Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, hybridoma cell strain thereof and application thereof

CN122647604APending Publication Date: 2026-08-28SHANGHAI BOFAN BIOTHERAPEUTICS CO LTD
View PDF 3 Cites 0 Cited by

Patent Information

Application Number
CN202610445127.7
Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Priority Date
2023-12-27
Filing Date
2024-11-28
Publication Date
2026-08-28

AI Technical Summary

Benefits of technology

本申请提供的肺炎克雷伯菌荚膜多糖单克隆抗体,能与K47型克雷伯菌的荚膜多糖特异性结合,有利于临床中肺炎克雷伯菌的分型,在动物体内和体外试验中均能证明其在预防和治疗K47型肺炎克雷伯菌感染具有优秀的效果,提供了解决肺炎克雷伯菌感染及多重耐药性问题的途径,对预防、诊断和治疗肺炎克雷伯菌的感染有显著意义,对于新一代肺炎克雷伯菌的药物研制有重要价值。

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN122647604A_ABST
    Figure CN122647604A_ABST
Patent Text Reader

Abstract

The application discloses K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, a hybridoma cell strain thereof and application of the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, sequence information of the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody is shown in SEQ NO:33-SEQ NO:40, the hybridoma cell strain has a preservation number of CCTCC NO:C2023313, the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided by the application can be specifically combined with the capsular polysaccharide of Klebsiella, is favorable for typing of Klebsiella pneumoniae in clinic, and can prove that the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody has excellent effects in preventing and treating infection of the K47 type Klebsiella pneumoniae in in-vivo and in-vitro tests, provides a way for solving problems of Klebsiella pneumoniae infection and multiple drug resistance, has remarkable significance for preventing, diagnosing and treating infection of Klebsiella pneumoniae, and has important value for development of a new generation of Klebsiella pneumoniae drugs.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] This application is a divisional application of the invention patent application filed on November 28, 2024, with application number 202411721464.1 and invention title "K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, its hybridoma cell line and its application". Technical Field

[0002] This application belongs to the field of pharmaceutical technology, and in particular relates to a K64 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, its hybridoma cell line and its application. Background Technology

[0003] Klebsiella pneumoniae is a capsule-encapsulated Gram-negative bacterium (G-). It primarily colonizes the digestive and respiratory tracts. When the body's resistance is lowered, it can cause lung infections, urinary tract infections, and even bloodstream infections. It is also one of the most common bacteria causing respiratory infections.

[0004] Klebsiella pneumoniae infections have become a serious global public health problem. Statistics show that the mortality rate of Klebsiella pneumoniae infection is extremely high; the mortality rate of bloodstream infections caused by Klebsiella pneumoniae is 20% to 30%, while the mortality rate of Klebsiella pneumoniae bacteremia complicated by pneumonia can reach over 50%. Treatment of Klebsiella pneumoniae mainly relies on antibiotics, but in recent years, due to the widespread use of various antibacterial drugs, Klebsiella pneumoniae producing extended-spectrum β-lactamases and carbapenemases has developed resistance to almost all available β-lactams (including carbapenems). In the past 10 years, the rate of carbapenem-resistant Klebsiella pneumoniae (CRKP) has increased dramatically worldwide. Capsular polysaccharide is the main virulence factor of Klebsiella pneumoniae and an important protective antigen for the treatment or prevention of Klebsiella pneumoniae infection. Based on the different structures of capsular polysaccharides, Klebsiella pneumoniae can be divided into at least 77 serotypes; capsular polysaccharides are also known as K antigens or K types. Different K serotypes exhibit varying resistance profiles and differ in geographical and clinical contexts, potentially leading to different epidemiological patterns in hospital-acquired infections and thus directly impacting the choice of clinical treatment. K47 Klebsiella pneumoniae is typically associated with more severe infections in clinical settings, particularly in immunocompromised patients.

[0005] Therefore, there is a need in this field to develop a K47 Klebsiella pneumoniae capsular polysaccharide monoclonal antibody with high specificity, good affinity, and strong binding force, which would be beneficial for the prevention and control of drug-resistant Klebsiella pneumoniae and its clinical application. Summary of the Invention

[0006] To address the above technical problems, this application provides a Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, wherein the Klebsiella pneumoniae is K47 type Klebsiella pneumoniae. The sequence of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody includes a light chain variable region and a heavy chain variable region. The amino acid sequence of the light chain variable region is as shown in SEQ NO:1 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it. The amino acid sequence of the heavy chain variable region is as shown in SEQ NO:2 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it.

[0007] Specifically, the complementary determining region of the light chain variable region comprises three sequences, as shown in SEQ ID:3, SEQ ID:4, and SEQ ID:5, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:3, SEQ ID:4, and SEQ ID:5; and the complementary determining region of the heavy chain variable region comprises three sequences, as shown in SEQ ID:6, SEQ ID:7, and SEQ ID:8, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:6, SEQ ID:7, and SEQ ID:8.

