Recombinant sialidases and methods of using the same
Recombinant sialidases conjugated to serum half-life enhancers effectively treat sialic acid-related disorders like cancer by desialylating cancer cells, overcoming immune suppression and enhancing anti-tumor activity.
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- PALLEON PHARMA INC
- Filing Date
- 2020-07-03
- Publication Date
- 2026-07-23
AI Technical Summary
Current cancer immunotherapies, particularly those using immune checkpoint inhibitors, are ineffective for many patients due to immune suppressive tumor microenvironments mediated by hypersialylated cancer cells, necessitating interventions that can overcome this suppression.
Administration of recombinant sialidases conjugated to serum half-life enhancers, such as Fc domains, transferrin, or albumin, to enhance the serum half-life and activity of sialidases, allowing them to remove sialic acid from cancer cells and their microenvironment, thereby reducing immune suppression.
Enhances NK cell-mediated killing of tumor cells and increases anti-tumor activity by desialylating cancer cells, improving treatment outcomes for cancers associated with hypersialylation.
Smart Images

Figure 00000162_0000 
Figure 00000162_0001 
Figure 00000162_0002
Abstract
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of, and priority to, U.S. Provisional Patent Application serial number 62 / 870,336, filed July 3, 2019 and U.S. Provisional Patent Application serial number 62 / 957,027, filed January 3, 2020, the entire disclosure of each of which is hereby incorporated by reference in its entirety. FIELD OF THE INVENTION
[0002] The invention relates generally to recombinant sialidases, methods and compositions for extending the serum half-life of recombinant sialidases, and use of the same in the treatment of a sialic acid-related disorder. BACKGROUND
[0003] A growing body of evidence supports roles for glycans, and sialoglycans in particular, at various pathophysiological steps of tumor progression. Glycans regulate tumor proliferation, invasion, hematogenous metastasis and angiogenesis (Fuster etaL (2005) Nat. Rev. Cancer 5(7): 526-42). The sialylation of cell surface glycoconjugates is frequently altered in cancers, resulting in the expression of sialylated tumor-associated carbohydrate antigens. The expression of sialylated glycans by tumor cells is often associated with increased aggressiveness and metastatic potential of a tumor.
[0004] It has recently become apparent that Siglecs (sialic acid-binding immunoglobulin-like lectins), a family of sialic acid binding lectins, play a role in cancer immune suppression by binding to hypersialylated cancer cells and mediating the suppression of signals from activating NK cell receptors, thereby inhibiting NK cell-mediated killing of tumor cells (Jandusc / a / . (2014) J. Clin. Invest. 124: 1810-1820; Laubli etaL (2014)Proc.Natl. Acad. Sci.USA 111: 14211-14216; Hudak etal. (2014)Nat. Chem.Biol. 10: 69-75). Likewise, enzymatic removal of sialic acids by treatment with sialidase can enhance NK cell-mediated killing of tumor cells (Jandus, supra, Hudak, supra; Xiao et al. (2016) Proc. Natl. Acad. Sci.USA 113(37): 10304-9.)
[0005] Cancer immunotherapy with immune checkpoint inhibitors, including antibodies blocking the PD-1 / PD-L1 pathway, has improved the outcome of many cancer patients. However, despite advances that have been made to date, many patients do not respond to currently available immune checkpoint inhibitors. Accordingly, there is still a need for effective interventions that overcome the immune suppressive tumor microenvironment and for treating cancers associated with hypersialylated cancer cells. SUMMARY OF THE INVENTION
[0006] The invention is based, in part, upon the discovery that it is possible to treat a sialic acid-mediated disorder by administering a sialidase enzyme or a sialidase enzyme conjugated to a serum half-life enhancer. Surprisingly, it has been discovered that a sialidase or a sialidase enzyme conjugated to a serum half-life enhancer that lacks a targeting moiety (e.g., an antibody binding domain directed to a tumor antigen) can effectively treat a sialic acid-mediated disorder (e.g., cancer, e.g., a solid tumor) in vivo.
[0007] The invention further relates to recombinant forms of sialidase enzymes, sialidase enzymes conjugated to a serum half-life enhancer, and pharmaceutical compositions thereof, that have suitable substrate specificities and activities to be useful in removing sialic acid and / or sialic acid containing molecules from the surface of cancer cells and / or removing sialic acid and / or sialic acid containing molecules from the tumor microenvironment, and / or reducing the concentration of sialic acid and / or sialic acid containing molecules in the tumor microenvironment.
[0008] Thus, in certain aspects, the invention provides a pharmaceutical composition comprising or consisting essentially of a sialidase conjugated to a serum half-life enhancer that increases the serum half-life of the sialidase when administered to a subject.
[0009] In another aspect, the invention provides a method of treating a sialic acid-related disorder in a subject in need thereof. The method includes administering to the subject an effective amount of a pharmaceutical composition comprising or consisting essentially of a sialidase and a serum half-life enhancer that increases the serum half-life of the sialidase when administered to the subject, thereby to treat the disorder.
[0010] In certain embodiments, the sialidase is not conjugated to a cancer antigen targeting agent that binds a cancer antigen associated with a cancerous cell.
[0011] In certain embodiments, the sialidase is a functional fragment of a full-length sialidase or a variant that exhibits at least 50% of the activity of the full-length sialidase.
[0012] In certain embodiments, the sialidase and the serum half-life enhancer are covalently linked together in a fusion protein or are chemically conjugated together.
[0013] In certain embodiments, the serum half-life enhancer is selected from the group consisting of an Fc domain, transferrin, albumin, XTEN, a homo-amino acid polymer (HAP), a proline-alanine-serine polymer (PAS), an elastin-like peptide (ELP), albumin binding domain, CTP fusion, GLK fusion, and a polyethylene glycol.
[0014] In certain embodiments, the serum half-life enhancer is an Fc domain.
[0015] In certain embodiments, the serum half-life enhancer is not an Fc domain or polyethylene glycol.
[0016] In certain embodiments, the sialidase comprises one or more mutations relative to a template, wild-type sialidase.
[0017] In certain embodiments, the sialidase comprises a substitution or deletion of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (Ml); a substitution of a valine residue at a position corresponding to position 6 of wild-type human Neu2 (V6); a substitution of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (1187); or a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); or a combination of any of the foregoing substitutions. In certain embodiments, in the sialidase, (a) the methionine residue at a position corresponding to position 1 of wild-type human Neu2 is deleted (AMI), is substituted by alanine (MIA), or is substituted by aspartic acid (MID); (b) the valine residue at a position corresponding to position 6 of wild-type human Neu2 is substituted by tyrosine (V6Y); (c) the isoleucine residue at a position corresponding to position 187 of wildtype human Neu2 is substituted by lysine (I187K); (d) or the cysteine residue at a position corresponding to position 332 of wild-type human Neu2 is substituted by alanine (C332A); or the sialidase comprises a combination of any of the foregoing substitutions.
[0018] In certain embodiments, the sialidase comprises a substitution or deletion of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (Ml); a substitution of a valine residue at a position corresponding to position 6 of wild-type human Neu2 (V6); a substitution of an proline residue at a position corresponding to position 62 of wild-type human Neu2 (P62); a substitution of an alanine residue at a position corresponding to position 93 of wild-type human Neu2 (A93); a substitution of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (1187); a substitution of a glutamine residue at a position corresponding to position 126 of wild-type human Neu2 (Q126); a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (A242); a substitution of a glutamine residue at a position corresponding to position 270 of wild-type human Neu2 (Q270); a substitution of a serine residue at a position corresponding to position 301 of wild-type human Neu2 (S301); a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302); a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); or a combination of any of the foregoing substitutions.
[0019] In certain embodiments, the sialidase comprises a combination of substitutions selected from the group consisting of: (a) MID, V6Y, P62G, A93E, I187K, C332A; (b) MID, V6Y, P62G, A93E, I187K, S301A, W302R, C332A; (c) MID, V6Y, P62G, A93E, Q126Y, I187K, A242F, Q270T, C332A; (d) MID, V6Y, P62G, A93E, Q126Y, I187K, C332A; and (e) A93E, Q126Y, I187K, A242F, Q270T, C332A.
[0020] In certain embodiments, the sialidase conjugated to a serum half-life enhancer comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 115, 152, 180, 184, and 188, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% to an amino acid sequence selected from the group consisting of SEQ ID NOs: 115, 152, 180, 184, and 188.
[0021] In certain embodiments, the sialidase comprises a substitution of a proline residue at a position corresponding to position 5 of wild-type human Neu2 (P5); a substitution of a lysine residue at a position corresponding to position 9 of wild-type human Neu2 (K9); a substitution of a lysine residue at a position corresponding to position 44 of wild-type human Neu2 (K44); a substitution of a lysine residue at a position corresponding to position 45 of wild-type human Neu2 (K45); a substitution of a leucine residue at a position corresponding to position 54 of wild-type human Neu2 (L54); a substitution of a proline residue at a position corresponding to position 62 of wild-type human Neu2 (P62); a substitution of a glutamine residue at a position corresponding to position 69 of wild-type human Neu2 (Q69); a substitution of an arginine residue at a position corresponding to position 78 of wild-type human Neu2 (R78); a substitution of an aspartic acid residue at a position corresponding to position 80 of wild-type human Neu2 (D80); a substitution of an alanine residue at a position corresponding to position 93 of wild-type human Neu2 (A93); a substitution of a glycine residue at a position corresponding to position 107 of wild-type human Neu2 (G107); a substitution of a glutamine residue at a position corresponding to position 108 of wild-type human Neu2 (QI08); a substitution of a glutamine residue at a position corresponding to position 112 of wild-type human Neu2 (QI 12); a substitution of a cysteine residue at a position corresponding to position 125 of wild-type human Neu2 (C125); a substitution of a glutamine residue at a position corresponding to position 126 of wild-type human Neu2 (Q126); a substitution of an alanine residue at a position corresponding to position 150 of wild-type human Neu2 (Al 50); a substitution of a cysteine residue at a position corresponding to position 164 of wild-type human Neu2 (Cl 64); a substitution of an arginine residue at a position corresponding to position 170 of wild-type human Neu2 (RI 70); a substitution of an alanine residue at a position corresponding to position 171 of wild-type human Neu2 (A171); a substitution of a glutamine residue at a position corresponding to position 188 of wild-type human Neu2 (QI 88); a substitution of an arginine residue at a position corresponding to position 189 of wild-type human Neu2 (RI 89); a substitution of an alanine residue at a position corresponding to position 213 of wild-type human Neu2 (A213); a substitution of a leucine residue at a position corresponding to position 217 of wild-type human Neu2 (L217); a substitution of a glutamic acid residue at a position corresponding to position 225 of wild-type human Neu2 (E225); a substitution of a histidine residue at a position corresponding to position 239 of wild-type human Neu2 (H239); a substitution of a leucine residue at a position corresponding to position 240 of wild-type human Neu2 (L240); a substitution of an arginine residue at a position corresponding to position 241 of wild-type human Neu2 (R241); a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (A242); a substitution of a valine residue at a position corresponding to position 244 of wild-type human Neu2 (V244); a substitution of a threonine residue at a position corresponding to position 249 of wild-type human Neu2 (T249); a substitution of an aspartic acid residue at a position corresponding to position 251 of wildtype human Neu2 (D251); a substitution of a glutamic acid residue at a position corresponding to position 257 of wild-type human Neu2 (E257); a substitution of a serine residue at a position corresponding to position 258 of wild-type human Neu2 (S258); a substitution of a leucine residue at a position corresponding to position 260 of wild-type human Neu2 (L260); a substitution of a valine residue at a position corresponding to position 265 of wild-type human Neu2 (V265); a substitution of a glutamine residue at a position corresponding to position 270 of wild-type human Neu2 (Q270); a substitution of a tryptophan residue at a position corresponding to position 292 of wild-type human Neu2 (W292); a substitution of a serine residue at a position corresponding to position 301 of wild- 5 - type human Neu2 (S301); a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302); a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); a substitution of a valine residue at a position corresponding to position 363 of wild-type human Neu2 (V363); or a substitution of a leucine residue at a position corresponding to position 365 of wild-type human Neu2 (L365); or a combination of any of the foregoing substitutions.
[0022] In certain embodiments, the sialidase is selected from the group consisting of a bacterial sialidase, a viral sialidase, and a mammalian sialidase. In certain embodiments, the sialidase is a human sialidase. In certain embodiments, the human sialidase is selected from the group consisting of neul, neu2, neu3, and neu4. In certain embodiments, the human sialidase is neu2.
[0023] In certain embodiments, the pharmaceutical comprises from about 0.01 mg / kg to about 100 mg / kg of the sialidase.
[0024] In certain embodiments, the pharmaceutical composition comprises a second therapeutic agent. In certain embodiments, the second therapeutic agent is selected from the group consisting of an anti-inflammatory agent, anti-angiogenic agent, anti-fibrotic agent, or an anti-proliferative compound (e.g., a cytotoxic agent or a checkpoint inhibitor).
[0025] In certain embodiments, the pharmaceutical composition further comprises a stabilizing amount of a sialidase stabilizing agent. In certain embodiments, the sialidase stabilizing agent is a cation. In certain embodiments, the cation is selected from the group consisting of calcium and magnesium.
[0026] In certain embodiments, the pharmaceutical composition is disposed in a sterile container (e.g., bottle or vial). In certain embodiments, the pharmaceutical composition is lyophilized in the sterile container. In certain embodiments, the pharmaceutical composition is present as a solution in the sterile container. In certain embodiments, sterile container is sealed with a septum. In certain embodiments, sterile container has a label disposed thereon identifying the pharmaceutical composition contained in the container.
[0027] In another aspect, the disclosure relates to a method of treating a sialic acid-related disorder in a subject in need thereof, the method comprising administering to the subject a pharmaceutical composition comprising an effective amount of a sialidase and a serum halflife enhancer that increases the serum half-life of the sialidase when administered to a subject, thereby to treat the disorder.
[0028] In certain embodiments, the sialic acid-related disorder is cancer. In certain embodiments, the sialidase is not conjugated to a cancer antigen targeting agent that binds a cancer antigen associated with a cancerous cell.
[0029] In certain embodiments, the sialidase is a functional fragment of a full-length sialidase that exhibits at least 50% of the activity of the full-length sialidase. In certain embodiments, the sialidase is a variant that exhibits at least 50% of the activity of the wild-type sialidase.
[0030] In certain embodiments, the sialidase and the serum half-life enhancer are covalently linked together in a fusion protein. In certain embodiments, the sialidase and serum half-life enhancer are chemically conjugated together.
[0031] In certain embodiments, the serum half-life enhancer is selected from the group consisting of an Fc domain, transferrin, albumin, XTEN, a homo-amino acid polymer (HAP), a proline-alanine-serine polymer (PAS), an elastin-like peptide (ELP), and a polyethylene glycol. In certain embodiments, the serum half-life enhancer is an Fc domain. In certain embodiments, the serum half-life enhancer is not an Fc domain or polyethylene glycol.
[0032] In certain embodiments, the sialidase comprises one or more mutations relative to a template, wild-type sialidase. In certain embodiments, the sialidase comprises a substitution or deletion of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (Ml); a substitution of a valine residue at a position corresponding to position 6 of wild-type human Neu2 (V6); a substitution of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (1187); or a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); or a combination of any of the foregoing substitutions.
[0033] In certain embodiments, in the sialidase, the methionine residue at a position corresponding to position 1 of wild-type human Neu2 is deleted (AMI), is substituted by alanine (MIA), or is substituted by aspartic acid (MID); the valine residue at a position corresponding to position 6 of wild-type human Neu2 is substituted by tyrosine (V6Y); the isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 is substituted by lysine (I187K); or the cysteine residue at a position corresponding to position 332 of wild-type human Neu2 is substituted by alanine (C332A); or the sialidase comprises a combination of any of the foregoing substitutions.
[0034] In certain embodiments, the sialidase comprises a substitution or deletion of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (Ml); a substitution of a valine residue at a position corresponding to position 6 of wild-type human Neu2 (V6); a substitution of an proline residue at a position corresponding to position 62 of wil d-type human Neu2 (P62); a substitution of an alanine residue at a position corresponding to position 93 of wild-type human Neu2 (A93); a substitution of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (1187); a substitution of a glutamine residue at a position corresponding to position 126 of wild-type human Neu2 (Q126); a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (A242); a substitution of a glutamine residue at a position corresponding to position 270 of wild-type human Neu2 (Q270); a substitution of a serine residue at a position corresponding to position 301 of wild-type human Neu2 (S301); a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302); a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); or a combination of any of the foregoing substitutions.
[0035] In certain embodiments, the sialidase comprises a combination of substitutions selected from the group consisting of: (a) MID, V6Y, P62G, A93E, I187K, C332A; (b) MID, V6Y, P62G, A93E, I187K, S301A, W302R, C332A; (c) MID, V6Y, P62G, A93E, Q126Y, I187K, A242F, Q270T, C332A; (d) MID, V6Y, P62G, A93E, Q126Y, I187K, C332A; and (e) A93E, Q126Y, I187K, A242F, Q270T, C332A.
[0036] In certain embodiments, the sialidase conjugated to a serum half-life enhancer comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 115, 152, 180, 184, and 188, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% to an amino acid sequence selected from the group consisting of SEQ ID NOs: 115, 152, 180, 184, and 188.
[0037] In certain embodiments, the sialidase comprises a substitution of a proline residue at a position corresponding to position 5 of wild-type human Neu2 (P5); a substitution of a lysine residue at a position corresponding to position 9 of wild-type human Neu2 (K9); a substitution of a lysine residue at a position corresponding to position 44 of wild-type human Neu2 (K44); a substitution of a lysine residue at a position corresponding to position 45 of wild-type human Neu2 (K45); a substitution of a leucine residue at a position corresponding to position 54 of wild-type human Neu2 (L54); a substitution of a proline residue at a position corresponding to position 62 of wild-type human Neu2 (P62); a substitution of a glutamine residue at a position corresponding to position 69 of wild-type human Neu2 (Q69); a substitution of an arginine residue at a position corresponding to position 78 of wild-type human Neu2 (R78); a substitution of an aspartic acid residue at a position corresponding to position 80 of wild-type human Neu2 (D80); a substitution of an alanine residue at a position corresponding to position 93 of wild-type human Neu2 (A93); a substitution of a glycine residue at a position corresponding to position 107 of wild-type human Neu2 (G107); a substitution of a glutamine residue at a position corresponding to position 108 of wild-type human Neu2 (QI08); a substitution of a glutamine residue at a position corresponding to position 112 of wild-type human Neu2 (QI 12); a substitution of a cysteine residue at a position corresponding to position 125 of wild-type human Neu2 (C125); a substitution of a glutamine residue at a position corresponding to position 126 of wild-type human Neu2 (Q126); a substitution of an alanine residue at a position corresponding to position 150 of wild-type human Neu2 (Al 50); a substitution of a cysteine residue at a position corresponding to position 164 of wild-type human Neu2 (Cl 64); a substitution of an arginine residue at a position corresponding to position 170 of wild-type human Neu2 (RI 70); a substitution of an alanine residue at a position corresponding to position 171 of wild-type human Neu2 (A171); a substitution of a glutamine residue at a position corresponding to position 188 of wild-type human Neu2 (QI 88); a substitution of an arginine residue at a position corresponding to position 189 of wild-type human Neu2 (RI 89); a substitution of an alanine residue at a position corresponding to position 213 of wild-type human Neu2 (A213); a substitution of a leucine residue at a position corresponding to position 217 of wild-type human Neu2 (L217); a substitution of a glutamic acid residue at a position corresponding to position 225 of wild-type human Neu2 (E225); a substitution of a histidine residue at a position corresponding to position 239 of wild-type human Neu2 (H239); a substitution of a leucine residue at a position corresponding to position 240 of wild-type human Neu2 (L240); a substitution of an arginine residue at a position corresponding to position 241 of wild-type human Neu2 (R241); a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (A242); a substitution of a valine residue at a position corresponding to position 244 of wild-type human Neu2 (V244); a substitution of a threonine residue at a position corresponding to position 249 of wild-type human Neu2 (T249); a substitution of an aspartic acid residue at a position corresponding to position 251 of wildtype human Neu2 (D251); a substitution of a glutamic acid residue at a position corresponding to position 257 of wild-type human Neu2 (E257); a substitution of a serine residue at a position corresponding to position 258 of wild-type human Neu2 (S258); a substitution of a leucine residue at a position corresponding to position 260 of wild-type human Neu2 (L260); a substitution of a valine residue at a position corresponding to position 265 of wild-type human Neu2 (V265); a substitution of a glutamine residue at a position corresponding to position 270 of wild-type human Neu2 (Q270); a substitution of a tryptophan residue at a position corresponding to position 292 of wild-type human Neu2 (W292); a substitution of a serine residue at a position corresponding to position 301 of wildtype human Neu2 (S301); a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302); a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); a substitution of a valine residue at a position corresponding to position 363 of wild-type human Neu2 (V363); or a substitution of a leucine residue at a position corresponding to position 365 of wild-type human Neu2 (L365); or a combination of any of the foregoing substitutions.
[0038] In certain embodiments, the sialidase is selected from the group consisting of a bacterial sialidase, a viral sialidase, and a mammalian sialidase. In certain embodiments, the mammalian sialidase is a human sialidase. In certain embodiments, the human sialidase is selected from the group consisting of neul, neu2, neu3, and neu4. In certain embodiments, the human sialidase is neu2.
