flavor, juiciness, and tenderness of meat, and is a key indicator for evaluating meat quality. Selective breeding practices have shown that genetic methods can effectively enhance IMF deposition. Therefore, in-depth analysis of the genetic basis and regulatory mechanisms of chicken intramuscular fat deposition, and the development of molecular markers suitable for breeding, are of great significance for accelerating the genetic improvement of chicken IMF content.
[0004] Chicken is the second most consumed meat in my country after pork, and its low cost and high quality make it a popular choice. With economic development and improved living standards, consumption patterns are changing and upgrading, leading to higher standards for meat. Therefore, improving chicken quality is receiving increasing attention from breeders. Protein is a crucial factor in assessing meat quality and nutritional value. Chicken provides a large amount of high-quality protein annually, making it a major source of protein in the diet. Furthermore, chicken is rich in polyunsaturated fatty acids (PUFAs), which can reduce the risk of cardiovascular disease and cancer. With increasing market demand for chicken, improving meat quality and nutritional value while increasing production has become a key focus in broiler farming. Therefore, elucidating the molecular factors influencing intramuscular fat deposition is crucial for improving meat quality. Summary of the Invention
[0005] The purpose of this invention is to provide the application of MUSTN1 in promoting weight gain and intramuscular fat deposition in chickens, in order to solve the problems existing in the prior art.
[0006] To achieve the above objectives, the present invention provides the following solution: One of the technical solutions of this invention, MUSTN1 Application of genes or their encoded proteins in promoting weight gain and intramuscular fat deposition in chickens.
[0007] The second technical solution of the present invention, MUSTN1The application of genes or their encoded proteins in breeding chicken strains with faster weight gain and intramuscular fat deposition, the aforementioned MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO.1, and the protein sequence it encodes is shown in SEQ ID NO.2; the described species is the Gushi chicken; MUSTN1 Overexpression of the gene, or increased levels of the protein it encodes, promotes weight gain and intramuscular fat deposition in chickens.
[0008] The third technical solution of this invention is a method for promoting weight gain and intramuscular fat deposition in chickens, which involves... MUSTN1 The recombinant adenovirus vector AAV-MUSTN1 was injected intramuscularly into 5-week-old Gushi chickens; MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO.1.
[0009] Based on the above technical solution, the present invention has the following technical effects: This invention utilizes innovative applications MUSTN1 The gene and its encoded protein synergistically enhance chicken body weight gain and intramuscular fat deposition. This invention is the first to reveal the overexpression of... MUSTN1 The gene can significantly increase intramuscular fat (IMF) content while promoting chicken weight gain, effectively solving the long-standing technical bottleneck in commercial broiler breeding where growth rate is negatively correlated with meat flavor. Experimental data shows that... MUSTN1 Overexpression increased the IMF content in the breast muscle of Gushi chicken from 1.47% to 2.60% and the IMF in the leg muscle from 3.49% to 4.13%, while simultaneously increasing the body weight from 1507g to 1707g, achieving simultaneous improvement in chicken yield and quality. This invention provides an innovative molecular tool for improving chicken quality, significantly enhancing meat flavor and nutritional value while ensuring yield, and has broad application prospects and significant economic and social benefits. Detailed Implementation
[0010] The terms “include,” “including,” “have,” “contain,” etc., used in this article are all open-ended terms, meaning that they include but are not limited to.
[0011] Unless otherwise specified, the technical solutions described in this invention are all conventional solutions in the field, and the reagents or raw materials used are all purchased from commercial channels or are publicly available unless otherwise specified.
[0012] The embodiments of the present invention provide MUSTN1 Application of genes or their encoded proteins in promoting weight gain and intramuscular fat deposition in chickens.
[0013] In some specific implementation schemes, the MUSTN1The nucleotide sequence of the gene is shown in SEQ ID NO.1, and the protein sequence it encodes is shown in SEQ ID NO.2.
[0014] In some specific implementations, the chicken referred to is Gushi chicken.
[0015] In some specific implementation plans, for MUSTN1 Overexpression of the gene, or increased levels of the protein it encodes, promotes weight gain and intramuscular fat deposition in chickens.
[0016] The embodiments of the present invention also provide MUSTN1 The application of genes or their encoded proteins in breeding chicken strains with faster weight gain and intramuscular fat deposition, the aforementioned MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO.1, and the protein sequence it encodes is shown in SEQ ID NO.2; the described species is the Gushi chicken; MUSTN1 Overexpression of the gene, or increased levels of the protein it encodes, promotes weight gain and intramuscular fat deposition in chickens.
[0017] In some specific implementation plans, MUSTN1 The recombinant adenovirus vector AAV-MUSTN1 was injected in situ into the muscles of 5-week-old Gushi chickens.
[0018] This invention also provides a method for promoting weight gain and intramuscular fat deposition in chickens, by... MUSTN1 The recombinant adenovirus vector AAV-MUSTN1 was injected intramuscularly into 5-week-old Gushi chickens; MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO.1.
[0019] Example 1 1. Experimental Materials The experimental subjects (5-week-old Gushi chickens) came from the Yuanyang Germplasm Resource Farm of Henan Agricultural University and were allowed free access to feed and water under the same feeding and management conditions.
[0020] AAV-NC (recombinant adeno-associated virus empty vector), AAV-MUSTN1 ( MUSTN1 The recombinant adeno-associated virus vector was purchased from Heyuan Biotechnology (Shanghai) Co., Ltd.