[0008] Secondly, this application provides a hybridoma cell line named K47-5B9-F8, with the accession number CCTCC NO: C2023314. The hybridoma cell line is used to prepare the aforementioned Klebsiella pneumoniae capsular polysaccharide monoclonal antibody.

[0009] Thirdly, this application provides a Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, wherein the Klebsiella pneumoniae is K47 type Klebsiella pneumoniae. The sequence of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody includes a light chain variable region and a heavy chain variable region. The amino acid sequence of the light chain variable region is as shown in SEQ NO:9 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it. The amino acid sequence of the heavy chain variable region is as shown in SEQ NO:10 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it.

[0010] Specifically, the complementary determining region of the light chain variable region comprises three sequences, as shown in SEQ ID:11, SEQ ID:12 and SEQ ID:13, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity compared to any one of SEQ ID:11, SEQ ID:12 and SEQ ID:13. The complementary determining region of the heavy chain variable region comprises three sequences, as shown in SEQ ID:14, SEQ ID:15 and SEQ ID:16, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity compared to any one of SEQ ID:14, SEQ ID:15 and SEQ ID:16.

[0011] Fourthly, this application provides a hybridoma cell line named K47-15D7-B10, with the accession number CCTCC NO: C2023312. The hybridoma cell line is used to prepare the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody described in the third aspect.

[0012] Fifthly, this application provides a Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, wherein the Klebsiella pneumoniae is K47 type Klebsiella pneumoniae, and the sequence of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody includes a light chain variable region and a heavy chain variable region. The amino acid sequence of the light chain variable region is as shown in SEQ NO:17 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it. The amino acid sequence of the heavy chain variable region is as shown in SEQ NO:18 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it.

[0013] Specifically, the complementary determining region of the light chain variable region comprises three sequences, as shown in SEQ ID:19, SEQ ID:20, and SEQ ID:21, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:19, SEQ ID:20, and SEQ ID:21. The complementary determining region of the heavy chain variable region comprises three sequences, as shown in SEQ ID:22, SEQ ID:23, and SEQ ID:24, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:22, SEQ ID:23, and SEQ ID:24.

[0014] In a sixth aspect, this application provides a hybridoma cell line named K47-18G6-B2, with the accession number CCTCC NO: C2023311. The hybridoma cell line is used to prepare the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in the fifth aspect.

[0015] In a seventh aspect, this application provides a Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, wherein the Klebsiella pneumoniae is K47 type Klebsiella pneumoniae, and the sequence of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody includes a light chain variable region and a heavy chain variable region. The amino acid sequence of the light chain variable region is as shown in SEQ NO:25 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it. The amino acid sequence of the heavy chain variable region is as shown in SEQ NO:26 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it.

[0016] Specifically, the complementary determining region of the light chain variable region comprises three sequences, as shown in SEQ ID:27, SEQ ID:28, and SEQ ID:29, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:27, SEQ ID:28, and SEQ ID:29. The complementary determining region of the heavy chain variable region comprises three sequences, as shown in SEQ ID:30, SEQ ID:31, and SEQ ID:32, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:30, SEQ ID:31, and SEQ ID:32.

[0017] Eighthly, this application provides a hybridoma cell line named K47-6E2, with accession number CCTCC NO: C2023296, which is used to prepare Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in the seventh aspect.

[0018] Ninthly, this application provides a Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, wherein the Klebsiella pneumoniae is K47 type Klebsiella pneumoniae, and the sequence of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody includes a light chain variable region and a heavy chain variable region. The amino acid sequence of the light chain variable region is as shown in SEQ NO:33 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it. The amino acid sequence of the heavy chain variable region is as shown in SEQ NO:34 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it.

[0019] Specifically, the complementary determining region of the light chain variable region comprises three sequences, as shown in SEQ ID:35, SEQ ID:36, and SEQ ID:37, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:35, SEQ ID:36, and SEQ ID:37. The complementary determining region of the heavy chain variable region comprises three sequences, as shown in SEQ ID:38, SEQ ID:39, and SEQ ID:40, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:38, SEQ ID:39, and SEQ ID:40.

[0020] In a tenth aspect, this application provides a hybridoma cell line named K47-20C10-B8, with the accession number CCTCC NO: C2023313. The hybridoma cell line is used to prepare Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in the ninth aspect.

[0021] In one aspect, this application provides a Klebsiella pneumoniae capsular polysaccharide monoclonal antibody, wherein the Klebsiella pneumoniae is K47 type Klebsiella pneumoniae, and the sequence of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody includes a light chain variable region and a heavy chain variable region. The amino acid sequence of the light chain variable region is as shown in SEQ NO:41 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it. The amino acid sequence of the heavy chain variable region is as shown in SEQ NO:42 or has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to it.