[0039] In certain embodiments, from about 0.01 mg / kg to about 100 mg / kg of the sialidase is administered to the subject.
[0040] In certain embodiments, the cancer is a solid tumor, soft tissue tumor, hematopoietic tumor or metastatic lesion. In certain embodiments, the solid tumor is a sarcoma, adenocarcinoma, or carcinoma. In certain embodiments, the solid tumor is a head and neck (e.g., pharynx), thyroid, lung (e.g., small cell or non-small cell lung carcinoma (NSCLC)), breast, lymphoid, gastrointestinal (e.g., oral, esophageal, stomach, liver, pancreas, small intestine, colon and rectum, anal canal), genital or genitourinary tract (e.g., renal, urothelial, bladder, ovarian, uterine, cervical, endometrial, prostate, testicular), CNS (e.g., neural or glial cell, e.g., neuroblastoma or glioma), or skin (e.g., melanoma) tumor. In certain embodiments, the cancer is breast cancer.
[0041] In certain embodiments, the hematopoietic tumor is a leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), B-cell, T-cell or FAB ALL, acute myeloid leukemia (AML), chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), e.g., transformed CLL, diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, hairy cell leukemia, myelodyplastic syndrome (MDS), lymphoma, Hodgkin’s disease, malignant lymphoma, nonHodgkin’s lymphoma, Burkitt’s lymphoma, multiple myeloma, or Richter’s Syndrome (Richter’s Transformation). In certain embodiments, the cancer is lymphoma.
[0042] In certain embodiments, administration of the pharmaceutical composition increases expression of granzyme B, IFNy, IL-10, IL-6, or IL-17A in the subject.
[0043] In certain embodiments, the pharmaceutical composition is administered to the subject in combination with another therapeutic agent. In certain embodiments, the therapeutic agent is selected from the group consisting of an anti-inflammatory agent, anti-angiogenic agent, anti-fibrotic agent, or an anti-proliferative compound (e.g., a cytotoxic agent or a checkpoint inhibitor).
[0044] In certain embodiments, the pharmaceutical composition further comprises a stabilizing amount of a sialidase stabilizing agent. In certain embodiments, the sialidase stabilizing agent is a cation. In certain embodiments, the cation is selected from the group consisting of calcium and magnesium.
[0045] In certain embodiments, the pharmaceutical composition, prior to administration, is disposed in a sterile container (e.g., bottle or vial).
[0046] In certain embodiments, the method comprises administering an effective amount of the pharmaceutical composition to the subject.
[0047] In certain embodiments, the disclosure relates to a method of removing sialic acid from a cell in a subject, the method comprising administering to the subject an effective amount of the pharmaceutical composition thereby to remove sialic acid from the cell.
[0048] In certain embodiments, the cell is a tumor cell, dendritic cell (DC) or monocyte. In certain embodiments, the cell is a monocyte, and the method results in increased expression of an MHC-II molecule on the monocyte.
[0049] In certain embodiments, the disclosure relates to a method of increasing phagocytosis of a tumor cell in a subject, the method comprising administering to the subject an effective amount of the pharmaceutical composition in an amount effective to remove sialic acid from the tumor cell, thereby increasing phagocytosis of the tumor cell.
[0050] In certain embodiments, the disclosure relates to a method of activating a dendritic cell (DC) in a subject, the method comprising administering to the subject an amount of the pharmaceutical composition effective to remove sialic acid from a tumor cell in the subject, thereby to activate the DC in the subject.
[0051] In certain embodiments, the disclosure relates to a method of reducing Siglec-15 binding activity, thereby increasing anti-tumor activity in a tumor microenvironment of a patient, the method comprising administering to the subject an effective amount of the pharmaceutical composition, thereby increasing anti-tumor activity (e.g., T cell activity) in the subject.
[0052] In another aspect, the invention provides a method of expressing a recombinant sialidase. The method can include (a) providing a cell comprising a nucleic acid encoding the recombinant sialidase and (b) expressing the recombinant sialidase in the presence of a stabilizing agent. In certain embodiments, the method further includes purifying the recombinant sialidase produced in step (b). The purification can be performed in the presence of a stabilizing agent, such as a cation (e.g., calcium or magnesium).
[0053] These and other aspects and features of the invention are described in the following detailed description and claims. DESCRIPTION OF THE DRAWINGS
[0054] The invention can be more completely understood with reference to the following drawings.
[0055] FIGURE 1 depicts different configurations for sialidase-Fc fusion constructs. Sialidase-Fc fusion constructs can comprise a first polypeptide comprising a first immunoglobulin Fc domain (“Fc domain”), and a second polypeptide comprising a second immunoglobulin Fc domain. The first and second polypeptides can be covalently linked together, e.g., by disulfide bond(s). FIGURE 1A shows a construct having two Fc domains and a sialidase enzyme conjugated to the N-terminus of each Fc domain. FIGURE IB shows a construct having two Fc domains and a sialidase enzyme conjugated to the C-terminus of the first Fc domain and the N-terminus of the second Fc domain. FIGURE IC shows a construct having two Fc domains and a sialidase enzyme conjugated to the N-terminus of the second Fc domain. FIGURE ID shows a construct having two Fc domains and a sialidase enzyme conjugated to the C-terminus of the first Fc domain. FIGURE IE shows a construct having two Fc domains and a sialidase enzyme conjugated to the C-terminus of the each Fc domain. It is understood that the Fc domains can be naturally occurring Fc domains or engineered Fc domains containing modifications, such as, point mutations in each polypeptide chain that facilitates a knob into hole configuration, or to provide a modified Fc domain functionality.
[0056] FIGURE 2 depicts an SDS-PAGE gel showing recombinant human Neul, Neu2, Neu3, and Salmonella typhimurium (ST-sialidase) under non-reducing and reducing conditions. Monomer and dimer species are indicated.
[0057] FIGURE 3 is a bar graph showing the enzymatic activity of recombinant human Neul, Neu2, and Neu3.
[0058] FIGURE 4 is a line graph showing enzymatic activity as a function of substrate concentration for recombinant human Neu2 and Neu3 at the indicated pH.
[0059] FIGURE 5A depicts an SDS-PAGE gel showing recombinant wildtype human Neu2-Fc and the Neu2-Fc variant M106 (“M106”) under non-reducing and reducing conditions. FIGURES 5B and 5C show SEC-HPLC traces comparing wildtype Neu2-Fc versus Ml06, wherein the monomer species has a retention time of 21 minutes.
[0060] FIGURE 6 is a line graph showing the enzymatic activity as a function of substrate concentration for Ml06.
[0061] FIGURE 7 is a bar graph showing the enzymatic activity of Neu3-Fc in the supernatant (“Supernatant”) or membrane-bound (“Washed Cells”) Expi293 cells.
[0062] FIGURE 8 is an SEC-HPLC trace of Fc-ST Sialidase, wherein the monomer species has a retention time of 21 minutes.
[0063] FIGURES 9A-D are a series of line graphs showing tumor volume in a mouse A20 (lymphoma) syngeneic tumor model. Mice were administered a negative control (“Isotype Control,” FIGURE 9A), Fc-ST Sialidase (FIGURE 9B), Avelumab (anti-mouse PD-L1 antibody, FIGURE 9C), or the combination of Fc-ST Sialidase and Avelumab (FIGURE 9D) at 10 mg / kg twice a week for 15 days and tumor volume was measured over time. Administration of FC-ST Sialidase alone or in combination with Avelumab reduces tumor volume.
[0064] FIGURES 10A-D is a series of line graphs showing tumor volume in a mouse syngeneic tumor model utilizing EMT6 cells engineered for human Her2 expression. Mice were administered isotype control (Vehicle Control, FIGURE 10A), Fc-ST Sialidase (FC- ST, FIGURE 10B), trastuzumab (anti human Her2 antibody, FIGURE 10C), or Fc human Sialidase (Ml06, FIGURE 10D) for at 10 mg / kg twice a week for 15 days, as indicated by the triangles, and tumor volume was measured over time. Administration of Fc human Sialidase or Fc-ST Sialidase reduces tumor volume.
[0065] FIGURE 11 is a bar graph showing that neuraminidase activity following incubation at 37 °C for up to 14 days is stabilized by the addition of CaCh.
[0066] FIGURE 12A is a bar graph showing neuraminidase activity in conditioned media of cells expressing a human neuraminidase Fc construct at the indicated days following transfection in the presence or absence of 4 mM CaCh. As shown, the presence of CaCh stabilizes activity. FIGURE 12B is a bar graph depicting cell viability at the indicated days following transfection in the presence or absence of 4 mM CaCh.
[0067] FIGURE 13A is a bar graph showing that neuraminidase activity is stabilized by CaCh at different concentrations in conditioned media of cells expressing a human neuraminidase Fc construct. Enzyme activity at the indicated days following transfection in the presence of 0, 0.05, 0.5, 1, 2 and 4 mM CaCh is shown. FIGURE 13B shows total protein yield at day 6 in the presence of 0, 0.05, 0.5, 1,2 and 4 mM CaCh.
[0068] FIGURE 14 provides bar graphs depicting geometric mean fluorescence intensity (gMFIs) resulting from staining with Hydra-3 (FIGURE 14A), Hydra-7 (FIGURE 14B), and Hydra-9 (FIGURE 14C) of different immune subset populations.
[0069] FIGURE 15 provides bar graphs depicting geometric mean fluorescence intensity (gMFIs) resulting from staining with PNA (FIGURE 15A), MAL-II (FIGURE 15B), and SNA (FIGURE 15C) of different immune subset populations.
[0070] FIGURE 16 provides line graphs depicting the degree of desialylation of dendritic cells (DCs) by increasing concentrations of M106. FIGURE 16A depicts mean fluorescence intensity (MFI) and FIGURE 16B provides bar graphs depicting fold increase in desialylation compared to untreated DCs.
[0071] FIGURE 17 provides line graphs the degree of desialylation of BT-20 (breast cancer) tumor cells following treatment with increasing concentrations of Ml 06 (triangles) compared to LOF control (squares) as determined by Hydra 9 binding (FIGURE 17A) or PNA binding (FIGURE 17B), measured by gMFI.
[0072] FIGURE 18 provides line graphs depicting the degree of desialylation of HT-29 tumor cells following treatment with increasing concentrations of M106 (triangles) compared to LOF control (squares) as determined by Hydra 9 binding (FIGURE 18A) or PNA binding (FIGURE 18B) and measured as gMFI.
[0073] FIGURE 19 provides line graphs depicting the degree of desialylation of SK-BR-3 tumor cells following treatment with increasing concentrations of Ml 06 (triangles) compared to LOF control (squares) as determined by Hydra 9 binding (FIGURE 19A), MAL-II binding (FIGURE 19B) or PNA binding (FIGURE 19C) and measured as gMFI.
[0074] FIGURE 20 provides bar graphs depicting the percent increase in CD83hi expression (FIGURE 20A) and CD86hi expression (FIGURE 20B) on DCs following incubation with SKBR3 tumor cells treated with or without M106 in the presence or absence of lipopolysaccharide (LPS) treatment (open bars versus filled bars).
[0075] FIGURE 21 depicts the dose-dependent enhancement of phagocytosis by M2-like macrophages of HT-29 tumor cells that were desialylated by M106 or LOF, as indicated. Tumor cells were derived from two different healthy donors (FIGURE 21A and FIGURE 21B) A similar increase in phagocytosis of desialylated BT20 and SKBR-3 tumor cells by M2 like macrophages is depicted in FIGURE 21C and FIGURE 21D respectively.
[0076] FIGURE 22 provides bar graphs depicting the dose-dependent enhancement of HLA-DR expression following desialylation of monocytes by M106 or LOF control. Monocytes were obtained from two different healthy donors (FIGURE 22A and FIGURE 22B).
[0077] FIGURE 23 provides tumor growth curves depicting the in vivo activity of sialidases of the current disclosure in a mouse MC38 syngeneic tumor model. Tumor growth curves for individual mice are shown for isotype control treated mice (FIGURE 23A), M106-treated mice (FIGURE 23B), anti-PD-1 treated mice (FIGURE 23C) or mice treated with a combination of Ml 06 and anti-PD-1 (FIGURE 23D). Triangles indicate administration times of test articles.
[0078] FIGURE 24 provides tumor growth curves depicting the in vivo activity of sialidases of the current invention in a mouse Bl 6F10 syngeneic tumor model. Tumor growth curves for individual mice are shown for isotype control treated mice (FIGURE 24A), Ml06 treated mice (FIGURE 24B) or anti-PD-1 treated mice (FIGURE 24C). FIGURE 24D is an overlay of the tumor growth curves for isotype control group and the Ml 06 group. Triangles indicate administration times of test articles.
[0079] FIGURE 25 provides tumor growth curves depicting the in vivo activity of sialidases of the current invention in a mouse EMT6 syngeneic tumor model. Tumor growth curves for each individual mouse is shown for Isotype control treated mice (FIGURE 25A) or M106 treated mice (FIGURE 25B). Triangles indicate administration times of test articles. - 15 -
[0080] FIGURE 26 depicts the in vivo efficacy of Ml 06 alone or in combination with avelumab (“Ave”) at the indicated dose in a mouse A20 syngeneic subcutaneous tumor model. Tumor growth curves for each mouse are depicted. Observed partial responses (PR) and complete responses (CR) are also indicated.
[0081] FIGURE 27 depicts the in vivo efficacy of M106 alone or in combination with avelumab at the indicated dose in a mouse A20 syngeneic subcutaneous tumor model. Tumor growth curves for each mouse are depicted. Triangles indicate dosing.
[0082] FIGURE 28 depicts the in vivo activity of ofatumumab, a combination of ofatumumab and Neu2-M106-Fc (“M106 FC”), and an isotype control in a syngeneic EL4-CD20 lymphoma intravenous dissemination model as of day 28 (FIGURE 28A) or at the end of in-life as of day 41 (FIGURE 28B). Triangles indicate dosing of various test articles. P-value was calculated by Log-rank (Mantle-Cox) test.
[0083] FIGURE 29 depicts the results of Siglec-15-Fc staining of CD4+ cells (FIGURE 29A) and CD8+ cells (FIGURE 29B) following no treatment (“none”), treatment with a loss of function sialidase (“LOF FC”), or treatment with a sialidase (M106 (“M106 FC”) or BiNaNH2 (positive control)). As a negative control, Isotype IgGl staining is also shown. As shown, treatment of activated CD4 and CD8 cells with M106 or BiNaNH2 decreased Siglec-15-Fc staining as compared to no treatment or treatment with a loss of function sialidase. Bar graphs showing levels of fluorescence (gMFI) and the underlying flow cytometry histogram data are provided in each figure.
[0084] FIGURE 30 depicts the results of Siglec-15-Fc staining of CD4+ cells (FIGURE 30A) and CD8+ cells (FIGURE 30B) using the same methods as in FIGURE 30A-B, with PBMCs from a second healthy donor. DETAILED DESCRIPTION
[0085] The invention is based, in part, upon the discovery that it is possible to treat a sialic acid-mediated disorder by administering a sialidase enzyme or a sialidase enzyme conjugated to a serum half-life enhancer. Surprisingly, it has been discovered that a sialidase or a sialidase enzyme conjugated to a serum half-life enhancer that lacks a targeting moiety (e.g., an antibody binding domain directed to a tumor antigen) can effectively treat a sialic acid-mediated disorder (e.g., cancer, e.g., a solid tumor) in vivo. As a result, the constructs described herein can be used on their own to treat a sialic acid-medicated disorder, e.g., cancer, or they can be used in combination with another agent, e.g., an anti-cancer agent, to treat the disorder, e.g., cancer. For example, when used in combination with another anticancer agent, the constructs can enhance the activity of the anti-cancer agent, for example, by making the cancer more susceptible to treatment with the anti-cancer agent.
[0086] The invention further relates to recombinant forms of sialidase enzymes, sialidase enzymes conjugated to a serum half-life enhancer, and pharmaceutical compositions thereof, that have suitable substrate specificities and activities to be useful in removing sialic acid and / or sialic acid containing molecules from the surface of cancer cells and / or removing sialic acid and / or sialic acid containing molecules from the tumor microenvironment, and / or reducing the concentration of sialic acid and / or sialic acid containing molecules in the tumor microenvironment.
[0087] The invention further relates to pharmaceutical compositions and methods of using sialidase or sialidase conjugated to a half-life extender to treat cancer, e.g., a solid tumor, soft tissue tumor, hematopoietic tumor, metastatic lesion, or an epithelial cell cancer.
[0088] Various features and aspects of the invention are discussed in more detail below. I. Recombinant Sialidases
[0089] As used herein, the term “sialidase” refers to any enzyme, or a functional fragment or variant thereof, that cleaves a terminal sialic acid residue from a substrate, for example, a glycoprotein or a glycolipid. The term sialidase includes variants having one or more amino acid substitutions, deletions, or insertions relative to a wild-type sialidase sequence, and / or fusion proteins or conjugates including a sialidase. Sialidases are also called neuraminidases, and, unless indicated otherwise, the two terms are used interchangeably herein. As used herein, the term “functional fragment” of a sialidase refers to fragment of a full-length sialidase that retains, for example, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the enzymatic activity of the corresponding full-length, naturally occurring sialidase. Sialidase enzymatic activity may be assayed by any method known in the art, including, for example, by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc). In certain embodiments, the functional fragment comprises at least 100, 150, 200, 250, 300, 310, 320, 330, 340, 350, 360, or 370 consecutive amino acids present in a full-length, naturally occurring sialidase.
[0090] The sialidase described herein can be any sialidase, e.g., a viral, fungal, bacterial, non-human mammalian or human sialidase. In certain embodiments, the sialidase is a recombinant human sialidase comprising at least one mutation relative to a wild-type human sialidase, e.g., a substitution, deletion, or addition of at least one amino acid, as described above.
[0091] In certain embodiments, the sialidase is any recombinant mutant human sialidase disclosed herein, or a functional fragment thereof.
[0092] In certain embodiments, the sialidase comprises a C332A and C352L mutation. In certain embodiments, the sialidase comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3). In certain embodiments, the sialidase comprises a LSHSLST (SEQ ID NO: 22) peptide on the N-terminus. In certain embodiments, the sialidase comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4) and an A2K substitution. In certain embodiments, the sialidase comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4) and a C332A substitution. In certain embodiments, the sialidase comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4), a C332A substitution, and a C352L substitution.
[0093] In certain embodiments, the sialidase portion comprises an Ml deletion (AMI), MIA substitution, MID substitution, V6Y substitution, K9D substitution, P62G substitution, P62N substitution, P62S substitution, P62T substitution, A93E substitution, Q126Y substitution, I187K substitution, A242T substitution, Q270A substitution, Q270T substitution, S301R substitution, S301R substitution, W302K substitution, W302R substitution, C332A substitution, V363R substitution, L365I substitution, or a combination of any of the foregoing.
[0094] In certain embodiments, the sialidase comprises the amino acid sequence of any one of SEQ ID NOs: 48-62, 169-171, or 196, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of 48-62, 169-171, or 196. a. Viral Sialidases
[0095] Exemplary viral sialidases include Influenza A virus surface glycoprotein neuraminidase (e.g., NCBI accession no. ACY01419.1, SEQ ID NO: 63), Influenza B virus surface glycoprotein neuraminidase (e.g., NCBI accession no. AIX94926.1, SEQ ID NO: 64), or an Influenza C virus surface glycoprotein neuraminidase, or a variant or functional fragment thereof. Other exemplary viral sialidases include Paramyxoviridae Respirovirus Parainfluenzavirus type 1 & 3 (e.g., NCBI accession no. BAD89145.1, SEQ ID NO: 65), Bovine Parainfluenza virus type 3 (e.g., NCBI accession no. ADQ43755, SEQ ID NO: 66), Sendai virus (e.g., UniProtKB accession P04853.1, SEQ ID NO: 67), Rubulavirus, Mumps virus, Simian virus 5, and Parainfluenza virus type 2 & 4a, 4b. b. Prokaryotic Sialidases
[0096] Exemplary prokaryotic sialidases include sialidases from Salmonella typhimurium and Vibrio cholera. The amino acid sequence of Salmonella typhimurium sialidase (St-sialidase) is depicted in SEQ ID NO: 30, and a nucleotide sequence encoding Salmonella typhimurium sialidase is depicted in SEQ ID NO: 6. The amino acid sequence of Vibrio cholera sialidase is depicted in SEQ ID NO: 36, and a nucleotide sequence encoding Vibrio cholera sialidase is depicted in SEQ ID NO: 37.