[0021] Main instruments: centrifuge, electronic scale, blood collection needle, vacuum blood collection tube.
[0022] 2. Test Methods 2.1 Selection of test subjects Sixteen 5-week-old Gushi chickens were randomly selected and divided into an experimental group and a control group (n=8 each). The experimental group received an intramuscular injection of AAV-MUSTN1 (1×10⁻⁶) while the control group received AAV-NC (1×10⁻⁶) in situ. 11 Each / each.
[0023] MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO.1, and the protein sequence it encodes is shown in SEQ ID NO.2.
[0024] SEQ ID NO.1: atgtcgcagccagacccagtgaaaaagaagcgtcctccagtgaaggaggaagatctcaaaggagctagaggaaacctttccaaaaaccaggaaattaagtccaaaacctaccaagt catgaagcagtgtgaacaaatgggctctgcagcaccttccatattcagccgggctcggacgggcagcgaaacggtctttgagaagtcaaaagatgagccgcccaaaagcgtctttggctga; SEQ ID NO. 2: MSQPDPVKKKRPPVKEEDLKGARGNLSKNQEIKSKTYQVMKQCEQMGSAAPSIFSRARTGSETVFEKSKDEPPKSVFG.
[0025] 2.2 Feeding methods All chickens were raised in the experimental chicken house of Henan Agricultural University, and were allowed free access to feed and water under the same conditions. The nutritional levels of the chickens during the rearing period were: protein 19.0%, crude fiber 6.0%, and crude ash 8.0%.
[0026] 2.3 Slaughter Standards for Experimental Individuals The slaughter experiment was conducted in the laboratory of Henan Agricultural University. The chickens were weighed weekly, and slaughter was carried out when there was a significant difference in weight between the experimental group and the control group. After slaughter, the intramuscular fat content of the breast and leg muscles was determined by Soxhlet extraction.
[0027] 2.4 Results Statistics Table 1. Comparison of MUSTN1 expression levels in muscle
[0028] Table 1 compares the expression levels of MUSTN1 in the pectoral and leg muscles of the experimental and control groups after slaughter. As shown in Table 1, after in situ injection of AAV-MUSTN1 / AAV-NC into chicken muscle tissue, the expression of MUSTN1 in the pectoral muscle tissue of the experimental group significantly increased. MUSTN1 Successful overexpression and significant increase in chicken muscle tissue.
[0029] Table 2. Statistics on weight changes after adeno-associated virus injection
[0030] Table 2 shows the body weight of 16 chickens in the experimental and control groups after slaughter. As can be seen from Table 2, the average body weight of the experimental group was significantly higher than that of the control group. Under the same feeding environment and with identical feed and drinking water conditions, the experimental group showed greater weight gain, indicating that MUSTN1 can promote weight gain in chickens.
[0031] Table 3 Comparison of body fat characteristics of Gushi chickens after slaughter
[0032] Note: Intramuscular fat content = (muscle weight before extraction - muscle weight after extraction) / muscle weight before extraction × 100%.
[0033] Table 3 compares the body fat characteristics of 16 Gushi chickens in the experimental group and the control group after slaughter. As shown in Table 3, the experimental group exhibited a higher intramuscular fat content. P < 0.05). This suggests that high levels of MUSTN1 in Gushi chickens are significantly associated with high intramuscular fat content.
[0034] Obviously, the above embodiments of the present invention are merely examples for clearly illustrating the present invention, and are not intended to limit the implementation of the present invention. For those skilled in the art, other variations or modifications can be made based on the above description. It is neither necessary nor possible to exhaustively describe all embodiments here. Any modifications, equivalent substitutions, and improvements made within the spirit and principles of the present invention should be included within the scope of protection of the claims of the present invention.
Claims
1. MUSTN1 Use of a gene or its encoded protein in promoting body weight gain and intramuscular fat deposition in chickens.
2. Use according to claim 1, characterized in that, The MUSTN1 The nucleotide sequence of the gene is shown as SEQ ID NO. 1 and the encoded protein sequence is shown as SEQ ID NO.
2.
3. Use according to claim 1, characterized in that, The is the Silky Fowl.
4. Use according to claim 1, characterized in that, right MUSTN1 Overexpression of the gene, or increased levels of the protein it encodes, promotes weight gain and intramuscular fat deposition in chickens.
5. MUSTN1 The use of a gene or its encoded protein in breeding a chicken line that grows faster in body weight and deposits more intramuscular fat, characterized in that, The MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO.1, and the protein sequence it encodes is shown in SEQ ID NO.2; the described species is the Gushi chicken; MUSTN1 Overexpression of the gene, or increased levels of the protein it encodes, promotes weight gain and intramuscular fat deposition in chickens.
6. Use according to claim 5, characterized in that, The MUSTN1 Genetic recombination adenovirus vector AAV-MUSTN1 was injected into the muscle of 5-week-old Muscovy ducks in situ.
7. A method of promoting body weight gain and intramuscular fat deposition in a chicken, characterized by, The MUSTN1 Genetic recombination adenovirus vector AAV-MUSTN1 was injected into the muscle of 5-week-old Muscovy ducks in situ; the MUSTN1 The nucleotide sequence of the gene is shown in SEQ ID NO. 1.