[0022] Specifically, the complementary determining region of the light chain variable region comprises three sequences, as shown in SEQ ID:43, SEQ ID:44, and SEQ ID:45, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:43, SEQ ID:44, and SEQ ID:45; and the complementary determining region of the heavy chain variable region comprises three sequences, as shown in SEQ ID:46, SEQ ID:47, and SEQ ID:48, or sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity compared to any one of SEQ ID:46, SEQ ID:47, and SEQ ID:48.

[0023] In the twelfth aspect, this application provides a hybridoma cell line named K47-4H8, with the accession number CCTCC:C2024339, which is used to prepare the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in the eleventh aspect.

[0024] In a thirteenth aspect, this application provides a pharmaceutical composition comprising any one of the preceding Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies, wherein the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody can bind to Klebsiella pneumoniae capsular polysaccharide target antigens and non-Klebsiella pneumoniae capsular polysaccharide target antigens, and the pharmaceutical composition further comprises any one or more combinations of pharmaceutically acceptable carriers, excipients or diluents.

[0025] In a fourteenth aspect, this application provides a kit for detecting Klebsiella pneumoniae type K47, the kit comprising the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described above, and further comprising any one or more combinations of positive control, negative control, antibody diluent, chromogenic solution, stop solution, blocking solution or washing solution.

[0026] In a fifteenth aspect, this application provides the use of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody described in any one of the preceding statements in the preparation of a therapeutic and / or diagnostic product for Klebsiella pneumoniae infection, the disease comprising one or more symptoms caused by Klebsiella infection, including pneumonia, urinary tract infection, sepsis / bacteremia / septicemia, neonatal sepsis I bacteremia / septicemia, diarrhea, soft tissue infection, post-organ transplant infection, surgical infection, wound infection, pulmonary infection, purulent liver abscess, lung abscess, cellulitis, necrotizing myofascitis, myositis, endophthalmitis, peritonitis, meningitis, necrotizing meningitis, or spondyloarthritis.

[0027] Capsular polysaccharides are important toxicological factors of Klebsiella pneumoniae. This application uses capsular polysaccharides coupled with carrier proteins to enhance immunogenicity, and prepares K47 type Klebsiella pneumoniae capsular polysaccharide-specific monoclonal antibodies using hybridoma technology. These antibodies have the characteristics of good specificity, high affinity, and high binding force to Klebsiella pneumoniae capsular polysaccharides.

[0028] The beneficial effects of this application are as follows: The monoclonal antibody against Klebsiella pneumoniae capsular polysaccharide provided in this application can specifically bind to the capsular polysaccharide of Klebsiella pneumoniae type K47, which is beneficial for the clinical typing of Klebsiella pneumoniae. In vivo and in vitro animal experiments have demonstrated its excellent efficacy in the prevention and treatment of Klebsiella pneumoniae type K47 infection, providing a way to solve the problems of Klebsiella pneumoniae infection and multidrug resistance. It has significant implications for the prevention, diagnosis and treatment of Klebsiella pneumoniae infection and is of great value for the development of next-generation Klebsiella pneumoniae drugs. Attached Figure Description

[0029] Figure 1 This is a graph showing the detection results of the titer level of the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided in this application using the indirect ELISA method in Example 2. Figure 2 In Example 4, flow cytometry analysis was performed on monoclonal antibody K47-20C10-B8 and Klebsiella pneumoniae with capsular strain HVKP4 and without capsular strain 19-249Δ. wbaP (Image showing the results of the combination of capsular polysaccharide expression gene knockout); Figure 3In Example 4, flow cytometry analysis was performed on monoclonal antibody K47-18G6-B2 and Klebsiella pneumoniae with capsular strain HVKP4 and without capsular strain 19-249Δ. wbaP (Image showing the results of the combination of capsular polysaccharide expression gene knockout); Figure 4 The in vitro bactericidal curves of K47-5B9-F8 and K47-15D7-B10 against Klebsiella pneumoniae HVKP4 strain are shown in Example 5. Figure 5 The survival curve of the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody prophylaxis test provided in this application is shown in Example 6. Detailed Implementation

[0030] The technical solutions of this application will be clearly and completely described below. Obviously, the described embodiments are only some, not all, of the embodiments of this application. Based on the embodiments of this application, all other embodiments obtained by those skilled in the art without creative effort are within the scope of protection of this application.

[0031] The following is information on the preservation of the microbial strain: The hybridoma cell lines K47-5B9-F8 (CCTCC NO:C2023314), K47-20C10-B8 (CCTCC NO:C2023313), K47-15D7-B10 (CCTCC NO:C2023312), K47-18G6-B2 (CCTCC NO:C2023311), and K47-6E2 (CCTCC NO:C2023296) provided in this application were all deposited at the China Center for Type Culture Collection on October 17, 2023.