[0097] Other exemplary prokaryotic sialidases include sialidases from Actinomyces viscosus (Avis_NanH; Uniprot accession no. AAA21932, SEQ ID NO:68); Arthrobacter nicotianae NAI and NA2; sialidases from Arthrobacter sialophilus: Arthrobacter ureafaciens L, Ml, M2 and S (GenBank accession no. BAD66680, SEQ ID NO:69); sialidases from Bacteroides fragiHs: sialidases from Clostridium chauvoei: i A99 NanH (GenBank accession no. CAA50436, SEQ ID NO:70), Nani (GenBank accession no. ABG83208, SEQ ID NO:71), NanJ (GenBank accession no. ABG84247, SEQ ID NO:72); sialidases from Clostridium septicum (e.g., GenBank accession no. CAA44916.1, SEQ ID NO: 107); sialidases from Clostridium sordellii', sialidases from Clostridium tertium (e.g., GenBank accession no. CAA69951, SEQ ID NO: 73); sialidases from Corynebacterium diphtheriae (e.g., GenBank accession no. ACS34893, SEQ ID NO: 74); sialidases from Haemophilusparasuis', sialidases fromMicromonospora viridifaciens (e.g., GenBank accession no. BAA00852, SEQ ID NO: 75); Pasteurella multocida NanH (GenBank accession no. AAG35310.1, SEQ ID NO: 76) andNanB (AAG35309, SEQ ID NO: 77); sialidases from Pseudomonas Aeruginosa (e.g., GenBank accession no. AAG06182, SEQ ID NO: 78); sialidases from Salmonella Typhimurium (e.g., GenBank accession no. NP 459905, SEQ ID NO: 79); Streptococcus pneumoniae NanA (GenBank accession no. P62575, SEQ ID NO: 108), NanB (GenBank accession no. AAC44396, SEQ ID NO: 80) and NanC; sialidases from Tannerellaforsythia (e.g., GenBank accession no. TF0035, SEQ ID NO: 81; sialidases from Vibrio cholerae (e.g., GenBank accession no. YP 001217324, SEQ ID NO: 82), sialidases from C. diphtheriae (C. diphtheriae KCTC3075 NanH, designated as Cdip NanH (GenBank accession number ACS34893, SEQ ID NO: 83) and its homologues; Corynebacterium glutamicum R hypothetical protein (Cglu hypP; YP 001138502, SEQ ID NO: 84); C. perfringens NCTC 8239 sialidase I (Cper NanI; ZP_02643014, SEQ ID NO: 85); B.fragilis YCH46 sialidase (Bfra NanH; Uniprot accession no. BAA05853, SEQ ID NO:86); M. viridifaciens sialidase (Mvir_NanH; Uniprot accession no. BAA0085, SEQ ID NO: 87); S. pneumoniae NanA sialidase (Spne_NanA; P62575, SEQ ID NO: 88); Streptomyces coelicolor A3(2) sialidase (Scoe_NanH; NP_630638, SEQ ID NO: 89); StreptomycesgriseusSk&RC 13350 sialidase (Sgri NanH; YP_001827941, SEQ ID NO: 90); Propionibacterium acnes SK137 sialidase (PacnNanH; ZP 03389398, SEQ ID NO: 91); Macrobdella decora trans-sialidase (Mdec_NanL; AAC47263, SEQ ID NO: 92); T. cruzi trans-sialidase (Tcru_TS; GenBank accession no. AAA99442, SEQ ID NO:93); Akkermansia muciniphila (ATCC BAA-835 / DSM 22959) Amuc_0625 / Am0707 (Uniprot accession no. B2UPI5, SEQ ID NO: 94); B. fragilis TAL2480 YCH46 sialidase (GenBank accession no. BF1729, SEQ ID NO: 95) (P31206); B. fragilis SBT3182; B. fragilis 4852; B. fragilis YM4000; B. thetaiotaomicron VPI-5482 sialidase (BtsA;BTSA;BT0455) (GenBank accession no. Q8AAK9, SEQ ID NO: 96); B. vulgatus ATCC 8482 / DSM 1447 / NCTC 11154 BVU_4143 (Uniprot accession no. A6L7T1, SEQ ID NO:97); B. bifidum JCM 1254 exo-a-sialidase (SiaBb2;BBP_0054) (GenBank accession no. BAK26854.1, SEQ ID NO: 98); Cl. perfringens A99 sialidase 1 ‘small’ (P10481, SEQ ID NO: 99); C. perfringens ATCC 10543 sialidase 2 (NanH) (Uniprot accession no. Q59311, SEQ ID NO: 100); C. perfringens ATCC 13124 sialidase (CPF 0721) (Uniprot accession no. Q0TT67, SEQ ID NO: 101); C. perfringens str 13 exo-a-sialidase (NanI;CPSA;CPE0725) (Uniprot accession no. Q8XMG4, SEQ ID NO: 102); C. perfringens str 13 / ATCC 13124 exo-a-sialidase (NanJ;CPE0553 (Uniprot accession no. Q8XMY5, SEQ ID NO: 103); Clostridium tertium ATCC 14573 sialidase (NanH;SiaH) (Uniprot accession no. P77848, SEQ ID NO: 104); R. gnavus ATCC 29149 RgNanH (Uniprot accession no. A7B557, SEQ ID NO: 105); 5. typhimurium TA262 / LT2 sialidase (NanH;STSA) (P29768, SEQ ID NO: 106).
[0098] Other exemplary sialidases include Sialidases or neuraminidases from A. Castellani, A. polyphaga, A. culbertsoni, A. astronyxis, A. hatchetti, A. palestinensis, A. rhysodes, E. tenella, E. maxima, E. necatrix, E. Spec, T. brucei, and T. rangeli. c. Mouse Sialidases
[0099] Four sialidases have also been found in the mouse genome and are referred to as Neul, Neu2, Neu3 and Neu4. The amino acid sequence of mouse Neul is depicted in SEQ ID NO: 38, and a nucleotide sequence encoding mouse Neul is depicted in SEQ ID NO: 42. The amino acid sequence of mouse Neu2 is depicted in SEQ ID NO: 39 and a nucleotide sequence encoding mouse Neu2 is depicted in SEQ ID NO: 43. The amino acid sequence of mouse Neu3 is depicted in SEQ ID NO: 40, and a nucleotide sequence encoding mouse Neu3 is depicted in SEQ ID NO: 44. The amino acid sequence of mouse Neu4 is depicted in SEQ ID NO: 41, and a nucleotide sequence encoding mouse Neu4 is depicted in SEQ ID NO: 45. d. Human Sialidases
[00100] Four sialidases have also been found in the human genome and are referred to as Neul, Neu2, Neu3 and Neu4.
[00101] Human Neul is a lysosomal neuraminidase enzyme which functions in a complex with beta-galactosidase and cathepsin A. The amino acid sequence of human Neul is depicted in SEQ ID NO: 7, and a nucleotide sequence encoding human Neul is depicted in SEQ ID NO: 23.
[00102] Human Neu2 is a cytosolic sialidase enzyme. The amino acid sequence of human Neu2 is depicted in SEQ ID NO: 1, and a nucleotide sequence encoding human Neu2 is depicted in SEQ ID NO: 24.
[00103] Human Neu3 is a plasma membrane sialidase with an activity specific for gangliosides. Human Neu3 has two isoforms: isoform 1 and isoform 2. The amino acid sequence of human Neu3, isoform 1 is depicted in SEQ ID NO: 8, and a nucleotide sequence encoding human Neu3, isoform 1 is depicted in SEQ ID NO: 25. The amino acid sequence of human Neu3, isoform 2 is depicted in SEQ ID NO: 9, and a nucleotide sequence encoding human Neu3, isoform 2 is depicted in SEQ ID NO: 34.
[00104] Human Neu4 has two isoforms: isoform lisa peripheral membrane protein and isoform 2 localizes to the lysosome lumen. The amino acid sequence of human Neu4, isoform 1 is depicted in SEQ ID NO: 10, and a nucleotide sequence encoding human Neu4, isoform 1 is depicted in SEQ ID NO: 26. The amino acid sequence of human Neu4, isoform 2 is depicted in SEQ ID NO: 11, and a nucleotide sequence encoding human Neu4, isoform 2 is depicted in SEQ ID NO: 35.
[00105] In certain embodiments, a recombinant mutant human sialidase has about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, or more than 100% of the enzymatic activity of a corresponding (or template) wild-type human sialidase.
[00106] In certain embodiments, the recombinant mutant human sialidase has the same substrate specificity as the corresponding wild-type human sialidase. In other embodiments, the recombinant mutant human sialidase has a different substrate specificity than the corresponding wild-type human sialidase. For example, in certain embodiments the recombinant mutant human sialidase can cleave a2,3, a2,6, and / or a2,8 linkages. In certain embodiments the sialidase can cleave a2,3 and a2,8 linkages.
[00107] In certain embodiments, the expression yield of the recombinant mutant human sialidase in mammalian cells, e.g., HEK293 cells, CHO cells, murine myeloma cells (NS0, Sp2 / 0), or human fibrosarcoma cells (HT-1080), e.g., HEK293 cells, is greater than about 10%, about 20%, about 50%, about 75%, about 100%, about 150%, about 200%, about 250%, about 300%, about 400%, about 500%, about 600%, about 700%, about 800%, about 900%, or about 1,000% of the expression yield of the corresponding wild-type human sialidase.
[00108] In certain embodiments, the recombinant mutant human sialidase has about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, or more than 100% of the enzymatic activity of a corresponding wild-type human sialidase, and the expression yield of the recombinant mutant human sialidase in mammalian cells, e.g., HEK293 cells, is greater than about 10%, about 20%, about 50%, about 75%, about 100%, about 150%, about 200%, about 250%, about 300%, about 400%, about 500%, about 600%, about 700%, about 800%, about 900%, or about 1,000% of the expression yield of a corresponding wild-type human sialidase.
[00109] In certain embodiments, the amino acid sequence of the recombinant mutant human sialidase has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of a corresponding wild-type human sialidase.
[00110] It is understood that the sialidases described herein, for example, the human sialidases, can be modified to enhance one or more properties of the enzyme, e.g., to improve expression, activity, stability (e.g., improve resistance to protease degradation). Some of these properties are applicable to the various sialidases described herein, e.g., the improved resistance to protease degradation. i. Substitution of Cysteine Residues
[00111] In certain embodiments, the recombinant mutant human sialidase comprises a substitution of at least one cysteine (cys, C) residue. It has been discovered that certain cysteine residues in sialidases may inhibit expression of functional protein as a result of protein aggregation. Accordingly, in certain embodiments, the recombinant mutant human sialidase contains at least one mutation to remove a free cysteine (e.g., for Neul (SEQ ID -22 - NO: 7), a mutation of one or more of Cl 11, Cl 17, C171, C183, C218, C240, C242, and C252; for Neu2 (SEQ ID NO: 1), a mutation of one or more of C125, C196, C219, C272, C332, and C352; for Neu3 (SEQ ID NO: 8), a mutation of one or more of C7, C90, C99, C106, C127, C136, C189, C194, C226, C242, C250, C273, C279, C295, C356, C365, C368, C384, C383, C394, and C415; and for Neu4 (SEQ ID NO: 10), a mutation of one or more of C88, C125, C126, C186, C191, C211, C223, C239, C276, C437, C453, C480, and C481). Free cysteines can be substituted with any amino acid. In certain embodiments, the free cysteine is substituted with serine (ser, S), isoleucine (iso, I), valine (val, V), phenylalanine (phe, F), leucine (leu, L), or alanine (ala, A). Exemplary cysteine substitutions in Neu2 include C125A, C125I, C125S, C125V, C196A, C196L, C196V, C272S, C272V, C332A, C332S, C332V, C352L, and C352V.
[00112] In certain embodiments, the recombinant mutant human sialidase comprises two or more cysteine substitutions. Exemplary double or triple substitutions in Neu2 include: C125S and C332S; C272V and C332A; C272V and C332S; C332A and C352L; C125S and C196L; C196L and C352L; C196L and C332A; C332A and C352L; and C196L, C332A and C352L.
[00113] In certain embodiments, the recombinant mutant human sialidase is a Neu2 sialidase and comprises the substitutions C322A and C352L (SEQ ID NO: 5).
[00114] In certain embodiments, the sialidase contains an amino acid substitution at 2, 3, 4, 5, or 6 cysteines typically present in a human sialidase, e.g., Neu2 or Neu3.
[00115] In certain embodiments, the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 1 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). TABLE 1 _______Substitution(s)_______ ________C125A________ _________C125I_________ _________C125S_________ ________C125V________ ________Cl96 A________ ________C196L________ ________Cl 96 V________ _________C272S_________ ________C272V________ C332A _________C332S_________ ________C332V________ ________C352L________ ________C352V________ C125S + C332S C272V + C332A C272V + C332S C332A + C352L C125S + C196L C196L + C352L C196L + C332A C196L + C332A + C352L ii. Substitutions of Residues to Increase pl and / or Decrease Hydrophobicity
[00116] The isoelectric point (pl) of a protein is the pH at which the net charge is zero. The pl also indicates the pH at which the protein is least soluble, which affects the ability to express and purify the protein. Generally, a protein has good solubility if its pl is greater than 2 units above the pH of the solution. Human Neu2 has a predicted pl of 7.5. Thus, human Neu2 is least soluble around neutral pH, which is undesirable because expression and physiological systems are at neutral pH. In contrast, the sialidase from Salmonella typhimurium (St-sialidase), which exhibits good solubility and recombinant expression, has a pl of 9.6. Accordingly, to increase expression of human Neu2 or the other human sialidases, a recombinant mutant human sialidase may be designed to contain one or more amino acid substitution(s) wherein the substitution(s) increase(s) the pl of the sialidase relative to a sialidase without the substitution. Additionally, decreasing the number of hydrophobic amino acids on the surface of a sialidase may improve expression of sialidase by, for example, reducing aggregation. Accordingly, to increase expression of human Neu2 or the other human sialidases, a recombinant mutant human sialidase may be designed to contain one or more amino acid substitution(s) wherein the substitution(s) decrease(s) the hydrophobicity of a surface of the sialidase relative to a sialidase without the substitution(s).
[00117] Accordingly, in certain embodiments, the recombinant mutant human sialidase comprises at least one amino acid substitution, wherein the substitution increases the isoelectric point (pl) of the sialidase and / or decreases the hydrophobicity of the sialidase relative to a sialidase without the substitution. This may be achieved by introducing one or more charged amino acids, for example, positively or negatively charged amino acids, into the recombinant sialidase. In certain embodiments, the amino acid substitution is to a charged amino acid, for example, a positively charged amino acid such as lysine (lys, K), histidine (his, H), or arginine (arg, R), or a negatively charged amino acid such as aspartic acid (asp, D) or glutamic acid (glu, E). In certain embodiments, the amino acid substitution is to a lysine residue. In certain embodiments, the substitution increases the pl of the sialidase to about 7.75, about 8, about 8.25, about 8.5, about 8.75, about 9, about 9.25, about 9.5, or about 9.75.
[00118] In certain embodiments, the amino acid substitution occurs at a surface exposed D or E amino acid, in a helix or loop, or in a position that has a K or R in the corresponding position of St-sialidase. In certain embodiments, the amino acid substitution occurs at an amino acid that is remote from the catalytic site or otherwise not involved in catalysis, an amino acid that is not conserved with the other human Neu proteins or with an St-Sialidase or Clostridium NanH, or an amino acid that is not located in a domain important for function (e.g., an Asp-box or beta strand).
[00119] Exemplary amino acid substitutions in Neu2 that increase the isoelectric point (pl) of the sialidase and / or decrease the hydrophobicity of the sialidase relative to a sialidase without the substitution include A2E, A2K, D215K, V325E, V325K, E257K, and E319K. In certain embodiments, the recombinant mutant human sialidase comprises two or more amino acid substitutions, including, for example, A2K and V325E, A2K and V325K, E257K and V325K, A2K and E257K, and E257K and A2K and V325K.
[00120] In certain embodiments, the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 2 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). TABLE 2 _____Substitution(s)_____ _______A2K_______ _______E72K_______ _______D215K_______ _______E257K_______ _______V325K_______ A2K + E257K A2K + V325E A2K + V325K E257K + V325K iii. Addition of N-terminal Peptides and N- or C-terminal Substitutions
[00121] It has been discovered that the addition of a peptide sequence of two or more amino acids to the N-terminus of a human sialidase can improve expression and / or activity of the sialidase. In certain embodiments, the peptide is at least 2 amino acids in length, for example, from 2 to 20, from 2 to 10, from 2 to 5, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in length. In certain embodiments, the peptide may form, or have a propensity to form, an a-helix.
[00122] In mice, a Neu2 isoform (type B) found in thymus contains six amino acids not present in the canonical isoform of Neu2 found in skeletal muscle. In certain embodiments herein, the N-terminal six amino acids of the mouse thymus Neu2 isoform, MEDLRP (SEQ ID NO: 4), or variations thereof, can be added onto a human Neu, e.g., human Neu2. In certain embodiments, the recombinant mutant human sialidase comprises a peptide at least two amino acid residues in length covalently associated with an N-terminal amino acid of the sialidase. In certain embodiments the recombinant mutant human sialidase comprises the peptide MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3) covalently associated with an N-terminal amino acid of the sialidase. In certain embodiments, the sialidase may further comprise a cleavage site, e.g., a proteolytic cleavage site, located between the peptide, e.g., MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3), and the remainder of the sialidase. In certain embodiments, the peptide, e.g., MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3), may be post-translationally cleaved from the remainder of the sialidase.
[00123] Alternatively to, or in combination with, the N-terminal addition, 1-5 amino acids of the 12 amino acid N-terminal region of the recombinant mutant human sialidase may be removed, e.g., the N-terminal methionine can be removed. In certain embodiments, if the recombinant mutant human sialidase is Neu2, the N-terminal methionine can be removed, the first five amino acids (MASLP; SEQ ID NO: 12) can be removed, or the second through fourth amino acids (ASLP; SEQ ID NO: 13) can be removed.
[00124] In certain embodiments, 1-5 amino acids of the 12 amino acid N-terminal region of the recombinant mutant human sialidase are substituted with MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3), or TVEKSVVF (SEQ ID NO: 14). For example, in certain embodiments, if the recombinant mutant human sialidase is Neu2, the amino acids MASLP (SEQ ID NO: 12), ASLP (SEQ ID NO: 13) or M are substituted with MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3) or TVEKSVVF (SEQ ID NO: 14).
[00125] Human sialidases have a P-propeller structure, characterized by 6 bladeshaped P-sheets arranged toroidally around a central axis. Generally, hydrophobic interactions between the blades of a P-propeller, including between the N- and C-terminal blades, enhance stability. Accordingly, in order to increase expression of human Neu2 or the other human sialidases, a recombinant mutant human sialidase can be designed comprising an amino acid substitution that increases hydrophobic interactions and / or hydrogen bonding between the N- and C-terminal P-propeller blades of the sialidase.
[00126] Accordingly, in certain embodiments, the recombinant mutant human sialidase comprises a substitution of at least one wild-type amino acid residue, wherein the substitution increases hydrophobic interactions and / or hydrogen bonding between the N- and C-termini of the sialidase relative to a sialidase without the substitution. In certain embodiments, the wildtype amino acid is substituted with asparagine (asn, N), lysine (lys, K), tyrosine (tyr, Y), phenylalanine (phe, F), or tryptophan (trp, W). Exemplary substitutions in Neu2 that increase hydrophobic interactions and / or hydrogen bonding between the N- and C-termini include L4N, L4K, V6Y, L7N, L4N and L7N, L4N and V6Y and L7N, V12N, V12Y, V12L, V6Y, V6F, or V6W. In certain embodiments, the sialidase comprises the V6Y substitution.
[00127] In certain embodiments, the recombinant mutant human sialidase comprises a combination of the above substitutions. For example, a recombinant mutant human Neu2 sialidase can comprise the additional amino acids MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3), or TVEKSVVF (SEQ ID NO: 14) at the N-terminus and, in combination, can comprise at least one L4N, L4K, V6Y, L7N, L4N and L7N, L4N and V6Y and L7N, V12N, V12Y, V12L, V6Y, V6F, or V6W substitution. In certain embodiments, the amino acids MASLP (SEQ ID NO: 12), ASLP (SEQ ID NO: 13) or M of a recombinant mutant human Neu2 sialidase are replaced with MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3) or TVEKSVVF (SEQ ID NO: 14) and the recombinant mutant human Neu2 sialidase also comprises at least one L4N, L4K, V6Y, L7N, L4N and L7N, L4N and V6Y and L7N, V12N, V12Y, V12L, V6Y, V6F, or V6W substitution.
[00128] In certain embodiments, the recombinant mutant human sialidase comprises a mutation or combination of mutations corresponding to a mutation or combination of mutations listed in TABLE 3 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). TABLE 3 Mutation(s) Substitute M at the N-terminus with EDLRP (SEQ ID NO: 3) Substitute M at the N-terminus with MEDLRP (SEQ ID NO: 4) Insert MEDLRP (SEQ ID NO: 4) at the N-terminus Substitute MASLP (SEQ ID NO: 12) at the N-terminus with _____________MEDLRP (SEQ ID NO: 4)_____________ ___________________L4N___________________ __________________V6Y__________________ ___________________L7N___________________ _____________________V6F_____________________ V6W
[00129] Additionally, in certain embodiments, the sialidase comprises a substitution or deletion of an N-terminal methionine at the N-terminus of the sialidase. For example, in 5 certain embodiments, the sialidase comprises a substitution of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (SEQ ID NO: 1), e.g., the methionine at a position corresponding to position 1 of wild-type human Neu2 is substituted by alanine (MIA) or aspartic acid (MID). In other embodiments, the sialidase comprises a deletion of a methionine residue at a position corresponding to position 1 (AMI) of wild-type 10 human Neu2 (SEQ ID NO: 1).
[00130] In certain embodiments, the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 4 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). 15 TABLE 4 Mutation(s) Deletion of Ml, V6Y, I187K MIR, V6Y, I187K M1H, V6Y, I187K MIK, V6Y, I187K MID, V6Y, I187K MIT, V6Y, I187K MIN, V6Y, I187K M1Q, V6Y, I187K MIG, V6Y, I187K MIA, V6Y, I187K M1V, V6Y, I187K MIL, V6Y, I187K Mutation(s) M1F, V6Y, I187K M1Y, V6Y, I187K d. Substitutions of Residues to Decrease Proteolytic Cleavage
[00131] It has been discovered that certain sialidases (e.g., human Neu2) are susceptible to cleavage by a protease (e.g., trypsin). As a result, proteolytic cleavage of the sialidase may occur during recombinant protein production, harvesting, purification, formulation, during administration to a subject, or after administration to a subject, or any combination of the foregoing. Accordingly, in certain embodiments, the recombinant mutant human sialidase comprises a substitution of at least one wild-type amino acid residue, wherein the substitution decreases cleavage of the sialidase by a protease (e.g., trypsin) relative to a sialidase without the substitution.
[00132] In certain embodiments, incubation of the recombinant mutant human sialidase with a protease (e.g., trypsin) results in from about 1% to about 50%, from about 1% to about 40%, from about 1%, to about 30%, from about 1% to about 20%, from about 1% to about 10%, from about 1% to about 5%, from about 5% to about 50%, from about 5% to about 40%, from about 5% to about 30%, from about 5% to about 20%, from about 5% to about 10%, from about 10% to about 50%, from about 10% to about 40%, from about 10% to about 30%, from about 10% to about 20%, from about 20% to about 50%, from about 20% to about 40%, from about 20% to about 30%, from about 30% to about 50%, from about 30% to about 40%, or from about 40% to about 50% of the proteolytic cleavage of a corresponding wild-type sialidase when incubated with the protease under the same conditions. In certain embodiments, incubation of the recombinant mutant human sialidase with a protease (e.g., trypsin) results in less than 50%, less than 40%, less than 30%, less than 10%, less than 5%, less than 3%, less than 1%, or less than 0.5% of the proteolytic cleavage of a corresponding wild-type sialidase when incubated with the protease under the same conditions. Proteolytic cleavage can be assayed by any method known in the art, including for example, by SDS-PAGE as described in Example 5 herein.
[00133] Exemplary substitutions that increase resistance to proteolytic cleavage include: (i) a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by cysteine (A242C), phenylalanine (A242F), glycine (A242G), histidine (A242H), isoleucine (A242I), lysine (A242K), leucine (A242L), methionine (A242M), asparagine (A242N), glutamine (A242Q), arginine (A242R), serine (A242S), valine (A242V), tryptophan (A242W), or tyrosine (A242Y); (ii) a substitution of an arginine residue at a position corresponding to position 243 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by glutamic acid (R243E), histidine (R243H), asparagine (R243N), glutamine (R243Q), or lysine (R243K); (iii) a substitution of a valine residue at a position corresponding to position 244 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by isoleucine (V244I), lysine (V244K), or proline (V244P); or (iv) a combination of any of the foregoing. In certain embodiments, the recombinant mutant human sialidase comprises a substitution selected from A242C, A242F, A242Y, and A242W. In certain embodiments, the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 5 (amino acid positions corresponding to wildtype human Neu2 (SEQ ID NO: 1)). TABLE 5 Wild Type Human Neu2 (SEQ ID NO: 1) Amino Acid Exemplary Substitution(s) at Specified Position(s) A242 C, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y R243 E, H, N, Q, K V244 I, K, P
[00134] Additional exemplary substitutions that increase resistance to proteolytic cleavage (and / or increase expression yield and / or enzymatic activity) include: (i) a substitution of a leucine residue at a position corresponding to position 240 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by aspartic acid (L240D), asparagine (L240N), or tyrosine (L240Y); (ii) a substitution of an alanine residue at a position corresponding to position 213 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by cysteine (A213C), asparagine (A213N), serine (A213S), or threonine (A213T); (iii) a substitution of an arginine residue at a position corresponding to position 241 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by alanine (R241 A), aspartic acid (R241D), leucine (R241L), glutamine (R241Q). or tyrosine (R241Y); (iv) a substitution of a serine residue at a position corresponding to position 258 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by cysteine (S258C); (v) a substitution of a leucine residue at a position corresponding to position 260 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by aspartic acid (L260D), phenylalanine (L260F), glutamine (L260Q), or threonine (L260T); (vi) a substitution of a valine residue at a position corresponding to position 265 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by phenylalanine (V265F); or (vii) a combination of any of the foregoing. It is contemplated that, in certain embodiments, a substitution or a combination of substitutions at these positions may improve hydrophobic and / or aromatic interaction between secondary structure elements in the sialidase (e.g., between an a-helix and the nearest P-sheet) thereby stabilizing the structure and improving resistance to proteolytic cleavage.
[00135] In certain embodiments, the recombinant mutant sialidase comprises a mutation at position L240. In certain embodiments, the recombinant mutant sialidase comprises a combination of mutations at positions (i) A213 and A242, (ii) A213, A242, and S258, (iii) L240 and L260, (iv) R241 and A242, (v) A242 and L260, (vi) A242 and V265, and (vii) L240 and A242. In certain embodiments, the recombinant mutant human sialidase comprises a combination of substitutions selected from (i) A213C, A242F, and S258C, (ii) A213C and A242F, (iii) A213T and A242F, (iv) R241Y and A242F, or (v) L240Y and A242F. In certain embodiments, the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 6 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). TABLE 6 _________Substitution(s)_________ A242C, V244P A242R, V244R A242R, V244H A242Y, V244P A242T, V244P A242N, V244P A213C, A242F A213S, A242F A213T, A242F A213N, A242F A213C, A242F, S258C A242F, L260F A242F, V265F L240Y L240Y, L260F L240D, L260T L240N, L260T L240N, L260D L240N, L260Q L240Y, A242F R241A, A242F R241Y, A242F iv. Other Substitutions
[00136] The invention further provides a recombinant mutant human sialidase comprising at least one of the following substitutions: I187K, A328E, K370N, or H210N. In certain embodiments, a recombinant mutant human Neu2 comprises the substitution of the amino acids GDYDAPTHQVQW (SEQ ID NO: 15) with the amino acids SMDQGSTW (SEQ ID NO: 16) or STDGGKTW (SEQ ID NO: 17). In certain embodiments, a recombinant mutant human Neu2 comprises the substitution of the amino acids PRPPAPEA (SEQ ID NO: 18) with the amino acids QTPLEAAC (SEQ ID NO: 19). In certain embodiments, a recombinant mutant human Neu2 comprises the substitution of the amino acids NPRPPAPEA (SEQ ID NO: 20) with the amino acids SQNDGES (SEQ ID NO: 21).
[00137] The invention further provides a recombinant mutant human sialidase comprising at least one substitution at a position corresponding to V212, A213, Q214, D215, T216, L217, E218, C219, Q220, V221, A222, E223, V224, E225, or T225.
[00138] The invention further provides a recombinant mutant human sialidase comprising an amino acid substitution at a position identified in TABLE 7 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1). In certain embodiments, the sialidase comprises an amino acid substitution identified in TABLE 7. In certain embodiments, the sialidase comprises a combination of any amino acid substitution identified in TABLE 7 TABLE 7 Wild Type Human Neu2 (SEQ ID NO: 1) Amino Acid Substitution at Specified Position Ml D L4 S, T, Y, L, F, A, P, V, I, N, D, H P5 G V6 Y L7 F, Y, S, I, T, N K9 D V12 L, A, P, V, N, D, H F13 S, N, R, K, T, G, D, E, A 122 S, N, R, K, T, G, D, E, A, Y, L, F, P, V, I, H A24 S, N, R, K, T, G, D, E, A, Y, L, F, P, V, I, H L34 S, T, Y, L, F, A, P, V, I, N, D, H A3 6 S, T, Y, L, F, A, P, V, I, N, D, H K44 R, E K45 A, E, R L54 M P62 H, G, N, T, S, F, I, D, E H64 F, Y, S, I, T, N Q69 H R78 K D80 P P89 S, T, Y, L, F, A, P, V, I, N, D, H, M A93 E,K G107 D Q108 H Q112 R, K C125 Y, F, L Q126 E, F, H, I, L, or Y A150 V T156 R, N, D, C, G, H, I, L, F, S, Y, V, A, P, T F157 R, N, D, C, G, H, I, L, F, S, Y, V, A, P Wild Type Human Neu2 (SEQ ID NO: 1) Amino Acid Substitution at Specified Position A158 R, N, D, C, G, H, I, L, F, S, Y, V, A, P, T V159 R, N, D, C, G, H, I, L, F, S, Y, V, A, P G160 R, N, D, C, G, H, I, L, F, S, Y, V, A, P, T P161 R, N, D, C, G, H, I, L, F, S, Y, V, A, P G162 R, N, D, C, G, H, I, L, F, S, Y, V, A, P, T H163 R, N, D, C, G, H, I, L, F, S, Y, V, A, P C164 R, N, D, C, G, H, I, L, F, S, Y, V, A, P, T L165 R, N, D, C, G, H, I, L, F, S, Y, V, A, P R170 P A171 G V176 R, N, D, C, G, H, I, L, F, S, Y, V, P, A P177 S, T, Y, L, F, A, P, V, I, N, D, H A178 S, T, Y, L, F, A, P, V, I, N, D, H L184 S, N, R, K, T, G, D, E, A, F, H, I, L, P, V, Y H185 S, N, R, K, T, G, D, E, A P186 S, N, R, K, T, G, D, E, A, F, H, I, L, P, V, Y, 1187 S, N, R, K, T, G, D, E, A Q188 P, S, N, R, K, T, G, D, E, A R189 P P190 F, M, A, D, G, H, N, P, R, S, T 1191 M, A, D, F, H, I, L, N, P, S, T, V, Y, E, G, K, R A194 S, T, Y, L, F, A, P, V, I, N, D, H A213 C, N, S, or T L217 R, N, D, C, G, H, I, L, F, S, Y, V C219 R, N, D, C, G, H, I, L, F, S, Y, V A222 D E225 P T249 A D251 G E257 P S258 C Wild Type Human Neu2 (SEQ ID NO: 1) Amino Acid Substitution at Specified Position L260 D, F,Q, or T V265 F Q270 S, T, A, H, P, F G271 S, N, R, K, T, G, D, E, A C272 S, N, R, K, T, G, D, E, A, C, H, Y, F, H, L, P, V W292 R S301 A, D, E, F, G, H, I, K, L, M, N, P, Q, T, V, W, Y, C, or R W302 A, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, Y, or K E319 D V325 F, Y, S, I, T, N, A, D, H, L, P, V L326 F, Y, S, I, T, N, A, D, H, L, P, V L327 F, Y, S, I, T, N, A, D, H, L, P, V C332 A, D, G, H, N, P, R, S, T Y359 A, S V363 R, S, T, Y, L, F, A, P, V, I, N, D, H L365 K, Q, F, Y, S, I, T, N, A, D, H, L, P, V
[00139] For example, in certain embodiments, the recombinant mutant human sialidase comprises: (a) a substitution of a proline residue at a position corresponding to position 5 of wild-type human Neu2 (P5); (b) a substitution of a lysine residue at a position corresponding to position 9 of wild-type human Neu2 (K9); (c) a substitution of a lysine residue at a 5 position corresponding to position 44 of wild-type human Neu2 (K44); (d) a substitution of a lysine residue at a position corresponding to position 45 of wild-type human Neu2 (K45); (e) a substitution of a leucine residue at a position corresponding to position 54 of wild-type human Neu2 (L54); (f) a substitution of a proline residue at a position corresponding to position 62 of wild-type human Neu2 (P62); (g) a substitution of a glutamine residue at a 10 position corresponding to position 69 of wild-type human Neu2 (Q69); (h) a substitution of an arginine residue at a position corresponding to position 78 of wild-type human Neu2 (R78); (i) a substitution of an aspartic acid residue at a position corresponding to position 80 of wild-type human Neu2 (D80); (j) a substitution of an alanine residue at a position corresponding to position 93 of wild-type human Neu2 (A93); (k) a substitution of a glycine residue at a position corresponding to position 107 of wild-type human Neu2 (G107); (1) a substitution of a glutamine residue at a position corresponding to position 108 of wild-type human Neu2 (QI08); (m) a substitution of a glutamine residue at a position corresponding to position 112 of wild-type human Neu2 (QI 12); (n) a substitution of a cysteine residue at a position corresponding to position 125 of wild-type human Neu2 (C125); (o) a substitution of a glutamine residue at a position corresponding to position 126 of wild-type human Neu2 (Q126); (p) a substitution of an alanine residue at a position corresponding to position 150 of wild-type human Neu2 (Al 50); (q) a substitution of a cysteine residue at a position corresponding to position 164 of wild-type human Neu2 (Cl 64); (r) a substitution of an arginine residue at a position corresponding to position 170 of wild-type human Neu2 (RI 70); (s) a substitution of an alanine residue at a position corresponding to position 171 of wild-type human Neu2 (A171); (t) a substitution of a glutamine residue at a position corresponding to position 188 of wild-type human Neu2 (QI 88); (u) a substitution of an arginine residue at a position corresponding to position 189 of wild-type human Neu2 (RI 89); (v) a substitution of an alanine residue at a position corresponding to position 213 of wild-type human Neu2 (A213); (w) a substitution of a leucine residue at a position corresponding to position 217 of wild-type human Neu2 (L217); (x) a substitution of a glutamic acid residue at a position corresponding to position 225 of wild-type human Neu2 (E225); (y) a substitution of a histidine residue at a position corresponding to position 239 of wild-type human Neu2 (H239); (z) a substitution of a leucine residue at a position corresponding to position 240 of wild-type human Neu2 (L240); (aa) a substitution of an arginine residue at a position corresponding to position 241 of wild-type human Neu2 (R241); (bb) a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (A242); (cc) a substitution of a valine residue at a position corresponding to position 244 of wild-type human Neu2 (V244); (dd) a substitution of a threonine residue at a position corresponding to position 249 of wild-type human Neu2 (T249); (ee) a substitution of an aspartic acid residue at a position corresponding to position 251 of wild-type human Neu2 (D251); (ff) a substitution of a glutamic acid residue at a position corresponding to position 257 of wild-type human Neu2 (E257); (gg) a substitution of a serine residue at a position corresponding to position 258 of wild-type human Neu2 (S258); (hh) a substitution of a leucine residue at a position corresponding to position 260 of wild-type human Neu2 (L260); (ii) a substitution of a valine residue at a position corresponding to position 265 of wild-type human Neu2 (V265); (jj) a substitution of a glutamine residue at a position corresponding to position 270 of wild-type human Neu2 (Q270); (kk) a substitution of a tryptophan residue at a position corresponding to position 292 of wild-type human Neu2 (W292); (11) a substitution of a serine residue at a position corresponding to position 301 of wild-type human Neu2 (S301); (mm) a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302); (nn) a substitution of a valine residue at a position corresponding to position 363 of wild-type human Neu2 (V363); or (oo) a substitution of a leucine residue at a position corresponding to position 365 of wild-type human Neu2 (L365); or a combination of any of the foregoing substitutions. For example, the sialidase may comprise a substitution of K9, P62, A93, Q216, A242, Q270, S301, W302, V363, or L365, or a combination of any of the foregoing substitutions..
[00140] In certain embodiments, in the sialidase: (a) the proline residue at a position corresponding to position 5 of wild-type human Neu2 is substituted by histidine (P5H); (b) the lysine residue at a position corresponding to position 9 of wild-type human Neu2 is substituted by aspartic acid (K9D); (c) the lysine residue at a position corresponding to position 44 of wild-type human Neu2 is substituted by arginine (K44R) or glutamic acid (K44E); (d) the lysine residue at a position corresponding to position 45 of wild-type human Neu2 is substituted by alanine (K45A), arginine (K45R), or glutamic acid (K45E); (e) the leucine residue at a position corresponding to position 54 of wild-type human Neu2 is substituted by methionine (L54M); (f) the proline residue at a position corresponding to position 62 of wild-type human Neu2 is substituted by asparagine (P62N), aspartic acid (P62D), histidine (P62H), glutamic acid (P62E), glycine (P62G), serine (P62S), or threonine (P62T); (g) the glutamine residue at a position corresponding to position 69 of wild-type human Neu2 is substituted by histidine (Q69H); (h) the arginine residue at a position corresponding to position 78 of wild-type human Neu2 is substituted by lysine (R78K); (i) the aspartic acid residue at a position corresponding to position 80 of wild-type human Neu2 is substituted by proline (D80P); (j) the alanine residue at a position corresponding to position 93 of wild-type human Neu2 is substituted by glutamic acid (A93E) or lysine (A93K); (k) the glycine residue at a position corresponding to position 107 of wild-type human Neu2 is substituted by aspartic acid (G107D); (1) the glutamine residue at a position corresponding to position 108 of wild-type human Neu2 is substituted by histidine (Q108H); (m) the glutamine residue at a position corresponding to position 112 of wild-type human Neu2 is substituted by arginine (QI 12R) or lysine (QI 12K); (n) the cysteine residue at a position corresponding to position 125 of wild-type human Neu2 is substituted by leucine (C125L); (o) the glutamine residue at a position corresponding to position 126 of wild-type human Neu2 is substituted by leucine (Q126L), glutamic acid (Q126E), phenylalanine (Q126F), histidine (Q126H), isoleucine (Q126I), or tyrosine (Q126Y); (p) the alanine residue at a position corresponding to position 150 of wild-type human Neu2 is substituted by valine (Al 50 V); (q) the cysteine residue at a position corresponding to position 164 of wild-type human Neu2 is substituted by glycine (C164G); (r) the arginine residue at a position corresponding to position 170 of wildtype human Neu2 is substituted by proline (R170P); (s) the alanine residue at a position corresponding to position 171 of wild-type human Neu2 is substituted by glycine (A171G); (t) the glutamine residue at a position corresponding to position 188 of wild-type human Neu2 is substituted by proline (Q188P); (u) the arginine residue at a position corresponding to position 189 of wild-type human Neu2 is substituted by proline (R189P); (v) the alanine residue at a position corresponding to position 213 of wild-type human Neu2 is substituted by cysteine (A213C), asparagine (A213N), serine (A213S), or threonine (A213T); (w) the leucine residue at a position corresponding to position 217 of wild-type human Neu2 is substituted by alanine (L217A) or valine (L217V); (x) the threonine residue at a position corresponding to position 249 of wild-type human Neu2 is substituted by alanine (T249A); (y) the aspartic acid residue at a position corresponding to position 251 of wild-type human Neu2 is substituted by glycine (D251G); (z) the glutamic acid residue at a position corresponding to position 225 of wild-type human Neu2 is substituted by proline (E225P); (aa) the histidine residue at a position corresponding to position 239 of wild-type human Neu2 is substituted by proline (H239P); (bb) the leucine residue at a position corresponding to position 240 of wild-type human Neu2 is substituted by aspartic acid (L240D), asparagine (L240N), or tyrosine (L240Y); (cc) the arginine residue at a position corresponding to position 241 of wild-type human Neu2 is substituted by alanine (R241 A), aspartic acid (R241D), leucine (R241L), glutamine (R241Q). or tyrosine (R241Y); (dd) the alanine residue at a position corresponding to position 242 of wild-type human Neu2 is substituted by cysteine (A242C), phenylalanine (A242F), glycine (A242G), histidine (A242H), isoleucine (A242I), lysine (A242K), leucine (A242L), methionine (A242M), asparagine (A242N), glutamine (A242Q), arginine (A242R), serine (A242S), valine (A242V), tryptophan (A242W), or tyrosine (A242Y); (ee) the valine residue at a position corresponding to position 244 of wild-type human Neu2 is substituted by isoleucine (V244I), lysine (V244K), or proline (V244P); (ff) the glutamic acid residue at a position corresponding to position 257 of wild-type human Neu2 is substituted by proline (E257P); (gg) the serine residue at a position corresponding to position 258 is substituted by cysteine (S258C); (hh) the leucine residue at a position corresponding to position 260 of wild-type human Neu2 is substituted by aspartic acid (L260D), phenylalanine (L260F), glutamine (L260Q), or threonine (L260T); (ii) the valine residue at a position corresponding to position 265 of wild-type human Neu2 is substituted by phenylalanine (V265F); (jj) the glutamine residue at a position corresponding to position 270 of wild-type human Neu2 is substituted by alanine (Q270A), histidine (Q270H), phenylalanine (Q270F), proline (Q270P), serine (Q270S), or threonine (Q270T); (kk) the tryptophan residue at a position corresponding to position 292 of wild-type human Neu2 is substituted by arginine (W292R); (11) the serine residue at a position corresponding to position 301 of wild-type human Neu2 is substituted by alanine (S301 A), aspartic acid (S301D), glutamic acid (S301E), phenylalanine (S301F), glycine (S301G), histidine (S301H), isoleucine (S301I), lysine (S301K), leucine (S301L), methionine (S301M), asparagine (S301N), proline (S301P), glutamine (S301Q), arginine (S301R), threonine (S301T), valine (S301V), tryptophan (S301W), or tyrosine (S301Y)); (mm) the tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 is substituted by alanine (W302A), aspartic acid (W302D), glutamic acid (W302E), phenylalanine (W302F), glycine (W302G), histidine (W302H), isoleucine (W302I), lysine (W302K), leucine (W302L), methionine (W302M), asparagine (W302N), proline (W302P), glutamine (W302Q), arginine (W302R), serine (W302S), threonine (W302T), valine (W302V), or tyrosine (W302Y); (nn) the valine residue at a position corresponding to position 363 of wild-type human Neu2 is substituted by arginine (V363R); or (oo) the leucine residue at a position corresponding to position 365 of wild-type human Neu2 is substituted by glutamine (L365Q), histidine (L365H), isoleucine (L365I), lysine (L365K) or serine (L365S); or the sialidase comprises a combination of any of the foregoing substitutions. For example, the sialidase may comprise a substitution selected from K9D, P62G, P62N, P62S, P62T, D80P, A93E, Q126H, Q126Y, R189P, H239P, A242T, Q270A, Q270S, Q270T, S301A, S301R, W302K, W302R, V363R, and L365I, or a combination of any of the foregoing substitutions.