[0032] The hybridoma cell line K47-4H8 (CCTCC:C2024339) provided in this application was deposited at the China Center for Type Culture Collection on September 25, 2024.

[0033] Location of the collection: Wuhan University, Wuhan City, Hubei Province.

[0034] Collection name and collection number: Hybridoma cell line K47-5B9-F8, CCTCC NO: C2023314.

[0035] Hybridoma cell line K47-20C10-B8, CCTCC NO: C2023313.

[0036] Hybridoma cell line K47-15D7-B10, CCTCC NO: C2023312.

[0037] Hybridoma cell line K47-18G6-B2, CCTCC NO: C2023311.

[0038] Hybridoma cell line K47-6E2, CCTCC NO: C2023296.

[0039] Hybridoma cell line K47-4H8: CCTCC:C2024339.

[0040] In Example 5 of this application, the negative control antibody light chain variable region (VL) sequence used (as shown in SEQ ID NO:49) is as follows: QIVLTQSPAIMSASPGEKVTMTCSATSSVTYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPRTFGGGTKLEIK The negative control antibody heavy chain variable region (VH) sequence used (as shown in SEQ ID NO:50): QVQLQQPGAELVRPGASVKLSCKASGYTFTTYWMNWIKQRPEQGLEWIGRIDPYDSETHYSQKFKDKAILTVDKSSSTAYMQLSSSLTSEDSAVYYCARGYANGAFVYWGQGTLVTVSA Example 1: Preparation of monoclonal antibody against Klebsiella pneumoniae K47 capsular polysaccharide 1) Establishment of a Klebsiella pneumoniae K47 capsular polysaccharide monoclonal antibody cell line The capsular polysaccharide extracted from K47 type Klebsiella pneumoniae (GDMCC No: 62131) after fermentation was chemically coupled with a carrier protein (a non-toxic variant of diphtheria toxoid CRM197) to obtain a K47 type capsular polysaccharide-protein conjugate. The method used was a commonly used polysaccharide activation method, such as the cyanogen bromide method (refer to US6375846B1), 1-cyano-4-dimethylaminopyridine tetrafluoroborate (CDAP) (EP0720485), and the periodic acid oxidation method (US4711779). K47 capsular polysaccharide-protein conjugate was added to Freund's adjuvant, and SPF-grade BALB / c mice were immunized multiple times. When the immunotiter was greater than 1:300,000, the spleens were harvested and hybridoma technology was used. After PEG1500 fusion, indirect ELISA screening of positive cell supernatants, and multiple subcloning, five monoclonal cell lines were obtained: hybridoma cell line K47-5B9-F8 (CCTCC NO:C2023314), hybridoma cell line K47-20C10-B8 (CCTCC NO:C2023313), hybridoma cell line K47-15D7-B10 (CCTCC NO:C2023312), hybridoma cell line K47-18G6-B2 (CCTCC NO:C2023311), and hybridoma cell line K47-6E2 (CCTCC NO:C2023312). The study used NO:C2023296 and hybridoma cell line K47-4H8 (CCTCC:C2024339) and sequenced them to verify that they were purebred.