[00141] In certain embodiments, the recombinant mutant human sialidase comprises a deletion of a leucine residue at a position corresponding to position 184 of wild-type human Neu2 (AL184), a deletion of a histidine residue at a position corresponding to position 185 of wild-type human Neu2 (AHI 85), a deletion of a proline residue at a position corresponding to position 186 of wild-type human Neu2 (API 86), a deletion of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (All 87), and a deletion of a glutamine residue at a position corresponding to position 184 of wild-type human Neu2 (AQ188), or a combination of any of the foregoing deletions.
[00142] In certain embodiments, the recombinant mutant human sialidase comprises an insertion between a threonine residue at a position corresponding to position 216 of wild-type human Neu2 and a leucine residue at a position corresponding to position 217 of wild-type human Neu2, for example, an insertion of an amino acid selected from S, T, Y, L, F, A, P, V, I, N, D, and H.
[00143] Additional exemplary sialidase mutations, and combinations of sialidase mutations, are described in International (PCT) Patent Application No. PCT / US2019 / 012207, filed January 3, 2019, including in the Detailed Description in the section entitled “I. Recombinant Human Sialidases,” and in the Examples in Examples 1, 2, 3, 4, 5, and 6. v. Combinations of Substitutions
[00144] The invention further provides a recombinant mutant human sialidase comprising a combination of any of the mutations contemplated herein. For example, the recombinant mutant sialidase enzyme may comprise a combination of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more of the mutations contemplated herein. It is contemplated that the recombinant mutant sialidase enzyme may comprise 1-15, 1-10, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-15, 2-10, 2-7, 2-6, 2-5, 2-4, 2-3, 3-15, 3-10, 3-7, 3-6, 3-5, or 3-4 of the mutations contemplated herein.
[00145] For example, the recombinant mutant sialidase enzyme may comprise a Ml deletion (AMI), MIA substitution, MID substitution, V6Y substitution, K9D substitution, P62G substitution, P62N substitution, P62S substitution, P62T substitution, A93E substitution, I187K substitution, Q270A substitution, S301R substitution, W302K substitution, C332A substitution, V363R substitution, L365I substitution, or a combination of any of the foregoing.
[00146] In certain embodiments, the recombinant mutant sialidase enzyme comprises a Ml deletion (AMI), MIA substitution, MID substitution, V6Y substitution, I187K substitution, C332A substitution, or a combination of any of the foregoing. For example, the recombinant mutant sialidase enzyme may comprise a combination of mutations selected from: MIA and V6Y; MIA and I187K; MIA and C332A; MID and V6Y; MID and I187K; MID and C332A; AMI and V6Y; AMI and I187K; AMI and C332A; V6Y and I187K; V6Y and C332A; I187K and C332A; MIA, V6Y, and I187K; MIA, V6Y, and C332A; MIA, I187K, and C332A; MID, V6Y, and I187K; MID, V6Y, and C332A; MID, I187K, and C332A; AMI, V6Y, and I187K; AMI, V6Y, and C332A; AMI, I187K, and C332A; V6Y, I187K, and C332A; MIA, V6Y, I187K, and C332A; MID, V6Y, I187K, and C332A; and AMI, V6Y, I187K, and C332A.
[00147] In certain embodiments, the recombinant mutant sialidase enzyme comprises (i) an amino acid substitution identified in TABLE 8, or a combination of any amino acid substitution identified in TABLE 8, and (ii) a substitution a Ml deletion (AMI), MIA substitution, MID substitution, V6Y substitution, I187K substitution, C332A substitution, or a combination of any of the foregoing. For example, the recombinant mutant sialidase enzyme may comprise (i) an amino acid substitution identified in TABLE 8, or a combination of any amino acid substitution identified in TABLE 8, and (ii) a combination of mutations selected from: MIA and V6Y; MIA and I187K; MIA and C332A; MID and V6Y; MID and I187K; MID and C332A; AMI and V6Y; AMI and I187K; AMI and C332A; V6Y and I187K; V6Y and C332A; I187K and C332A; MIA, V6Y, and I187K; MIA, V6Y, and C332A; MIA, I187K, and C332A; MID, V6Y, and I187K; MID, V6Y, and C332A; MID, I187K, and C332A; AMI, V6Y, and I187K; AMI, V6Y, and C332A; AMI, I187K, and C332A; V6Y, I187K, and C332A; MIA, V6Y, I187K, and C332A; MID, V6Y, I187K, and C332A; and AMI, V6Y, I187K, and C332A.
[00148] In certain embodiments, the recombinant mutant sialidase enzyme comprises: (a) the MID, V6Y, P62G, A93E, I187K, and C332A substitutions; (b) the MID, V6Y, K9D, A93E, I187K, C332A, V363R, and L365I substitutions; (c) the MID, V6Y, P62N, I187K, and C332A substitutions; (d) the MID, V6Y, I187K, Q270A, S301R, W302K, and C332A substitutions; (e) the MID, V6Y, P62S, I187K, Q270A, S301R, W302K, and C332A substitutions; (f) the MID, V6Y, P62T, I187K, Q270A, S301R, W302K, and C332A substitutions; (g) the MID, V6Y, P62N, I187K, Q270A, S301R, W302K, and C332A substitutions; (h) the MID, V6Y, P62G, A93E, I187K, S301A, W302R, and C332A substitutions; (i) the MID, V6Y, P62G, A93E, Q126Y, I187K, Q270T, and C332A substitutions; or (j) the MID, V6Y, P62G, A93E, Q126Y, I187K, and C332A substitutions; or (k) the MID, V6Y, P62G, A93E, Q126Y, I187K, A242F, Q270T, and C332A substitutions.
[00149] In certain embodiments, the recombinant mutant human sialidase comprises a substitution of a serine residue at a position corresponding to position 301 of wild-type human Neu2 (S301) in combination with a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302). For example, the recombinant mutant human sialidase may comprise a combination of substitutions corresponding to a combination of substitutions listed in a row of TABLE 8 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). For example, the 5 recombinant mutant human sialidase may comprise: the S301K and W302R substitutions; the S301K and W302K substitutions; or the S301A and W302S substitutions. TABLE 8 Substitutions S301 A, W302R S301A, W302S S301A, W302T S301K, W302S S301N, W302S S301T, W302S S301T, W302T S301T, W302R S301 A, W302A S301K, W302R S301K, W302T S301N, W302T S301K, W302K S301P, W302R S301P, W302S S301P, W302T
[00150] In certain embodiments, the recombinant mutant human sialidase comprises a 10 combination of substitutions corresponding to a combination of substitutions listed in a row of TABLE 9 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)). TABLE 9 Substitutions M1D / V6Y^P62GjT87k7C332A MID, V6Y, K9D, I187K, C332A, V363R, L365I MID, V6Y, P62G, A93E, I187K, C332A MID, V6Y, K9D, I187K, C332A, V363R, L365K MID, V6Y, K9D, I187K, C332A, V363R, L365S MID, V6Y, K9D, I187K, C332A, V363R, L365Q MID, V6Y, K9D, I187K, C332A, V363R, L365H MID, V6Y, A93K, I187K, C332A MID, V6Y, A93E, I187K, C332A V6Y, I187K, W292R V6Y, G107D, I187K V6Y, C125L C125L, I187K V6Y, C125L, I187K M4d7v6Y^K45AjT87kTC332A MID, V6Y, Q270A, I187K, C332A MID, V6Y, K44R, K45R, I187K, C332A MID, V6Y, Q112R, I187K, C332A MID, V6Y, Q270F, I187K, C332A MID, V6Y, I187K, S301R, W302K, C332A MID, V6Y, K44E, K45E, I187K, C332A MID, V6Y, I187K, L217V, C332A MID, V6Y, I187K, L217A, C332A MID, V6Y, K44E, K45E, I187K, S301R, W302K, C332A MID, V6Y, Q112R, I187K, S301R, W302K, C332A MID, V6Y, I187K, Q270A, S301R, W302K, C332A MID, V6Y, K44E, K45E, Q112R, I187K, C332A MID, V6Y, K44E, K45E, I187K, Q270A, C332A MID, V6Y, K45A, I187K, Q270A, C332A MID, V6Y, I187K, Q270H, C332A Substitutions MID, V6Y, I187K, Q270P, C332A MID, V6Y, Q112K, I187K, C332A MID, V6Y, P62S, I187K, Q270A, S301R, W302K, C332A MID, V6Y, P62T, I187K, Q270A, S301R, W302K, C332A MID, V6Y, P62N, I187K, Q270A, S301R, W302K, C332A V6Y, P62H, I187K V6Y, Q108H, I187K MID, V6Y, P62H, I187K, C332A MID, V6Y, P62G, I187K, C332A V6Y, P62G, I187K MID, V6Y, P62H, I187K MID, V6Y, Q108H, I187K MID, V6Y, P62N, I187K, C332A MID, V6Y, P62D, I187K, C332A MID, V6Y, P62E, I187K, C332A V6Y, C164G, I187K, T248A V6Y, C164G, I187K V6Y, Q126L, I187K D251G V6Y, L54M, Q69H, R78K, A171G, I187K V6Y, P62T, I187K V6Y, Al 50V, I187K P5H, V6Y, P62S, I187K V6Y, C164G, I187K Q126Y, Q170T Q126Y, A242F, Q270T MID, V6Y, P62G, A93E, Q126E, I187K, C332A MID, V6Y, P62G, A93E, Q126I, I187K, C332A MID, V6Y, P62G, A93E, Q126L, I187K, C332A MID, V6Y, P62G, A93E, Q126Y, I187K, C332A MID, V6Y, P62G, A93E, Q126F, I187K, C332A MID, V6Y, P62G, A93E, Q126H, I187K, C332A Substitutions NnD7v6Y^P62QA53EjT87K7Q270S7C332A NnD7v6Y^P62QA53EjT87K7Q270T7C332A MID, V6Y, P62G, A93E, Q126Y, I187K, Q270T, C332A MID, V6Y, P62G, A93E, Q126Y, I187K, A242F, Q270T, C332A MID, V6Y, P62G, D80P, A93E, I187K, C332A MID, V6Y, P62G, A93E, R170P, I187K, C332A MID, V6Y, P62G, A93E, I187K, Q188P, C332A MID, V6Y, P62G, A93E, I187K, R189P, C332A MID, V6Y, P62G, A93E, I187K, E225P, C332A MID, V6Y, P62G, A93E, I187K, H239P, C332A MID, V6Y, P62G, A93E, I187K, E257P, C332A MID, V6Y, P62G, A93E, I187K, S301A, C332A MID, V6Y, P62G, A93E, I187K, S301D, C332A MID, V6Y, P62G, A93E, I187K, S301E, C332A MID, V6Y, P62G, A93E, I187K, S301F, C332A MID, V6Y, P62G, A93E, I187K, S301H, C332A MID, V6Y, P62G, A93E, I187K, S301K, C332A MID, V6Y, P62G, A93E, I187K, S301L, C332A MID, V6Y, P62G, A93E, I187K, S301M, C332A MID, V6Y, P62G, A93E, I187K, S301N, C332A MID, V6Y, P62G, A93E, I187K, S301P, C332A MID, V6Y, P62G, A93E, I187K, S301Q, C332A MID, V6Y, P62G, A93E, I187K, S301R, C332A MID, V6Y, P62G, A93E, I187K, S301T, C332A MID, V6Y, P62G, A93E, I187K, S301V, C332A MID, V6Y, P62G, A93E, I187K, S301W, C332A MID, V6Y, P62G, A93E, I187K, S301Y, C332A MID, V6Y, P62G, A93E, I187K, W302A, C332A MID, V6Y, P62G, A93E, I187K, W302D, C332A MID, V6Y, P62G, A93E, I187K, W302F, C332A MID, V6Y, P62G, A93E, I187K, W302G, C332A Substitutions NnD7v6Y^P62QA53EjT87K7w302HTC332A NnD7v6Y^P62QA53EjT87K7w302TC332A NnD7v6Y^P62QA53EjT87K7w302LTC332A NnD7v6YJ>62QA53^^ mTdTv^yTpOYToI^^ MID, V6Y, P62G, A93E, I187K, W302P, C332A MID, V6Y, P62G, A93E, I187K, W302Q, C332A MID, V6Y, P62G, A93E, I187K, W302R, C332A MID, V6Y, P62G, A93E, I187K, W302S, C332A MID, V6Y, P62G, A93E, I187K, W302T, C332A MID, V6Y, P62G, A93E, I187K, W302V, C332A MID, V6Y, P62G, A93E, I187K, W302Y, C332A MID, V6Y, P62G, A93E, I187K, S301A, W302A, C332A MID, V6Y, P62G, A93E, I187K, S301A, W302R, C332A MID, V6Y, P62G, A93E, I187K, S301A, W302S, C332A MID, V6Y, P62G, A93E, I187K, S301A, W302T, C332A MID, V6Y, P62G, A93E, I187K, S301K, W302S, C332A MID, V6Y, P62G, A93E, I187K, S301K, W302R, C332A MID, V6Y, P62G, A93E, I187K, S301K, W302T, C332A MID, V6Y, P62G, A93E, I187K, S301N, W302S, C332A MID, V6Y, P62G, A93E, I187K, S301N, W302T, C332A MID, V6Y, P62G, A93E, I187K, S301T, W302R, C332A Q126Y, Q270T Q126Y7A242F7Q270T
[00151] In certain embodiments, the recombinant mutant human sialidase comprises the amino acid sequence of any one of SEQ ID NOs: 48-62, 169-171, or 196 or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 48-62, 169-171, or 196. 5
[00152] In certain embodiments, the recombinant mutant human sialidase comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASX7X8DEHAELIVX9RR GDYDAX10THQVQWX11AQEWAQAX12LDGHRSMNPCPLYDX13QTGTLFLFFIAIPX14X15VT EX16QQLQTRANVTRLX17X18VTSTDHGRTWSSPRDLTDAAIGPX19YREWSTFAVGPGHX20LQ LHDRX21RSLWPAYAYRKLHPX22QRPIPSAFX23FLSHDHGRTWARGHFVAQDTX24ECQVAE VETGEQRWTLNARSHLRARVQAQSX25NX26GLDFQX27SQLVKKLVEPPPX28GX29QGSVISF PSPRSGPGSPAQX30LLYTHPTHX31X32QRADLGAYLNPRPPAPEAWSEPX33LLAKGSX34AYS DLQSMGTGPDGSPLFGX35LYEANDYEEIX36FX37MFTLKQAFPAEYLPQ (SEQ ID NO: 47), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Ala or Lys, X3 is Asn or Leu, X4 is Pro or His, X5 is Phe, Trp, Tyr or Vai, Xe is Lys or Asp. X7 is Lys, Arg, or Glu. Xs is Lys, Ala, Arg, or Glu, X9 is Leu or Met, X10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X12 is Arg or Lys, X13 is Ala, Glu or Lys, X14 is Gly or Asp, X15 is Gin or His, Xie is Gin, Arg, or Lys, X17 is Ala, Cys, He, Ser, Vai, or Leu, Xis is Gin or Leu, X19 is Ala or Vai, X20 is Cys or Gly, X21 is Ala or Gly, X22 is Arg, He, or Lys, X23 is Ala, Cys, Leu, or Vai, X24 is Leu, Ala, or Vai, X25 is Thr or Ala, X26 is Asp or Gly, X27 is Glu or Lys, X28 is Gin, Ala, His, Phe, or Pro, X29 is Cys or Vai, X30 is Trp or Arg, X31 is Ser or Arg, X32 is Trp or Lys, X33 is Lys or Vai, X34 is Ala, Cys, Ser, or Vai, X35 is Cys, Leu, or Vai, X36 is Vai or Arg, and X37 is Leu, Gin, His, lie, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
[00153] In certain embodiments, the recombinant mutant human sialidase comprises the amino acid sequence of X1ASLPX2LQX3ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYD AX4THQVQWQAQEWAQARLDGHRSMNPCPLYDX5QTGTLFLFFIAIPGQVTEQQQLQTRANV TRLCQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRK LHPXeQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQ AQSTNDGLDFQESQLVKKLVEPPPX7GCQGSVISFPSPRSGPGSPAQWLLYTHPTHX8X9QRA DLGAYLNPRPPAPEAWSEPVLLAKGSX10AYSDLQSMGTGPDGSPLFGCLYEANDYEEIX11FX 12MFTLKQAFPAEYLPQ (SEQ ID NO: 46), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Phe, Trp, Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, X5 is Ala, Glu, or Lys, Xe is Arg, He, or Lys, X7 is Gin, Ala, His, Phe, or Pro, Xs is Ser or Arg, X9 is Trp or Lys, X10 is Ala, Cys, Ser, or Vai, Xu is Vai or Arg, and X12 is Leu, Gin, His, He, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1). In certain embodiments, Xi is Ala, Asp, Met, or not present, X2 is Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Gly, Ser or Thr, X5 is Ala or Glu, Xe is He or Lys, X7 is Gin or Ala, Xs is Ser or Arg, X9 is Trp or Lys, X10 is Ala or Cys, Xu is Vai or Arg, and X12 is Leu or He.
[00154] In certain embodiments, the recombinant mutant human sialidase comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASX7X8DEHAELIVX9RR GDYDAX10THQVQWX11AQEWAQAX12LX13GHRSMNPCPLYDX14QTGTLFLFFIAIPX15X16V TEX17QQLQTRANVTRLX18X19VTSTDHGRTWSSPRDLTDAAIGPX20YREWSTFAVGPGHX21L QLHDX22X23RSLWPAYAYRKLHPX24X25X26PIPSAFX27FLSHDHGRTWARGHFVX28QDTX29 ECQVAEVX30TGEQRWTLNARSX31X32X33X34RX35QAQSX36NX37GLDFQX38X39QX40VKKL X41EPPPX42GX43QGSVISFPSPRSGPGSPAQX44LLYTHPTHX45X46QRADLGAYLNPRPPAP EAWSEPX47LLAKGSX48AYSDLQSMGTGPDGSPLFGX49LYEANDYEEIX50FX51MFTLKQAFP AEYLPQ (SEQ ID NO: 172), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Ala or Lys, X3 is Asn or Leu, X4 is Pro or His, X5 is Phe, Trp, Tyr or Vai, Xe is Lys or Asp, X7 is Lys, Arg, or Glu, Xs is Lys, Ala, Arg, or Glu, X9 is Leu or Met, X10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X12 is Arg or Lys, X13 is Asp or Pro, X14 is Ala, Glu or Lys, X15 is Gly or Asp, Xi6 is Gin or His, X17 is Gin, Arg, or Lys, Xis is Ala, Cys, He, Ser, Vai, or Leu, X19 is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr, X20 is Ala or Vai, X21 is Cys or Gly, X22 is Arg or Pro, X23 is Ala or Gly, X24 is Arg, He, or Lys, X25 is Gin or Pro, X26 is Arg or Pro, X27 is Ala, Cys, Leu, or Vai, X28 is Ala, Cys, Asn, Ser, or Thr, X29 is Leu, Ala, or Vai, X30 is Glu or Pro, X31 is His or Pro, X32 is Leu, Asp, Asn, or Tyr, X33 is Arg, Ala, Asp, Leu, Gin, or Tyr, X34 is Ala, Cys, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Gin, Arg, Ser, Vai, Trp, or Tyr, X35 is Vai, He, or Lys, X36 is Thr or Ala, X37 is Asp or Gly, X38 is Glu, Lys, or Pro, X39 is Ser or Cys, X40 is Leu, Asp, Phe, Gin, or Thr, X41 is Vai or Phe, X42 is Gin, Ala, His, Phe, Pro, Ser, or Thr, X43 is Cys or Vai, X44 is Trp or Arg, X45 is Ser, Arg, Ala, Asp, Glu, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Pro, Gin, Thr, Vai, Trp, or Tyr, X46is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Vai, or Tyr, X47 is Lys or Vai, X48 is Ala, Cys, Ser, or Vai, X49 is Cys, Leu, or Vai, X50 is Vai or Arg, and X51 is Leu, Gin, His, He, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
[00155] In certain embodiments, the recombinant mutant human sialidase comprises the amino acid sequence of X1ASLPX2LQX3ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYD AX4THQVQWQAQEWAQARLDGHRSMNPCPLYDX5QTGTLFLFFIAIPGQVTEQQQLQTRANV trlcx6vt s tdhgrtws s prdltdaai gpayrews t favgpghclqlhdrars lwpayayrk LHPX7QRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRX8RV QAQSTNDGLDFQESQLVKKLVEPPPX9GCQGSVISFPSPRSGPGSPAQWLLYTHPTHX10X11Q RADLGAYLNPRPPAPEAWSEPVLLAKGSX12AYSDLQSMGTGPDGSPLFGCLYEANDYEEIX13 FX14MFTLKQAFPAEYLPQ (SEQ ID NO: 173), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Phe, Trp, Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, X5 is Ala, Glu, or Lys, Xe is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr, X?is Arg, He, or Lys, Xs is Ala, Cys, Phe, Gly, His, He, Lys, Leu, Met, Asn, Gin, Arg, Ser, Vai, Trp, or Tyr, X9 is Gin, Ala, His, Phe, Pro, Ser, or Thr, X10 is Ser, Arg, Ala, Asp, Glu, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Pro, Gin, Thr, Vai, Trp, or Tyr, Xu is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Vai, or Tyr, X12 is Ala, Cys, Ser, or Vai, X13 is Vai or Arg, and X14 is Leu, Gin, His, lie, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1). In certain embodiments, Xi is Ala, Asp, Met, or not present, X2 is Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Gly, Ser or Thr, X5 is Ala or Glu, Xe is Gin or Tyr, X7 is He or Lys, Xs is Ala or Thr, X9 is Gin, Ala, or Thr, X10 is Ser, Arg, or Ala, Xu is Trp, Lys, or Arg, X12 is Ala or Cys, X13 is Vai or Arg, and X14 is Leu or He.
[00156] In certain embodiments, the recombinant mutant human sialidase comprises a conservative substitution relative to a recombinant mutant human sialidase sequence disclosed herein. As used herein, the term “conservative substitution” refers to a substitution with a structurally similar amino acid. For example, conservative substitutions may include those within the following groups: Ser and Cys; Leu, lie, and Vai; Glu and Asp; Lys and Arg; Phe, Tyr, and Trp; and Gin, Asn, Glu, Asp, and His. Conservative substitutions may also be defined by the BLAST (Basic Local Alignment Search Tool) algorithm, the BLOSUM substitution matrix (e.g., BLOSUM 62 matrix), or the PAM substitutiomp matrix (e.g., the PAM 250 matrix).
[00157] Sequence identity may be determined in various ways that are within the skill of a person skilled in the art, e.g, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. BLAST (Basic Local Alignment Search Tool) analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268; Altschul, (1993) J. Mol. Evol. 36:290-300; Altschul etaL, (1997) Nucleic Acids Res. 25:3389-3402, incorporated by reference herein) are tailored for sequence similarity searching. For a discussion of basic issues in searching sequence databases see Altschul et al., (1994) Nature Genetics 6:119-129, which is fully incorporated by reference herein. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. The search parameters for histogram, descriptions, alignments, expect (i.e., the statistical significance threshold for reporting matches against database sequences), cutoff, matrix and filter are at the default settings. The default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff etaL, (1992) Proc. Natl. Acad. Sci. USA 89:10915-10919, fully incorporated by reference herein). Four blastn parameters may be adjusted as follows: Q=10 (gap creation penalty); R=10 (gap extension penalty); wink=l (generates word hits at every wink.sup.th position along the query); and gapw=16 (sets the window width within which gapped alignments are generated). The equivalent blastp parameter settings may be Q=9; R=2; wink=l; and gapw=32. Searches may also be conducted using the NCBI (National Center for Biotechnology Information) BLAST Advanced Option parameter (e.g.: -G, Cost to open gap [Integer]: default = 5 for nucleotides / 11 for proteins; -E, Cost to extend gap [Integer]: default = 2 for nucleotides / 1 for proteins; -q, Penalty for nucleotide mismatch [Integer]: default = -3; -r, reward for nucleotide match [Integer]: default = 1; -e, expect value [Real]: default = 10; -W, wordsize [Integer]: default = 11 for nucleotides / 28 for megablast / 3 for proteins; -y, Dropoff (X) for blast extensions in bits: default = 20 for blastn / 7 for others; -X, X dropoff value for gapped alignment (in bits): default = 15 for all programs, not applicable to blastn; and -Z, final X dropoff value for gapped alignment (in bits): 50 for blastn, 25 for others). ClustalW for pairwise protein alignments may also be used (default parameters may include, e.g., Blosum62 matrix and Gap Opening Penalty = 10 and Gap Extension Penalty = 0.1). A Bestfit comparison between sequences, available in the GCG package version 10.0, uses DNA parameters GAP=50 (gap creation penalty) and LEN=3 (gap extension penalty). The equivalent settings in Bestfit protein comparisons are GAP=8 and LEN=2. II. Serum Half-life Extenders
[00158] As used herein, a “serum half-life extender” refers to a moiety that can be associated with a sialidase to extend its circulating half-life in the serum of a subject. In certain embodiments, a serum half-life extender can be selected from an Fc domain (see, e.g., Beck et al. (2011) MAbs 4:1015-28), albumin (e.g., human serum albumin (HSA), see, Weimer et al. (2013) Recombinant albumin fusion proteins. In: Schmidt S, editor. Fusion protein technologies for biopharmaceuticals: applications and challenges. Hoboken: Wiley; 2013, p. 297-323), albumin binding domain (e.g., an HSA binder, see Walker et al. (2013) Albuminbinding fusion proteins in the development of novel long-acting therapeutics. In: Schmidt S, editor. Fusion protein technologies for biopharmaceuticals: applications and challenges. Hoboken: Wiley; 2013, p. 325-43), transferrin (see Kim et al. (2010) J Pharmacol Exp Ther 334:682-92), XTEN (also called recombinant PEG or “rPEG”, see Schellenberger et al. (2009) Nat. Biotechnol. 27:1186-90), a homo-amino acid polymer (HAP, see Schlapschy et al. (2007) Protein Eng Des Sel. 20:273-84)), a proline-alanine-serine polymer (PAS, see Schlapschy et al. (2013) Protein Eng Des Sel. 26:489-501), an elastin-like peptide (ELP, see Floss et al. (2013) Fusion protein technologies for biopharmaceuticals: applications and challenges, p. 372-98), carboxy-terminal peptide (CTP, Duijkers et al. (2002) Hum Reprod. 17:1987-93)), gelatin-like protein (GLK, Huang et al. (2010) Eur J Pharm Biopharm 72:435-41), and a polyethylene glycol (PEG).
[00159] Suitable serum half-life extenders also include a variety of polymers, such as those described in U.S. Patent No. 7,842,789. For example, block copolymers of polyoxyethylene and polyoxypropylene (Pluronics); polymethacrylates; carbomers; and branched or unbranched polysaccharides which comprise the saccharide monomers such as D-mannose, D- and L-galactose, fucose, fructose, D-xylose, L-arabinose, and D-glucuronic acid can be used. In other embodiments, the serum half-life extender can be a hydrophilic polyvinyl polymer such as polyvinyl alcohol and polyvinylpyrrolidone (PVP)-type polymers. The serum half-life extender can be a functionalized polyvinylpyrrolidone, for example, carboxy or amine functionalized on one (or both) ends of the polymer (as available from PolymerSource). Alternatively, the serum half-life extender can include Poly N-(2-hydroxypropyl)methacrylamide (HPMA), or functionalized HPMA (amine, carboxy, etc.), Poly(N-isopropylacrylamide) or functionalized poly(N-isopropylacrylamide).
[00160] In one embodiment, a sialidase is covalently attached to a naturally long-half-life polypeptide or protein such as an Fc domain (Beck et al., supra), transferrin (Kim et al., supra), or albumin (Weimer et al., supra) to form a fusion protein, either by genetic fusion (i.e., production of recombinant fusion protein) or by chemical conjugation.
[00161] In another embodiment, a sialidase is covalently attached to an inert polypeptide such as an XTEN (also called recombinant PEG or “rPEG”, see Schellenberger, supra), a homo amino acid polymer (HAP, see Schlapschy et al. (2007), supra), a proline-alanine-serine-polymer (PAS, see Schlapschy et al, (2013), supra), an elastin-like peptide (ELP, see Floss et al., supra), or gelatin-like protein (GLK, Huang et al., supra) to form a fusion protein, either by genetic fusion (i.e., production of recombinant fusion protein) or by chemical conjugation. Inert polypeptides function, among other things, to increase the size and hydrodynamic radius of the sialidase, thereby to extend half-life. In certain embodiments, an XTEN polypeptide has a length from about 25 amino acids to about 1500 amino acids (e.g., from about 25 amino acids to about 100 amino acids, from about 25 amino acids to about 250 amino acids, from about 25 amino acids to about 500 amino acids, from about 25 amino acids to about 750 amino acids, from about 25 amino acids to about 1000 amino acids, from about 25 amino acids to about 1250 amino acids, from about 100 amino acids to about 250 amino acids, from about 100 amino acids to about 250 amino acids, from about 100 amino acids to about 500 amino acids, from about 100 amino acids to about 750 amino acids, from about 100 amino acids to about 1000 amino acids, from about 100 amino acids to about 1250 amino acids, from about 100 amino acids to about 1500 amino acids, from about 250 amino acids to about 1250 amino acids, from about 250 amino acids to about 1000 amino acids, from about 250 amino acids to about 750 amino acids, from about 250 amino acids to about 500 amino acids, from about 500 amino acids to about 750 amino acids, from about 500 amino acids to about 1000 amino acids, from about 500 amino acids to about 1250 amino acids, from about 500 amino acids to about 1500 amino acids, from about 750 amino acids to about 1000 amino acids, from about 750 amino acids to about 1250 amino acids, from about 750 amino acids to about 1500 amino acids, from about 1000 amino acids to about 1250 amino acids, from about 1000 amino acids to about 1500 amino acids, or from about 1250 amino acids to about 1500 amino acids.
[00162] In certain embodiments, a sialidase is chemically conjugated to a repeat chemical moiety such as PEG or hyaluronic acid (see, Mero et al. (2013) Carb Polymers 92:216370), which increases the hydrodynamic radius of the sialidase thereby to extend half-life.
[00163] In another embodiment, a sialidase is itself polysialylated or covalently attached to a negatively charged, highly sialylated protein (e.g., carboxy-terminal peptide (CTP), of chorionic gonadotropin (CG) P-chain, see, Duijkers et al. (2002) Hum Reprod 17:1987-93).
[00164] Methods for making and using the foregoing serum half-life extenders are known in the art. See also, e.g., Strohl (2015) Biodrugs 29:215-239.
[00165] In certain embodiments, the sialidase is conjugated to a serum half-life extender that is not and Fc domain and / or is not PEG.
[00166] It is contemplated that one or more sialidases may be covalently bound to one or more (for example, 2, 3, 4, 5, 6, 8, 9, 10 or more) serum half-life extenders.
[00167] In certain embodiments, the serum half-life of the sialidase enzyme conjugated to a serum half-life enhancer is at least 24, 36, 48, or 60 hours.
[00168] In general, the serum half-life extender may have a molecular weight from about 2 kDa to about 5 kDa, from about 2 kDa to about 10 kDa, from about 2 kDa to about 20 kDa, from about 2 kDa to about 30 kDa, from about 2 kDa to about 40 kDa, from about 2 kDa to about 50 kDa, from about 2 kDa to about 60 kDa, from about 2 kDa to about 70 kDa, from about 2 kDa to about 80 kDa, from about 2 kDa to about 90 kDa, from about 2 kDa to about 100 kDa, from about 2 kDa to about 150 kDa, from about 5 kDa to about 10 kDa, from about 5 kDa to about 20 kDa, from about 5 kDa to about 30 kDa, from about 5 kDa to about 40 kDa, from about 5 kDa to about 50 kDa, from about 5 kDa to about 60 kDa, from about 5 kDa to about 70 kDa, from about 5 kDa to about 80 kDa, from about 5 kDa to about 90 kDa, from about 5 kDa to about 100 kDa, from about 5 kDa to about 150 kDa, from about 10 kDa to about 20 kDa, from about 10 kDa to about 30 kDa, from about 10 kDa to about 40 kDa, from about 10 kDa to about 50 kDa, from about 10 kDa to about 60 kDa, from about 10 kDa to about 70 kDa, from about 10 kDa to about 80 kDa, from about 10 kDa to about 90 kDa, from about 10 kDa to about 100 kDa, from about 10 kDa to about 150 kDa, from about 20 kDa to about 30 kDa, from about 20 kDa to about 40 kDa, from about 20 kDa to about 50 kDa, from about 20 kDa to about 60 kDa, from about 20 kDa to about 70 kDa, from about 20 kDa to about 80 kDa, from about 20 kDa to about 90 kDa, from about 20 kDa to about 100 kDa, from about 20 kDa to about 150 kDa, from about 30 kDa to about 40 kDa, from about 30 kDa to about 50 kDa, from about 30 kDa to about 60 kDa, from about 30 kDa to about 70 kDa, from about 30 kDa to about 80 kDa, from about 30 kDa to about 90 kDa, from about 30 kDa to about 100 kDa, from about 30 kDa to about 150 kDa, from about 40 kDa to about 50 kDa, from about 40 kDa to about 60 kDa, from about 40 kDa to about 70 kDa, from about 40 kDa to about 80 kDa, from about 40 kDa to about 90 kDa, from about 40 kDa to about 100 kDa, from about 40 kDa to about 150 kDa, from about 50 kDa to about 60 kDa, from about 50 kDa to about 70 kDa, from about 50 kDa to about 80 kDa, from about 50 kDa to about 90 kDa, from about 50 kDa to about 100 kDa, from about 50 kDa to about 150 kDa, from about 60 kDa to about 70 kDa, from about 60 kDa to about 80 kDa, from about 60 kDa to about 90 kDa, from about 60 kDa to about 100 kDa, from about 60 kDa to about 150 kDa, from about 70 kDa to about 80 kDa, from about 70 kDa to about 90 kDa, from about 70 kDa to about 100 kDa, from about 70 kDa to about 150 kDa, from about 80 kDa to about 90 kDa, from about 80 kDa to about 100 kDa, from about 80 kDa to about 150 kDa, from about 90 kDa to about 100 kDa, from about 90 kDa to about 150 kDa, or from about 100 kDa to about 150 kDa. a. Fc domains
[00169] In certain embodiments, the fusion protein comprises an immunoglobulin Fc domain. As used herein, unless otherwise indicated, the term “immunoglobulin Fc domain” or “Fc domain” or “Fc” refers to a fragment of an immunoglobulin heavy chain constant region which, either alone or in combination with a second immunoglobulin Fc domain, or unconjugated or conjugated to a sialidase, is capable of binding to an Fc receptor. An immunoglobulin Fc domain may include, e.g., immunoglobulin CH2 and CH3 domains. An immunoglobulin Fc domain may include, e.g., immunoglobulin CH2 and CH3 domains and an immunoglobulin hinge region. Boundaries between immunoglobulin hinge regions, CH2, and CH3 domains are well known in the art, and can be found, e.g., in the PROSITE database (available on the world wide web at prosite.expasy.org).
[00170] FIGURES 1A-E depict certain embodiments of sialidase-Fc fusion constructs comprising a first polypeptide comprising a first immunoglobulin Fc domain, and a second polypeptide comprising a second immunoglobulin Fc domain. The first and second polypeptides can be covalently linked together. The covalent linkages can be disulfide bonds. A sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin Fc domain or to the N- or C-terminus of the second immunoglobulin Fc domain. An optional second sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin Fc domain or to the N- or C-terminus of the second immunoglobulin Fc domain.
[00171] FIGURE 1A shows a construct having two Fc domains and a sialidase enzyme conjugated to the N-terminus of each Fc domain. FIGURE IB shows a construct having two Fc domains and a sialidase enzyme conjugated to the C-terminus of the first Fc domain and the N-terminus of the second Fc domain. FIGURE IC shows a construct having two Fc domains and a sialidase enzyme conjugated to the N-terminus of the second Fc domain. FIGURE ID shows a construct having two Fc domains and a sialidase enzyme conjugated to the C-terminus of the first Fc domain. FIGURE IE shows a construct having two Fc domains and a sialidase enzyme conjugated to the C-terminus of the each Fc domain. It is understood that the Fc domains can be naturally occurring Fc domains or engineered Fc domains containing modifications, such as, point mutations in each polypeptide chain that facilitates a knob into hole configuration, or to provide a modified Fc domain functionality.
[00172] In certain embodiments, the immunoglobulin Fc domain is derived from a human IgGl, IgG2, IgG3, IgG4, IgAl, IgA2, IgD, IgE, and IgM Fc domain. A single amino acid substitution (S228P according to Kabat numbering; designated IgG4Pro) may be introduced to abolish the heterogeneity observed in recombinant IgG4 antibody. See Angal, S. et al. (1993) Mol. Immunol. 30:105-108.
[00173] In certain embodiments, the immunoglobulin Fc domain is derived from a human IgGl isotype or another isotype that elicits antibody-dependent cell-mediated cytotoxicity (ADCC) and / or complement mediated cytotoxicity (CDC). In certain embodiments, the immunoglobulin Fc domain is derived from a human IgGl isotype (e.g., SEQ ID NO: 31 or SEQ ID NO: 69).
[00174] In certain embodiments, the immunoglobulin Fc domain is derived from a human IgG4 isotype or another isotype that elicits little or no antibody-dependent cell-mediated cytotoxicity (ADCC) and / or complement mediated cytotoxicity (CDC). In certain embodiments, the immunoglobulin Fc domain is derived from a human IgG4 isotype.
[00175] In certain embodiments, the immunoglobulin Fc domain comprises either a “knob” mutation, e.g., T366Y or a “hole” mutation, e.g., Y407T for heterodimerization with a second polypeptide (residue numbers according to EU numbering, Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). In certain embodiments comprising a sialidase-Fc fusion with two Fc domains, the first Fc domain can comprises a “knob” mutation (such as SEQ ID NO: 33 and SEQ ID NO: 148) and the second Fc domain can comprise a “hole” mutation (such as SEQ ID NO: 32 and SEQ ID NO: 147).
[00176] In certain embodiments, a sialidase-Fc fusion protein comprises the amino acid sequence of any one of SEQ ID NOs: 129-158, 177-192, and 197-200, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 129-158, 177-192, and 197-200.
[00177] In certain embodiments, the sialidase-Fc fusion protein comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASX7X8DEHAELIV X9RRGDYDAXioTHQVQWXiiAQEVVAQAXi2LDGHRSMNPCPLYDXi3QTGTLFLFFI AIPX14X15VTEX16QQLQTRANVTRLX17X18VTSTDHGRTWSSPRDLTDAAIGPX19YRE WSTFAVGPGHX2oLQLHDRX2iRSLVVPAYAYRKLHPX22QRPIPSAFX23FLSHDHGRT WARGHFVAQDTX24ECQVAEVETGEQRVVTLNARSHLRARVQAQSX25NX26GLDFQ X27SQLVKKLVEPPPX28GX29QGSVISFPSPRSGPGSPAQX3oLLYTHPTHX3iX32QRADL - 55 - GAYLNPRPPAPEAWSEPX33LLAKGSX34AYSDLQSMGTGPDGSPLFGX35LYEANDYE EIX36FX37MFTLKQAFPAEYLPQGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLTSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 159), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Ala or Lys, X3 is Asn or Leu, X4 is Pro or His, X5 is Phe, Trp, Tyr or Vai, Xe is Lys or Asp. X7 is Lys, Arg, or Glu. Xs is Lys, Ala, Arg, or Glu, X9 is Leu or Met, Xw is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X12 is Arg or Lys, Xi3 is Ala, Glu or Lys, X14 is Gly or Asp, X15 is Gin or His, Xi6 is Gin, Arg, or Lys, X17 is Ala, Cys, He, Ser, Vai, or Leu, Xis is Gin or Leu, X19 is Ala or Vai, X20 is Cys or Gly, X21 is Ala or Gly, X22 is Arg, He, or Lys, X23 is Ala, Cys, Leu, or Vai, X24 is Leu, Ala, or Vai, X25 is Thr or Ala, X26 is Asp or Gly, X27 is Glu or Lys, X28 is Gin, Ala, His, Phe, or Pro, X29 is Cys or Vai, X3o is Trp or Arg, X3i is Ser or Arg, X32 is Trp or Lys, X33 is Lys or Vai, X34 is Ala, Cys, Ser, or Vai, X3s is Cys, Leu, or Vai, X^X36 is Vai or Arg, and X37 is Leu, Gin, His, He, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
[00178] In certain embodiments, the sialidase-Fc fusion protein comprises the amino acid sequence of X1ASLPX2LQX3ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRR GDYDAX4THQVQWQAQEVVAQARLDGHRSMNPCPLYDX5QTGTLFLFFIAIPGQVTE QQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQL HDRARSLVVPAYAYRKLHPXeQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVA EVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPX7GCQGSVIS FPSPRSGPGSPAQWLLYTHPTHX8X9QRADLGAYLNPRPPAPEAWSEPVLLAKGSX10A YSDLQSMGTGPDGSPLFGCLYEANDYEEIX11FX12MFTLKQAFPAEYLPQGGGGSGG GGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLTSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK (SEQ ID NO: 160), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Phe, Trp, Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, X5 is Ala, Glu, or Lys, Xe is Arg, He, or Lys, X7 is Gin, Ala, His, Phe, or Pro, Xs is Ser or Arg, X9 is Trp or Lys, Xw is Ala, Cys, Ser, or Vai, Xu is Vai or Arg, and Xuis Leu, Gin, His, He, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1). In certain embodiments, Xi is Ala, Asp, Met, or not present, X2 is Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Gly, Ser or Thr, X5 is Ala or Glu, Xe is He or Lys, X7 is Gin or Ala, Xs is Ser or Arg, X9 is Trp or Lys, X10 is Ala or Cys, Xu is Vai or Arg, and X12 is Leu or He.