[0041] The sequence information of six Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies is as follows (SEQ NO:1~SEQ NO:48 in order): K47-5B9-F8-Light chain variable region (VL) sequence: MDFQVQIFSLLLISVTVIVSCGEIVLTQSPTTLAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGLPARFSGSGSGTSYSLTIGTMEAEDVATYFCQQGGGIPRITFGSGTKLEIK K47-5B9-F8 heavy chain variable region (VH) sequence: MNFGLSWVFLVTLLNGIQCEVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWVRQPPGKALEWLGFIRNKANGYTTEYTASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCAREAYRFDGAMDYWGQGTSVTVSS Complementarity-determining region 1 (LCDR1) sequence of the K47-5B9-F8 light chain: SASSSISSNYLH The complementarity-determining region 2 (LCDR2) sequence of the K47-5B9-F8 light chain: RTSNLAS The complementarity-determining region 3 (LCDR3) sequence of the K47-5B9-F8 light chain: QQGGGIPRIT Complementarity-determining region 1 (HCDR1) sequence of the K47-5B9-F8 heavy chain: DYYMN The complementarity-determining region 2 (HCDR2) sequence of the K47-5B9-F8 heavy chain: FIRNKANGYTTEYTASVKG The complementarity-determining region 3 (HCDR3) sequence of the K47-5B9-F8 heavy chain: EAYRFDGAMDY K47-15D7-B10-Light chain variable region (VL) sequence: MDFQVQIFSLLLISVTVIVSNGEIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPRITFGSGTKLEIK K47-15D7-B10 heavy chain variable region (VH) sequence: MNFGLSWVFLVTLLNGIQCEVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWFRQPPGKALEWLGFIRNKANGYTIEYTPSVQGRFTISRDNSQSILYLHMITLRTEDSATYYCAREAYRFDGAMDYWGQGTSVTVSS The complementarity-determining region 1 (LCDR1) sequence of the K47-15D7-B10 light chain: SASSSISSNYLH The complementarity-determining region 2 (LCDR2) sequence of the K47-15D7-B10 light chain: RTSNLAS The complementarity-determining region 3 (LCDR3) sequence of the K47-15D7-B10 light chain: QQGSSIPRIT Complementarity-determining region 1 (HCDR1) sequence of the K47-15D7-B10 heavy chain: DYYMN The complementarity-determining region 2 (HCDR2) sequence of the K47-15D7-B10 heavy chain: FIRNKANGYTIEYTPSVQG The complementarity-determining region 3 (HCDR3) sequence of the K47-15D7-B10 heavy chain: EAYRFDGAMDY K47-18G6-B2-Light chain variable region (VL) sequence: MSPAQFLVLLLFWIPASRGDVVLTQTPLSLPVSFGDQVSISCRSSQSLVNSYGITYLSWYLHKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISTIKPEDLGMYYCLQGTHQPWTFGGGTKLEIK K47-18G6-B2 heavy chain variable region (VH) sequence: MEWTGIFILSVTAGVHSQVQLQQSGAELVRPGTSVKISCKASGYAFTNYWLGWIKQRPGHGLEWIGDFYPGSGSTYYNEKFKGKATLTADKSSSTAYMQVSSLTSEDAAVYFCTRKGFYGTSGRYFAYWGQGTTLTVSS The complementarity-determining region 1 (LCDR1) sequence of the K47-18G6-B2 light chain: RSSQSLVNSYGITYLS The complementarity-determining region 2 (LCDR2) sequence of the K47-18G6-B2 light chain: GISNRFS The complementarity-determining region 3 (LCDR3) sequence of the K47-18G6-B2 light chain: LQGTHQPWT The complementarity-determining region 1 (HCDR1) sequence of the K47-18G6-B2 heavy chain: NYWLG The complementarity-determining region 2 (HCDR2) sequence of the K47-18G6-B2 heavy chain: DFYPGSGSTYYNEKFKG The complementarity-determining region 3 (HCDR3) sequence of the K47-18G6-B2 heavy chain: KGFYGTSGRYFAY K47-6E2-Light chain variable region (VL) sequence: MDFQVQIFSLLLISVTVMVSNGEIVLTQSPTTMAASPGEKITITCSASSSVRSNYLHWYQQKPGCSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSMPRITFGSGTKLEIN K47-6E2-heavy chain variable region (VH) sequence: MNFGLSWVFLVTLLNGIQCEVKLVESGGGLVLPGGSLRLSCTTSGFTFTDYYMNWVRQPPGKALEWLGFIRNKANGYTTDYNASVKGRFTISRDNSQSILYLQMNTLRAEDSASYYCARESYRYDGAMDYWGQGTSVTVSS The complementarity-determining region 1 (LCDR1) sequence of the K47-6E2 light chain: SASSSVRSNYLH The complementarity-determining region 2 (LCDR2) sequence of the K47-6E2 light chain: RTSNLAS The complementarity-determining region 3 (LCDR3) sequence of the K47-6E2-light chain: QQGSSMPRIT The complementarity-determining region 1 (HCDR1) sequence of the K47-6E2 heavy chain: DYYMN The complementarity-determining region 2 (HCDR2) sequence of the K47-6E2 heavy chain: FIRNKANGYTTDYNASVKG The complementarity-determining region 3 (HCDR3) sequence of the K47-6E2 heavy chain: ESYRYDGAMDY K47-20C10-B8-Light Chain Variable Region (VL) Sequence: MESHSQVFIFLLFWIPVSRGDILLTQSPAILSVSPGERVSFSCRASQSIGRSIHWYQQRTNGSPRLLIKYASESIYGIPSRFSGSGSGTDFTLSINSVESEDIAAYYCQQSYNWPRTFGGGTKLEIK K47-20C10-B8 heavy chain variable region (VH) sequence: MNFGLSWVFLVALLNGVQCQVQLVETGGGLVRPGNSLNLSCITSGFTFSNYRLHWLRQPPGKGLEWLAVIAVKSDNFGAIYADSVKGRFTISRDDSRSSVYLQMNRLREEDTATYYCVRAGVSFFDYWGQGTSLTVSS Complementarity-determining region 1 (LCDR1) sequence of the K47-20C10-B8 light chain: RASQSIGRSIH The complementarity-determining region 2 (LCDR2) sequence of the K47-20C10-B8 light chain: YASESIY The complementarity-determining region 3 (LCDR3) sequence of the K47-20C10-B8 light chain: QQSYNWPRT Complementarity-determining region 1 (HCDR1) sequence of the K47-20C10-B8 heavy chain: NYRLH The complementarity-determining region 2 (HCDR2) sequence of the K47-20C10-B8 heavy chain: VIAVKSDNFGAIYADSVKG The complementarity-determining region 3 (HCDR3) sequence of the K47-20C10-B8 heavy chain: AGVSFFDY K47-4H8-Light chain variable region (VL) sequence: MSPTQFLVLLLFWIPASRGDVVVTQTPLSLPVSFGDQVSISCRSSQSLANSYGNTYLSWYLHKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISTIKPEDLGMYYCLQGTHQPWTFGGGTKLEIK K47-4H8-heavy chain variable region (VH) sequence: MGWSVVFIFLLSVTAGVHSQVQLQQSGAELVRPGTSVKISCKASGYAFTNYWLGWIKQRPGHGLEWIGDIYPGGDKTYYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSGVYFCARKGYYGSNGRYFAYWGQGTTLTVSS Complementarity-determining region 1 (LCDR1) sequence of the K47-4H8-light chain: RSSQSLANSYGNTYLS Complementarity-determining region 2 (LCDR2) sequence of the K47-4H8-light chain: GISNRFS The complementarity-determining region 3 (LCDR3) sequence of the K47-4H8-light chain: LQGTHQPWT Complementarity-determining region 1 (HCDR1) sequence of the K47-4H8 heavy chain: NYWLG Complementarity-determining region 2 (HCDR2) sequence of the K47-4H8 heavy chain: DIYPGGDKTYYNEKFKG The complementarity-determining region 3 (HCDR3) sequence of the K47-4H8 heavy chain: KGYYGSNGRYFAY As described in this application, the term "CDR" or "complementarity-determining region" refers to a discontinuous antigen-binding site found within the variable region of a heavy-chain or light-chain polypeptide. In this application, the amino acid sequences of the CDRs listed above are all as shown in accordance with the Kabat definition rules (the sequences in the claims of this invention are also as shown in accordance with the Kabat definition rules). However, it is well known to those skilled in the art that the CDR of an antibody can be defined in various ways. In the literature Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., US Dept. of Health and Human Services, "Sequences of proteins of immunological interest" (1991); Chothiaet al, J. Mol. Biol. 196:901-917 (1987); Al-Lazikani B. et al., J. Mal. Biol., 273: 927-948 (1997); MacCallum et al, J. Mol. Biol. 262:732-745 (1996); Abhinandan and Martin, Mal. Immunol., 45: 3832-3839 (2008); LefrancM.P. et al., Dev. Comp. Jmmunol., 27: 55-77 (2003); These specific regions have been described in Honegger and Pltickthun, J. Mal Biol., 309:657-670 (2001), where these definitions include overlaps or subsets of amino acid residues when compared with each other. However, any definition used to indicate the CDR of an antibody or transplanted antibody or its variant is included within the scope of the terminology defined and used in this application. Algorithms for CDR prediction and binding interfaces are known in the art, for example, as described in Abhinandan and Martin, Mal. Immunol., 45: 3832-3839 (2008); Ehrenmann F. et al., Nucleic Acids Res., 38: D301-D307 (2010) and Adolf-Bryfogle J. et al., Nucleic Acids Res., 43: D432-D438 (2015).The references cited in this paragraph are incorporated herein by reference in their entirety for use in this application and in one or more claims that may be included in this application.