[00179] In certain embodiments, the sialidase-Fc fusion protein comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASX7X8DEHAELIV X9RRGDYDAX10THQVQWX11AQEVVAQAX12LDGHRSMNPCPLYDX13QTGTLFLFFI AIPX14X15VTEX16QQLQTRANVTRLX17X18VTSTDHGRTWSSPRDLTDAAIGPX19YRE WSTFAVGPGHX2oLQLHDRX2iRSLVVPAYAYRKLHPX22QRPIPSAFX23FLSHDHGRT WARGHFVAQDTX24ECQVAEVETGEQRVVTLNARSHLRARVQAQSX25NX26GLDFQ X27SQLVKKLVEPPPX28GX29QGSVISFPSPRSGPGSPAQX3oLLYTHPTHX3iX32QRADL GAYLNPRPPAPEAWSEPX33LLAKGSX34AYSDLQSMGTGPDGSPLFGX35LYEANDYE EIX36FX37MFTLKQAFPAEYLPQX38DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLTSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 161), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Ala or Lys, X3 is Asn or Leu, X4 is Pro or His, X5 is Phe, Trp, Tyr or Vai, Xe is Lys or Asp. X7 is Lys, Arg, or Glu. Xs is Lys, Ala, Arg, or Glu, X9 is Leu or Met, X10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X12 is Arg or Lys, Xi3 is Ala, Glu or Lys, X14 is Gly or Asp, X15 is Gin or His, Xie is Gin, Arg, or Lys, X17 is Ala, Cys, He, Ser, Vai, or Leu, Xis is Gin or Leu, X19 is Ala or Vai, X20 is Cys or Gly, X21 is Ala or Gly, X22 is Arg, He, or Lys, X23 is Ala, Cys, Leu, or Vai, X24 is Leu, Ala, or Vai, X25 is Thr or Ala, X26 is Asp or Gly, X27 is Glu or Lys, X28 is Gin, Ala, His, Phe, or Pro, X29 is Cys or Vai, X3o is Trp or Arg, X3i is Ser or Arg, X32 is Trp or Lys, X33 is Lys or Vai, X34 is Ala, Cys, Ser, or Vai, X3s is Cys, Leu, or Vai, X36 is Vai or Arg, X37 is Leu, Gin, His, He, Lys, or Ser, X38 is GGGGSGGGGS (SEQ ID NO: 162) or EPKSS (SEQ ID NO: 163), and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
[00180] In certain embodiments, the sialidase-Fc fusion protein comprises the amino acid sequence of X1ASLPX2LQX3ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRR GDYDAX4THQVQWQAQEVVAQARLDGHRSMNPCPLYDX5QTGTLFLFFIAIPGQVTE QQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQL HDRARSLVVPAYAYRKLHPXeQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVA EVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPX7GCQGSVIS FPSPRSGPGSPAQWLLYTHPTHX8X9QRADLGAYLNPRPPAPEAWSEPVLLAKGSX10A YSDLQSMGTGPDGSPLFGCLYEANDYEEIXiiFXuMFTLKQAFPAEYLPQXbDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLTSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 164), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Phe, Trp, Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, X5 is Ala, Glu, or Lys, Xe is Arg, He, or Lys, X7 is Gin, Ala, His, Phe, or Pro, Xs is Ser or Arg, X9 is Trp or Lys, X10 is Ala, Cys, Ser, or Vai, Xu is Vai or Arg, X12 is Leu, Gin, His, He, Lys, or Ser, and X13 is GGGGSGGGGS (SEQ ID NO: 162) or EPKSS (SEQ ID NO: 163), and the sialidase comprises at least one mutation relative to wildtype human Neu2 (SEQ ID NO: 1). In certain embodiments, Xi is Ala, Asp, Met, or not present, X2 is Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Gly, Ser or Thr, X5 is Ala or Glu, Xe is He or Lys, X7 is Gin or Ala, Xs is Ser or Arg, X9 is Trp or Lys, X10 is Ala or Cys, Xu is Vai or Arg, and X12 is Leu or He.
[00181] In certain embodiments, the sialidase-Fc fusion protein comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASX7X8DEHAELIV X9RRGDYDAX10THQVQWX11AQEVVAQAX12LX13GHRSMNPCPLYDX14QTGTLFLFF IAIPX15X16VTEX17QQLQTRANVTRLX18X19VTSTDHGRTWSSPRDLTDAAIGPX20YRE WSTFAVGPGHX21LQLHDX22X23RSLVVPAYAYRKLHPX24X25X26PIPSAFX27FLSHDH GRTWARGHFVX28QDTX29ECQVAEVX30TGEQRVVTLNARSX31X32X33X34RX35QAQS X36NX37GLDFQX38X39QX40VKKLX41EPPPX42GX43QGSVISFPSPRSGPGSPAQX44LLYT HPTHX45X46QRADLGAYLNPRPPAPEAWSEPX47LLAKGSX48AYSDLQSMGTGPDGSP LFGX49LYEANDYEEIX50FX51MFTLKQAFPAEYLPQX52DKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLTSKL TVDKSRWQQGNVF SC S VMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 165), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Ala or Lys, X3 is Asn or Leu, X4 is Pro or His, X5 is Phe, Trp, Tyr or Vai, Xe is Lys or Asp, X7 is Lys, Arg, or Glu, Xs is Lys, Ala, Arg, or Glu, X9 is Leu or Met, X10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X12 is Arg or Lys, X13 is Asp or Pro, X14 is Ala, Glu or Lys, X15 is Gly or Asp, Xie is Gin or His, X17 is Gin, Arg, or Lys, Xis is Ala, Cys, He, Ser, Vai, or Leu, X19 is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr, X20 is Ala or Vai, X21 is Cys or Gly, X22 is Arg or Pro, X23 is Ala or Gly, X24 is Arg, He, or Lys, X25 is Gin or Pro, X26 is Arg or Pro, X27 is Ala, Cys, Leu, or Vai, X28 is Ala, Cys, Asn, Ser, or Thr, X29 is Leu, Ala, or Vai, X30 is Glu or Pro, X31 is His or Pro, X32 is Leu, Asp, Asn, or Tyr, X33 is Arg, Ala, Asp, Leu, Gin, or Tyr, X34 is Ala, Cys, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Gin, Arg, Ser, Vai, Trp, or Tyr, X35 is Vai, He, or Lys, X36 is Thr or Ala, X37 is Asp or Gly, X38 is Glu, Lys, or Pro, X39 is Ser or Cys, X40 is Leu, Asp, Phe, Gin, or Thr, X41 is Vai or Phe, X42 is Gin, Ala, His, Phe, Pro, Ser, or Thr, X43 is Cys or Vai, X44 is Trp or Arg, X45 is Ser, Arg, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Thr, Vai, Trp, or Tyr, X46is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Vai, or Tyr, X47 is Lys or Vai, X48 is Ala, Cys, Ser, or Vai, X49 is Cys, Leu, or Vai, X50 is Vai or Arg, X51 is Leu, Gin, His, lie, Lys, or Ser, X52 is GGGGS (SEQ ID NO: 174), GGGGSGGGGS (SEQ ID NO: 162), or EPKSS (SEQ ID NO: 163), and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
[00182] In certain embodiments, the sialidase-Fc fusion protein comprises the amino acid sequence of X1ASLPX2LQX3ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRR GDYDAX4THQVQWQAQEVVAQARLDGHRSMNPCPLYDX5QTGTLFLFFIAIPGQVTE QQQLQTRANVTRLCX6VTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQ LHDRARSLVVPAYAYRKLHPX7QRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQV AEVETGEQRVVTLNARSHLRX8RVQAQSTNDGLDFQESQLVKKLVEPPPX9GCQGSV ISFPSPRSGPGSPAQWLLYTHPTHXioXiiQRADLGAYLNPRPPAPEAWSEPVLLAKGS X12AYSDLQSMGTGPDGSPLFGCLYEANDYEEIX13FX14MFTLKQAFPAEYLPQX15DK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVD GVEVHNAI<TI<PREEQYNSTYRVVSVLTVLHQDWLNGI<EYI<CI<VSNI<ALPAPIEI<TI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLTSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 166), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Vai, or not present, X2 is Phe, Trp, Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, X5 is Ala, Glu, or Lys, Xe is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr, X-is Arg, He, or Lys, Xs is Ala, Cys, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Gin, Arg, Ser, Vai, Trp, or Tyr, X9 is Gin, Ala, His, Phe, Pro, Ser, or Thr, X10 is Ser, Arg, Ala, Asp, Glu, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Pro, Gin, Thr, Vai, Trp, or Tyr, Xu is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Vai, or Tyr, X12 is Ala, Cys, Ser, or Vai, X13 is Vai or Arg, X14 is Leu, Gin, His, lie, Lys, or Ser, X15 is GGGGS (SEQ ID NO: 184), GGGGSGGGGS (SEQ ID NO: 162), or EPKSS (SEQ ID NO: 163), and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1). In certain embodiments, Xi is Ala, Asp, Met, or not present, X2 is Tyr or Vai, X3 is Lys or Asp, X4 is Pro, Asn, Gly, Ser or Thr, X5 is Ala or Glu, Xe is Gin or Tyr, X7 is He or Lys, Xs is Ala or Thr, X9 is Gin, Ala, or Thr, X10 is Ser, Arg, or Ala, Xu is Trp, Lys, or Arg, X12 is Ala or Cys, X13 is Vai or Arg, and X14 is Leu or He. b. Polyethylene Glycol (PEG)
[00183] In one embodiment, the serum half-life extender is polyethylene glycol (PEG) and derivatives thereof (for example, alkoxy polyethylene glycol, for example, methoxypolyethylene glycol, ethoxypolyethylene glycol and the like). In one embodiment, the sialidase as described herein is covalently attached to at least one PEG having an actual MW of at least about 20,000 D. In another embodiment, the sialidase is covalently attached to at least one PEG having an actual MW of at least about 30,000 D. In another embodiment, the sialidase is covalently attached to at least one PEG having an actual MW of at least about 40,000 D. In certain embodiments, the PEG is methoxyPEG(5000)-succinimidylpropionate (mPEG-SPA), methoxyPEG(5000)-succinimidylsuccinate (mPEG-SS). Such PEGS are commercially available from Nektar Therapeutics or SunBiowest or LaysanBio or NOF. In one embodiment, the PEG may be branched, or Y-shaped, as available from JenKem USA or NOF, or comb-shaped, or synthesized by coupling two or more PEGs to a small molecule such as glutamic acid.
[00184] The omega position of PEG may include a hydroxyl group or a methoxy group and the PEG may also contain an amino group in the omega position. Such an amino group can in turn be coupled to a variety of agents. In another embodiment of the present invention, the biological modifier can be a pegylated poly-L-lysine or a pegylated poly-D-lysine.
[00185] Attachment sites on a sialidase for a PEG or a derivative thereof include the N-terminal amino group and epsilon amino groups found on lysine residues, as well as other amino, imino, carboxyl, sulfhydryl, hydroxyl or other hydrophilic groups. PEG may be covalently bonded directly to the sialidase with or without the known use of a multifunctional (ordinarily bifunctional) crosslinking agent using chemistries and used in the art. For example, the PEG modifier can be conjugated to the sialidase by using a thiol reactive cross linker and then reacting with a thiol group on the PEG. In certain embodiments, sulfhydryl groups can be derivatized by coupling to maleimido-substituted PEG (e.g. alkoxy-PEG amine plus sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-l-carboxylate), orPEG-maleimide commercially available from Shearwater Polymers, Inc., Huntsville, Ala.). c. Human Serum Albumin (HSA) and HSA Binders
[00186] Human serum albumin (HSA) (molecular mass ~67 kDa) is the most abundant protein in plasma, present at about 50 mg / mL (600 pM), and has a half-life of around 20 days is humans. HSA serves to maintain plasma pH, contributes to colloidal blood pressure, functions as carrier of many metabolites and fatty acids, and serves as a major drug transport protein in plasma.
[00187] In certain embodiments, the serum half-life extender is human serum albumin (HSA) or an HSA-binding peptide (see, e.g., PCT Publication Nos. WO2013128027A1 and WO2014140358A1). The neonatal Fc receptor (FcRn) appears to be involved in prolonging the life-span of albumin in circulation (see, Chaudhury etaL (2003) J. EXP. MED., 3: 31522). Albumin and IgG bind noncooperatively to distinct sites of FcRn and form a tri-molecular (see id.). Binding of human FcRn to HSA and to human IgG is pH dependent, stronger at acidic pH and weaker at neutral or physiological pH (see id.). This observation suggests that proteins and protein complexes containing albumin, similar to those containing IgG (particularly Fc), are protected from degradation through pH-sensitive interaction with FcRn (see id.). Using surface plasmon resonance (SPR) to measure the capacity of individual HSA domains to bind immobilized soluble human FcRn, it has been shown that FcRn and albumin interact via the D-III domain of albumin in a pH-dependent manner, on a site distinct from the IgG binding site (see, Chaudhury et al. (2006) BlOCHEM. 45:4983-90 and PCT Publication No. WO2008068280A1).
[00188] Exemplary HSA-binding proteins are known in the art. For example, U.S. Patent Application Publication No. US20130316952A1 discloses a polypeptide that binds serum albumin having the amino acid sequence of LKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA (SEQ ID NO: 109). Additional exemplary polypeptides that bind HSA are described in Dennis et al. (2002) J. Biol. Chem., 277: 35035-43; Jacobs etaL (2015) Protein Eng. Des. Sel., 28: 385-93; and Zorzi etaL (2017)Nat. Commun., 8: 16092. III. Linkers
[00189] In certain embodiments, the sialidase can be linked or fused directly to the serum half-life extender. In other embodiments, the sialidase can be covalently bound to the serum half-life extender by a linker.
[00190] The linker may couple, with one or more natural amino acids, the sialidase, or functional fragment thereof, and the serum half-life extender, where the one or more natural amino acids (for example, a cysteine amino acid) may be introduced by site-directed mutagenesis. The linker may include one or more unnatural amino acids. It is contemplated that, in certain circumstances, a linker containing for example, one or more sulfhydryl reactive groups (e.g., a maleimide) may covalently link a cysteine in the sialidase or the serum half-life extender that is a naturally occurring cysteine residue or is the product of sitespecific mutagenesis.
[00191] The linker may be a cleavable linker or a non-cleavable linker. Optionally or in addition, the linker may be a flexible linker or an inflexible linker.
[00192] The linker should be a length sufficiently long to allow the sialidase and the serum half-life extender to be linked without steric hindrance from one another and sufficiently short to retain the intended activity of the fusion protein. The linker preferably is sufficiently hydrophilic to avoid or minimize instability of the fusion protein. The linker preferably is sufficiently hydrophilic to avoid or minimize insolubility of the fusion protein. The linker should be sufficiently stable in vivo (e.g., it is not cleaved by serum, enzymes, etc.) to permit the fusion protein to be operative in vivo.
[00193] The linker may be from about 1 angstroms (A) to about 150 A in length, or from about 1 A to about 120 A in length, or from about 5 A to about 110 A in length, or from about 10 A to about 100 A in length. The linker may be greater than about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 27, 30 or greater angstroms in length and / or less than about 110, 100, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, or fewer A in length. Furthermore, the linker may be about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, and 120 A in length.
[00194] In certain embodiments, the linker comprises a polypeptide linker that connects or fuses the sialidase to the serum half-life extender (e.g., Fc domain) of the fusion protein. For example, it is contemplated that a gene encoding a sialidase linked directly or indirectly (for example, via an amino acid containing linker) to a serum half-life extender can be created and expressed using conventional recombinant DNA technologies. For example, the amino terminus of a sialidase can be linked to the carboxy terminus of a serum half-life extender. When a linker is employed, the linker may comprise hydrophilic amino acid residues, such as Gin, Ser, Gly, Glu, Pro, His and Arg. In certain embodiments, the linker is a peptide containing 1-25 amino acid residues, 1-20 amino acid residues, 2-15 amino acid residues, 310 amino acid residues, 3-7 amino acid residues, 4-25 amino acid residues, 4-20 amino acid residues, 4-15 amino acid residues, 4-10 amino acid residues, 5-25 amino acid residues, 5-20 amino acid residues, 5-15 amino acid residues, or 5-10 amino acid residues. Exemplary linkers include glycine and serine-rich linkers, e.g., (GlyGlyPro)n,(SEQ ID NO: 110) or (GlyGlyGlyGlySer)n, (SEQ ID NO: 111) where n is 1-5. In certain embodiments, the linker comprises, consists, or consists essentially of GGGGS (SEQ ID NO: 174). In certain embodiments, the linker comprises, consists, or consists essentially of GGGGSGGGGS (SEQ ID NO: 162). In certain embodiments, the linker comprises, consists, or consists essentially of EPKSS (SEQ ID NO: 163). Additional exemplary linker sequences are disclosed, e.g., in George et al. (2003) Protein Engineering 15:871-879, and U.S. Patent Nos. 5,482,858 and 5,525,491. IV. Methods of Making a Sialidase and / or a Sialidase Conjugated to a Serum Half-life Enhancer
[00195] Methods for producing a sialidase or a sialidase conjugated to a serum half-life enhancer e.g., those disclosed herein, are known in the art. For example, DNA molecules encoding a serum half-life enhancer (e.g., an Fc domain) can be synthesized chemically or by recombinant DNA methodologies. For example, the sequences of the serum half-life enhancer can be cloned by conventional hybridization techniques or polymerase chain reaction (PCR) techniques, using the appropriate synthetic nucleic acid primers. The resulting DNA molecules encoding the protein of interest can be ligated to other appropriate nucleotide sequences, including, for example, expression control sequences, to produce conventional gene expression constructs (i.e., expression vectors) encoding the desired serum half-life enhancer. Production of defined gene constructs is within routine skill in the art.
[00196] Nucleic acids encoding desired sialidases can be incorporated (ligated) into expression vectors, which can be introduced into host cells through conventional transfection or transformation techniques. Exemplary host cells are E. coli cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK 293) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and myeloma cells that do not otherwise produce IgG protein. Transformed host cells can be grown under conditions that permit the host cells to express the sialidase.
[00197] Specific expression and purification conditions will vary depending upon the expression system employed. For example, if a gene is to be expressed in E. coli, it is first cloned into an expression vector by positioning the engineered gene downstream from a suitable bacterial promoter, e.g., Trp or Tac, and a prokaryotic signal sequence. The expressed protein may be secreted. The expressed protein may accumulate in refractile or inclusion bodies, which can be harvested after disruption of the cells by French press or sonication. The refractile bodies then are solubilized, and the protein may be refolded and / or cleaved by methods known in the art.
[00198] If the engineered gene is to be expressed in eukaryotic host cells, e.g., CHO cells, it is first inserted into an expression vector containing a suitable eukaryotic promoter, a secretion signal, a poly A sequence, and a stop codon. Optionally, the vector or gene construct may contain enhancers and introns. The gene construct can be introduced into eukaryotic host cells using conventional techniques.
[00199] A polypeptide comprising a sialidase or a fusion protein, e.g., a fusion protein comprising an immunoglobulin heavy chain variable region or light chain variable region, can be produced by growing (culturing) a host cell transfected with an expression vector encoding such a variable region, under conditions that permit expression of the polypeptide. Following expression, the polypeptide can be harvested and purified or isolated using techniques known in the art, e.g., affinity tags such as glutathione-S-transferase (GST) or histidine tags.
[00200] In embodiments in which a sialidase or sialidase conjugated to an Fc region, can be produced by growing (culturing) a host cell transfected with: (a) an expression vector that encodes a one Fc polypeptide, and a separate expression vector that encodes another Fc polypeptide; or (b) a single expression vector that encodes both Fc polypeptides, under conditions that permit expression of both polypeptides. The sialidase will be fused to one or more of the polypeptides. The intact sialidase-Fc domain fusion protein can be harvested and purified or isolated using techniques known in the art, e.g., Protein A, Protein G, affinity tags such as glutathione-S-transferase (GST) or histidine tags.
[00201] In certain embodiments, a sialidase or a sialidase conjugated to a serum half-life extender is expressed and / or purified in the presence of a stabilizing agent. The stabilizing agent prevents one or more of protein unfolding, protein misfolding, protein aggregation, protein inhibition, enzymatic loss and / or protein degradation of the sialidase or the sialidase conjugated to a serum half-life extender during expression, purification and / or storage. In certain embodiments, the stabilizing agent is a cation, such as a divalent cation. In certain embodiments, the cation is calcium or magnesium. The cation can be in the form of a salt, such as calcium chloride (CaCh) or magnesium chloride (MgCh).
[00202] In certain embodiments, the stabilizing agent is present in an amount from about 0.05 mM to about 5 mM during expression and / or purification. For example, the stabilizing agent may be present in an amount of from about 0.05 mM to about 4 mM, from about 0.05 mM to about 3 mM, from about 0.05 mM to about 2 mM, from about 0.05 mM to about 1 mM, from about 0.05 mM to about 0.5 mM, from about 0.5 mM to about 4 mM, from about 0.5 mM to about 3 mM, from about 0.5 mM to about 2 mM, from about 0.5 mM to about 1 mM, from about 1 mM to about 4 mM, from about 1 mM to about 3 mM, of from about 1 mM to about 2 mM.