[0042] As used herein, “monoclonal antibody” refers to a group of homologous antibodies that participate in the highly specific recognition and binding of a single antigenic determinant or epitope, encompassing full-length and complete monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single-chain (scFv) mutants, fusion proteins containing antibody moieties, and any other modified immunoglobulin molecules containing antigen recognition sites. Furthermore, “monoclonal antibody” refers to such antibodies prepared in any number of ways (including but not limited to hybridoma, phage selection, recombinant expression, and transgenic animals). In humans, this category includes IgG1, IgG2, IgG3, and IgG4. In mice, this category includes IgG1, IgG2a, IgG2b, and IgG3. It is known in the art that the antigen-binding function of an antibody can be performed by a fragment of a full-length antibody. The monoclonal antibody or antigen-binding fragment described in the claims of this invention comprises the Fc fragment of antibodies in the above-described categories.

[0043] 2) Preparation and purification of ascites fluid containing Klebsiella pneumoniae K47 polysaccharide monoclonal antibody The obtained monoclonal antibody cells were cultured and then injected intraperitoneally with 0.5 mL of a solution at a concentration of 1×10⁻⁶. 6 Cells per mL were introduced into BALB / c mice sensitized with paraffin oil 7 days in advance. After 7-10 days, obvious abdominal distension was observed in the mice, and the ascites fluid was collected and purified.

[0044] Mouse ascites fluid was diluted with PBS, and crude purity was precipitated by adding 50% final concentration of ammonium sulfate. After further purification by Protein A affinity column chromatography and ion exchange chromatography, monoclonal antibodies with a purity greater than 90% were obtained. After sterile filtration through a 0.22 μm filter membrane, the purified antibody was stored in PBS at pH 7.0-7.4.

[0045] Example 2: Detection of titer levels of monoclonal antibodies against Klebsiella pneumoniae K47 capsular polysaccharide After cell fusion, screening, and several subcloning processes, six monoclonal antibody cell lines were obtained. The ELISA results of the cell culture supernatant binding to K47 capsular polysaccharide are shown in Table 1 below.

[0046] Table 1

[0047] like Figure 1 As shown, the titer level of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided in this application was detected by indirect ELISA. It can be seen that all six monoclonal antibodies have good binding affinity to K47 capsular polysaccharide.

[0048] Example 3: ELISA detection of binding specificity of monoclonal antibody against Klebsiella pneumoniae K47 capsular polysaccharide The specificity of the Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided in this application in reaction with capsular polysaccharides of serotypes K47, K64, K19, K1, K2, K38, and K57 was evaluated by indirect ELISA. Klebsiella pneumoniae capsular polysaccharides of different serotypes were coated onto ELISA plates and incubated at 37°C for 3 hours. After blocking with 1% BSA for 1 hour, an appropriate amount of K47 Klebsiella pneumoniae capsular polysaccharide monoclonal antibody was added to react with the coated polysaccharides at a concentration of 50 µL per well, and incubated overnight. After washing the plates, a secondary antibody diluted 1:30,000 was added to each well at a concentration of 100 µL, and incubated for 2 hours. After washing, 1 mg / mL PNPP-Na chromogenic substrate was added to each well at a concentration of 100 µL, and incubated for 2 hours. The reaction was stopped by adding 3M NaOH to each well at a concentration of 50 µL, and the OD405 value was read using an ELISA reader.

[0049] The results of the binding of the six Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies provided in this application to Klebsiella pneumoniae capsular polysaccharides of different serotypes are shown in Table 2 below: Table 2

[0050] As can be seen from Table 2 above, the six Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies provided in this application are specific for K47 capsular polysaccharide, but do not cross-react with capsular polysaccharides of other serotypes of Klebsiella pneumoniae.

[0051] Example 4: Flow cytometry detection of the binding of Klebsiella pneumoniae K47 capsular polysaccharide monoclonal antibody to Klebsiella pneumoniae K47. The highly virulent strains of Klebsiella pneumoniae, HVKP4 and 19-249Δ, were used. wbaP The strain (capsular polysaccharide expression gene knockout) was inoculated into 5 mL of LB medium and cultured at 37 °C and 250 rpm until the OD value reached 0.7. 0.2 mL of bacterial solution was centrifuged at 8000 g for 10 min, the precipitate was collected, washed twice with PBS, and resuspended in 0.2 mL of PBS. After fixation with 4% paraformaldehyde for 10 min, and after washing, blocked with 2% BSA for 1 h, it was incubated with K47 capsular polysaccharide monoclonal antibody overnight. After washing, anti-mouse fluorescent antibody (brand - CST, catalog number - #4410S) was added and incubated in the dark for 1 h. After washing with PBS, it was resuspended in PBS and detected by flow cytometry.

[0052] Test results as follows Figure 2 As shown, Figure 2 Flow cytometry analysis was performed to differentiate monoclonal antibody K47-20C10-B8 from capsulated Klebsiella pneumoniae HVKP4 and non-capsulated Klebsiella pneumoniae 19-249Δ. wbaP Binding peak diagram of (capsular polysaccharide expression gene knockout) Figure 3 For flow cytometry analysis of monoclonal antibody K47-18G6-B2 with Klebsiella pneumoniae HVKP4 and bacteria 19-249Δ wbaP Binding peak diagram of (capsular polysaccharide expression gene knockout).

[0053] See Figure 2 It is known that monoclonal antibody K47-20C10-B8 can bind to the highly virulent strain of Klebsiella pneumoniae HVKP4, and to Klebsiella pneumoniae 19-249Δ. wbaP (Knockout of the capsular polysaccharide expression gene) does not bind, indicating that the monoclonal antibody K47-20C10-B8 can be applied to the diagnosis and typing of clinical strains.

[0054] See Figure 3 The binding of monoclonal antibody K47-18G6-B2 to Klebsiella pneumoniae HVKP4 was detected. The results showed that monoclonal antibody K47-18G6-B2 could bind to capsulated strains and Klebsiella pneumoniae 19-249Δ. wbaP (Knockout of the capsular polysaccharide expression gene) does not bind, indicating that the monoclonal antibody K47-18G6-B2 can be applied to the diagnosis and typing of clinical strains.

[0055] Example 5: Bactericidal assay of monoclonal antibody against Klebsiella pneumoniae K47 capsular polysaccharide This embodiment illustrates the opsonization and phagocytosis bactericidal assay of the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided in this application, specifically: a carbapenem-resistant Klebsiella pneumoniae HVKP4 strain diluted 10... 5 CFU / mL was added at 10 μL / well to a 96-well cell culture plate. The Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided in this application was serially diluted and added at 20 μL / well to the above cell culture plate. The cells and antibody were incubated at 700 rpm / min for 30 min. HL-60 cells differentiated from DMF were washed with HBSS buffer and adjusted to a concentration of 1×10⁻⁶. 7 cells / mL, then add 1×10 7 Cell suspension at a concentration of 1 / mL was mixed with diluted complement at a volume ratio of 1:4. The mixture was then added at a rate of 50 μL / well to a 96-well cell culture plate. The 96-well plate was placed on a mixer and incubated in a CO2 incubator at 37°C with shaking for 45 min. After stopping opsonization, the cells were spotted onto blood agar plates and incubated overnight in a CO2 incubator. The bactericidal rate of each antibody dilution was calculated.

[0056] like Figure 4The image shows the in vitro bactericidal curves of the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies K47-5B9-F8 and K47-15D7-B10 against Klebsiella pneumoniae HVKP4 strain, provided in this application. Figure 4 It can be seen that K47-5B9-F8 and K47-15D7-B10 have good bactericidal effects against the highly virulent strain HVKP4 in vitro, with the highest bactericidal rates reaching 91.5% and 95.5%, respectively. These results show significant differences compared to the negative control antibody.

[0057] Example 6: Prophylactic test of monoclonal antibody against Klebsiella pneumoniae K47 capsular polysaccharide This embodiment illustrates the protective test of the K47 Klebsiella pneumoniae capsular polysaccharide monoclonal antibody provided in this application. Specifically, six Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies were administered intraperitoneally to five mice in each group, with each mouse receiving 0.25 mg. PBS was used as a negative control. Four hours later, the highly virulent K47 Klebsiella pneumoniae strain HVKP4 was injected at 8.5 × 10⁻⁶ mg. 5 The bacterial count of CFU was used to infect Balb / c mice (n=5) via intraperitoneal infection. The survival rate of the mice was observed 10 days after infection, and survival curves were plotted.

[0058] like Figure 5 The image shows the survival curves of the prophylactic test for Klebsiella pneumoniae capsular polysaccharide monoclonal antibodies provided in this application. It can be seen that 4 hours after administration of the six K47 capsular polysaccharide monoclonal antibodies and the control PBS, the amount of Klebsiella pneumoniae K47 (strain number HVKP4) was 8.5 × 10⁻⁶. 5 With CFU challenge, the survival rate in the control group was 20%, while the survival rate in all five monoclonal antibody groups was 100%, showing a statistically significant difference. p <0.0001.

[0059] In summary, the above embodiments are merely preferred embodiments of this application and are not intended to limit the scope of protection of this application. Any modifications, equivalent substitutions, improvements, etc., made within the spirit and principles of this application should be included within the scope of protection of this application.

Claims

1. A monoclonal antibody against Klebsiella pneumoniae capsular polysaccharide, characterized in that, The Klebsiella pneumoniae is K47 type Klebsiella pneumoniae. The amino acid sequence of the light chain variable region of the monoclonal antibody is shown in SEQ NO:33, and the amino acid sequence of the heavy chain variable region is shown in SEQ NO:

34. The sequences of complementarity-determining regions 1-3 of the light chain variable region of the monoclonal antibody are SEQ ID:35, SEQ ID:36, and SEQ ID:37, respectively; the sequences of complementarity-determining regions 1-3 of the heavy chain variable region of the monoclonal antibody are SEQ ID:38, SEQ ID:39, and SEQ ID:40, respectively.

2. A hybridoma cell line, characterized in that, The hybridoma cell line is named K47-20C10-B8, with accession number CCTCC NO:C2023313. The hybridoma cell line is used to prepare the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in claim 1.

3. A pharmaceutical composition, characterized in that, The antibody comprises the K47 type Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in claim 1, and one or more combinations of a pharmaceutically acceptable carrier or diluent.

4. A kit for detecting Klebsiella pneumoniae type K47, characterized in that, It includes the monoclonal antibody as described in claim 1, and one or more combinations of positive control, negative control, antibody diluent, chromogenic solution, stop solution, blocking solution or washing solution.

5. The use of the K47 Klebsiella pneumoniae capsular polysaccharide monoclonal antibody as described in claim 1 in the preparation of K47 Klebsiella pneumoniae infection treatment drugs and / or detection products.

Citation Information

Patent Citations

  • Method of activating soluble carbohydrate using novel cyanylating reagents for the production of immunogenic constructs

    EP0720485A1

  • Glycoproteinic conjugates having trivalent immunogenic activity

    US4711779A

  • Cyanogen bromide-activation of hydroxyls on silica for high pressure affinity chromatography

    US6375846B1