[00203] In certain embodiments, in order to express a protein, e.g., a sialidase, as a secreted protein, a native N-terminal signal sequence of the protein is replaced, e.g., with MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28). In certain embodiments, to express a protein, e.g., a recombinant human sialidase, as a secreted protein, an N-terminal signal sequence, e.g., MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28), is added. Additional exemplary N-terminal signal sequences include signal sequences from interleukin-2, CD-5, IgG kappa light chain, trypsinogen, serum albumin, and prolactin. In certain embodiments, in order to express a protein, e.g., a recombinant human sialidase, as a secreted protein, a C terminal lysosomal signal motif, e.g., YGTL (SEQ ID NO: 29) is removed.
[00204] In certain embodiments, when a sialidase is chemically conjugated to a serum halflife extender, the chemical conjugation can be performed using methods known in the art. Attachment sites on a sialidase and / or a serum half-life extender include the N-terminal amino group and epsilon amino groups found on lysine residues, as well as other amino, imino, carboxyl, sulfhydryl, hydroxyl or other hydrophilic groups. A serum half-life extender may be covalently bonded directly to the sialidase with or without the known use of a multifunctional (ordinarily bifunctional) crosslinking agent using chemistries and used in the art. For example, in the case of PEG, sulfhydryl groups can be derivatized by coupling to maleimido-substituted PEG (e.g. alkoxy-PEG amine plus sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-l-carboxylate), or PEG-maleimide commercially available from Shearwater Polymers, Inc., Huntsville, Ala.). V. Pharmaceutical Compositions
[00205] For therapeutic use, a sialidase or sialidase conjugated to a half-life extender preferably is combined with a pharmaceutically acceptable carrier. The term “pharmaceutically acceptable” as used herein refers to those compounds, materials, compositions, and / or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit / risk ratio.
[00206] The term “pharmaceutically acceptable carrier” as used herein refers to buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit / risk ratio. Pharmaceutically acceptable carriers include any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g., such as an oil / water or water / oil emulsions), and various types of wetting agents. The compositions also can include stabilizers and preservatives. For examples of carriers, stabilizers and adjuvants, see, e.g., Martin, Remington’s Pharmaceutical Sciences, 15th Ed., Mack Publ. Co., Easton, PA
[1975] , Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art.
[00207] In certain embodiments, a pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition. In such embodiments, suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate, triton, tromethamine, lecithin, cholesterol, tyloxapal); stability enhancing / stabilizing agents (such as sucrose, sorbitol, or a cation); tonicity enhancing agents (such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol); delivery vehicles; diluents; excipients and / or pharmaceutical adjuvants (see, Remington’s Pharmaceutical Sciences, 18th ed. (Mack Publishing Company, 1990).
[00208] In certain embodiments, a pharmaceutical composition may contain a stabilizing agent. In certain embodiments, the stabilizing agent is a cation, such as a divalent cation. In certain embodiments, the cation is calcium or magnesium. The cation can be in the form of a salt, such as calcium chloride (CaCh) or magnesium chloride (MgCh).
[00209] In certain embodiments, the stabilizing agent is present in an amount from about 0.05 mM to about 5 mM. For example, the stabilizing agent may be present in an amount of from about 0.05 mM to about 4 mM, from about 0.05 mM to about 3 mM, from about 0.05 mM to about 2 mM, from about 0.05 mM to about 1 mM, from about 0.05 mM to about 0.5 mM, from about 0.5 mM to about 4 mM, from about 0.5 mM to about 3 mM, from about 0.5 mM to about 2 mM, from about 0.5 mM to about 1 mM, from about 1 mM to about 4 mM, from about 1 mM to about 3 mM, of from about 1 mM to about 2 mM.
[00210] In certain embodiments, a pharmaceutical composition may contain nanoparticles, e.g., polymeric nanoparticles, liposomes, or micelles (See Anselmo etaL (2016) Bioeng. Transl.Med. 1: 10-29).
[00211] In certain embodiments, a pharmaceutical composition may contain a sustained- or controlled-delivery formulation. Techniques for formulating sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art. Sustained-release preparations may include, e.g., porous polymeric microparticles or semipermeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules. Sustained release matrices may include polyesters, hydrogels, polylactides, copolymers of L-glutamic acid and gamma ethyl-L-glutamate, poly (2-hydroxyethyl-inethacrylate), ethylene vinyl acetate, or poly-D(-)-3-hy dr oxybutyric acid. Sustained release compositions may also include liposomes that can be prepared by any of several methods known in the art.
[00212] Pharmaceutical compositions containing a sialidase or sialidase conjugated to a half-life extender can be presented in a dosage unit form and can be prepared by any suitable method. A pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, intrathecal and rectal administration. In certain embodiments, a sialidase or sialidase conjugated to a half-life extender is administered by IV infusion. In certain embodiments, a sialidase or sialidase conjugated to a half-life extender is administered by intratumoral injection. Useful formulations can be prepared by methods known in the pharmaceutical art. For example, see Remington’s Pharmaceutical Sciences, 18th ed. (Mack Publishing Company, 1990). Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
[00213] For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS). The carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof.
[00214] Pharmaceutical formulations preferably are sterile. Sterilization can be accomplished by any suitable method, e.g., filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution.
[00215] In certain embodiments, the pharmaceutical composition is disposed in a sterile container (e.g., bottle or vial). The pharmaceutical composition can be, for example, lyophilized or present as a solution in the sterile container. The sterile container can be sealed with a septum and can have a label disposed thereon identifying the pharmaceutical composition contained in the container.
[00216] The compositions described herein may be administered locally or systemically. Administration will generally be parenteral administration. In a preferred embodiment, the pharmaceutical composition is administered subcutaneously and in an even more preferred embodiment intravenously. Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
[00217] Generally, a therapeutically effective amount of active component, for example, a sialidase or sialidase conjugated to a half-life extender, is in the range of 0.1 mg / kg to 100 mg / kg, e.g., 1 mg / kg to 100 mg / kg, 1 mg / kg to 10 mg / kg. The amount administered will depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the active component, the pharmaceutical formulation, and the route of administration. The initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue-level. Alternatively, the initial dosage can be smaller than the optimum, and the daily dosage may be progressively increased during the course of treatment. Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from 0.5 mg / kg to 20 mg / kg. Dosing frequency can vary, depending on factors such as route of administration, dosage amount, serum half-life of the sialidase or sialidase conjugated to a half-life extender, and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks. A preferred route of administration is parenteral, e.g., intravenous infusion. In certain embodiments, a sialidase or sialidase conjugated to a halflife extender is lyophilized, and then reconstituted in buffered saline, at the time of administration. VI. Therapeutic Uses
[00218] The compositions and methods disclosed herein can be used to treat various forms of cancer in a subject or inhibit cancer growth in a subject. The invention provides a method of treating a cancer in a subject. The method comprises administering to the subject an effective amount of a sialidase or sialidase conjugated to a half-life extender either alone or in a combination with another therapeutic agent to treat the cancer in the subject. The term “effective amount” as used herein refers to the amount of an active agent (e.g., sialidase or sialidase conjugated to a half-life extender according to the present invention) sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
[00219] As used herein, “treat”, “treating” and “treatment” mean the treatment of a disease in a subject, e.g., in a human. This includes: (a) inhibiting the disease, i.e., arresting its development; and (b) relieving the disease, i.e., causing regression of the disease state. As used herein, the terms “subject” and “patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably includes humans.
[00220] Examples of cancers include solid tumors, soft tissue tumors, hematopoietic tumors and metastatic lesions. Examples of hematopoietic tumors include, leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), B-cell, T-cell or FAB ALL, acute myeloid leukemia (AML), chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), e.g., transformed CLL, diffuse large B-cell lymphomas (DLBCL), follicular lymphoma, hairy cell leukemia, myelodyplastic syndrome (MDS), a lymphoma, Hodgkin’s disease, a malignant lymphoma, non-Hodgkin’s lymphoma, Burkitt’s lymphoma, multiple myeloma, or Richter’s Syndrome (Richter’s Transformation). Examples of solid tumors include malignancies, e.g., sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting head and neck (including pharynx), thyroid, lung (small cell or non-small cell lung carcinoma (NSCLC)), breast, lymphoid, gastrointestinal (e.g., oral, esophageal, stomach, liver, pancreas, small intestine, colon and rectum, anal canal), genitals and genitourinary tract (e.g., renal, urothelial, bladder, ovarian, uterine, cervical, endometrial, prostate, testicular), CNS (e.g., neural or glial cells, e.g., neuroblastoma or glioma), or skin (e.g., melanoma).
[00221] In certain embodiments the cancer is an epithelial cancer, e.g., an epithelial cancer that upregulates the expression of sialylated glycans. Exemplary epithelial cancers include, but are not limited to, endometrial cancer, colon cancer, ovarian cancer, cervical cancer, vulvar cancer, uterine cancer or fallopian tube cancer, breast cancer, prostate cancer, lung cancer, pancreatic cancer, urinary cancer, bladder cancer, head and neck cancer, oral cancer and liver cancer. Epithelial cancers also include carcinomas, for example, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, baso squamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiermoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatinifomi carcinoma, gelatinous carcinoma, giant cell carcinoma, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypemephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher’s carcinoma, Kulchitzky-cell carcinoma, large-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma medullare, medullary carcinoma, melanotic carcinoma, carcinoma molle, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma myxomatodes, nasopharyngeal carcinoma, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prickle cell carcinoma, pultaceous carcinoma, renal cell carcinoma of kidney, reserve cell carcinoma, carcinoma sarcomatodes, Schneiderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, and carcinoma villosum.
[00222] In certain embodiments, the cancer is breast cancer. In certain embodiments, the cancer is an adenocarcinoma. In certain embodiments, the cancer is a metastatic cancer. In certain embodiments, the cancer is a refractory cancer.
[00223] In certain embodiments, the cancer is resistant to or non-responsive to treatment with an antibody, e.g, an antibody with ADCC activity, e.g, trastuzumab.
[00224] The methods and compositions described herein can be used alone or in combination with other therapeutic agents and / or modalities. The term administered “in combination,” as used herein, is understood to mean that two (or more) different treatments are delivered to the subject during the course of the subject’s affliction with the disorder, such that the effects of the treatments on the patient overlap at a point in time. In certain embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous” or “concurrent delivery.” In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In certain embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In certain embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
[00225] In certain embodiments, a method or composition described herein, is administered in combination with one or more additional therapies, e.g., surgery, radiation therapy, or administration of another therapeutic preparation. In certain embodiments, the additional therapy may include chemotherapy, e.g., a cytotoxic agent. In certain embodiments the additional therapy may include a targeted therapy, e.g. a tyrosine kinase inhibitor, a proteasome inhibitor, or a protease inhibitor. In certain embodiments, the additional therapy may include an anti-inflammatory, anti-angiogenic, anti-fibrotic, or anti-proliferative compound, e.g., a steroid, a biologic immunomodulator, a monoclonal antibody, an antibody fragment, an aptamer, an siRNA, an antisense molecule, a fusion protein, a cytokine, a cytokine receptor, a bronchodilator, a statin, an anti-inflammatory agent (e.g. methotrexate), or an NSAID. In certain embodiments, the additional therapy may include a combination of therapeutics of different classes.
[00226] In certain embodiments, a method or composition described herein is administered in combination with a checkpoint inhibitor. The checkpoint inhibitor may, for example, be selected from a PD-1 antagonist, PD-L1 antagonist, CTLA-4 antagonist, adenosine A2A receptor antagonist, B7-H3 antagonist, B7-H4 antagonist, BTLA antagonist, KIR antagonist, LAG3 antagonist, TIM-3 antagonist, VISTA antagonist or TIGIT antagonist.
[00227] In certain embodiments, the checkpoint inhibitor is a PD-1 or PD-L1 inhibitor. PD-1 is a receptor present on the surface of T-cells that serves as an immune system checkpoint that inhibits or otherwise modulates T-cell activity at the appropriate time to prevent an overactive immune response. Cancer cells, however, can take advantage of this checkpoint by expressing ligands, for example, PD-L1, that interact with PD-1 on the surface of T-cells -72- to shut down or modulate T-cell activity. Exemplary PD-1 / PD-L1 based immune checkpoint inhibitors include antibody based therapeutics. Exemplary treatment methods that employ PD-1 / PD-L1 based immune checkpoint inhibition are described in U.S. Patent Nos. 8,728,474 and 9,073,994, and EP Patent No. 1537878B1, and, for example, include the use of anti-PD-1 antibodies. Exemplary anti-PD-1 antibodies are described, for example, in U.S. Patent Nos. 8,952,136, 8,779,105, 8,008,449, 8,741,295, 9,205,148, 9,181,342, 9,102,728, 9,102,727, 8,952,136, 8,927,697, 8,900,587, 8,735,553, and 7,488,802. Exemplary anti-PD-1 antibodies include, for example, nivolumab (Opdivo®, Bristol-Myers Squibb Co.), pembrolizumab (Keytruda®, Merck Sharp & Dohme Corp.), PDR001 (Novartis Pharmaceuticals), and pidilizumab (CT-011, Cure Tech). Exemplary anti-PD-Ll antibodies are described, for example, in U.S. Patent Nos. 9,273,135, 7,943,743, 9,175,082, 8,741,295, 8,552,154, and 8,217,149. Exemplary anti-PD-Ll antibodies include, for example, atezolizumab (Tecentriq®, Genentech), durvalumab (AstraZeneca), MEDI4736, avelumab, and BMS 936559 (Bristol Myers Squibb Co.).
[00228] In certain embodiments, a method or composition described herein is administered in combination with a CTLA-4 inhibitor. In the CTLA-4 pathway, the interaction of CTLA-4 on a T-cell with its ligands (e.g., CD80, also known as B7-1, and CD86) on the surface of an antigen presenting cells (rather than cancer cells) leads to T-cell inhibition. Exemplary CTLA-4 based immune checkpoint inhibition methods are described in U.S. Patent Nos. 5,811,097, 5,855,887, 6,051,227. Exemplary anti-CTLA-4 antibodies are described in U.S. Patent Nos. 6,984,720, 6,682,736, 7,311,910; 7,307,064, 7,109,003, 7,132,281, 6,207,156, 7,807,797, 7,824,679, 8,143,379, 8,263,073, 8,318,916, 8,017,114, 8,784,815, and 8,883,984, International (PCT) Publication Nos. WO98 / 42752, WO00 / 37504, and WO01 / 14424, and European Patent No. EP 1212422 BL Exemplary CTLA-4 antibodies include ipilimumab or tremelimumab.
[00229] In certain embodiments, a method or composition described herein is administered in combination with (i) a PD-1 or PD-L1 inhibitor, e.g., a PD-1 or PD-L1 inhibitor disclosed herein, and (ii) CTLA-4 inhibitor, e.g., a CTLA-4 inhibitor disclosed herein.
[00230] In certain embodiments, a method or composition described herein is administered in combination with a CD20 inhibitor. In certain embodiments, the CD20 inhibitor is an anti-CD20 antibody. In certain embodiments, the anti-CD20 antibody is selected from the group consisting of ofatumumab, rituximab, ocrelizumab, iodine 1131 tositumomab, obinutuzumab, ibritumomab, and hyaluronidase ritixumab.
[00231] In certain embodiments, a method or composition described herein is administered in combination with an IDO inhibitor. Exemplary IDO inhibitors include 1 -methyl-D-tryptophan (known as indoximod), epacadostat (INCB24360), navoximod (GDC-0919), and BMS-986205.
[00232] Exemplary cytotoxic agents that can be administered in combination with a method or composition described herein include, for example, antimicrotubule agents, topoisomerase inhibitors, antimetabolites, protein synthesis and degradation inhibitors, mitotic inhibitors, alkylating agents, platinating agents, inhibitors of nucleic acid synthesis, histone deacetylase inhibitors (HDAC inhibitors, e.g., vorinostat (SAHA, MK0683), entinostat (MS-275), panobinostat (LBH589), trichostatin A (TSA), mocetinostat (MGCD0103), belinostat (PXD101), romidepsin (FK228, depsipeptide)), DNA methyltransferase inhibitors, nitrogen mustards, nitrosoureas, ethylenimines, alkyl sulfonates, triazenes, folate analogs, nucleoside analogs, ribonucleotide reductase inhibitors, vinca alkaloids, taxanes, epothilones, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis and radiation, or antibody molecule conjugates that bind surface proteins to deliver a toxic agent. In one embodiment, the cytotoxic agent that can be administered with a method or composition described herein is a platinum-based agent (such as cisplatin), cyclophosphamide, dacarbazine, methotrexate, fluorouracil, gemcitabine, capecitabine, hydroxyurea, topotecan, irinotecan, azacytidine, vorinostat, ixabepilone, bortezomib, taxanes (e.g., paclitaxel or docetaxel), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, vinorelbine, col chicin, anthracyclines (e.g., doxorubicin or epirubicin) daunorubicin, dihydroxy anthracin di one, mitoxantrone, mithramycin, actinomycin D, adriamycin, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, ricin, or maytansinoids.
[00233] The invention also provides a method of increasing the expression of granzyme B, IL-lb, IL-2, IL-6, IL-10, IL-17A, HLA-DR, CD86, CD83, IFNy, or TNFa in a cell, tissue, or subject. The method comprises contacting the cell, tissue, or subject with an effective amount of a sialidase or sialidase conjugated to a half-life extender so as to increase the expression of granzyme B, IL-lb, IL-2, IL-6, IL-10, IL-17A, HLA-DR, CD86, CD83, TFNy, or TNFa in a cell, tissue, or subject relative the corresponding expression level prior to contact with the sialidase or sialidase conjugated to the half-life extender. In certain embodiments, the cell is selected from a dendritic cell and a peripheral blood mononuclear cell (PBMC, e.g., a monocyte).
[00234] In certain embodiments, expression of granzyme B, IL-lb, IL-2, IL-6, IL-10, IL-17A, HLA-DR, CD86, CD83, IFNy, or TNFa in the cell, tissue, or subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell or tissue that has not been contacted with the sialidase or sialidase conjugated to a half-life extender. Gene expression may be measured by any suitable method known in the art, for example, by ELISA, by Luminex multiplex assays, or by flow cytometry as described in the examples herein.
[00235] The invention also provides a method of removing sialic acid from a cell or tissue. The method comprises contacting the cell or tissue with an effective amount of a sialidase or sialidase conjugated to a half-life extender. The invention also provides a method of removing sialic acid from a cell in a subject, the method comprising administering to the subject an effective amount of a pharmaceutical composition comprising a sialidase or sialidase conjugated to a half-life extender thereby to remove sialic acid from the cell.
[00236] In certain embodiments, the cell is tumor cell, dendritic cell (DC) or monocyte. In certain embodiments, the cell is a monocyte, and the method results in increased expression of an MHC-II molecule (e.g., HLA-DR) on the monocyte. In certain embodiments, expression of an MHC-II molecule in the cell or tissue is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell or tissue that has not been contacted with the sialidase or sialidase conjugated to a half-life extender. Gene expression may be measured by any suitable method known in the art, for example, by ELISA, by Luminex multiplex assays, or by flow cytometry as described in the examples herein.
[00237] The invention also provides a method of increasing phagocytosis of a tumor cell. The method comprises contacting the tumor cell with a sialidase or sialidase conjugated to a half-life extender in an amount effective to remove sialic acid from the tumor cell, thereby increasing phagocytosis of the tumor cell. In certain embodiments, the disclosure relates to a method of increasing phagocytosis of a tumor cell in a subject, the method comprising administering to the subject an effective amount of a pharmaceutical composition comprising a sialidase or sialidase conjugated to a half-life extender in an amount effective to remove sialic acid from the tumor cell, thereby increasing phagocytosis of the tumor cell.
[00238] In certain embodiments, phagocytosis is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical tumor cell or population of tumor cells that has not or have not been contacted with the sialidase or sialidase conjugated to a half-life extender. Phagocytosis may be measured as described in Example 9 herein.
[00239] The invention also provides a method of activating a dendritic cell (DC) or a population of DCs. The method comprises contacting the DC or population of DCs with a tumor cell that has been treated with a sialidase or sialidase conjugated to a half-life extender. In certain embodiments, the disclosure relates to a method of activating a dendritic cell (DC) or a population of DCs in a subject, the method comprising administering to the subject an amount of a pharmaceutical composition comprising a sialidase or sialidase conjugated to a half-life extender effective to remove sialic acid from a tumor cell in the subject, thereby to activate the DC or the population of DCs in the subject.
[00240] In certain embodiments, activation of the DC or a population of DCs is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical DC or population of DCs that has not or have not been contacted with a tumor cell that has been treated with the sialidase or sialidase conjugated to a half-life extender. Activation may be measured as described in Example 8 herein.
[00241] The invention also provides a method of reducing Siglec-15 binding activity, thereby increasing anti-tumor activity in a tumor microenvironment, the method comprising contacting a T cell with a sialidase or sialidase conjugated to a half-life extender. In certain embodiments, the disclosure relates to a method of reducing Siglec-15 binding activity, thereby increasing anti-tumor activity in a tumor microenvironment of a patient, the method comprising administering to the subject an effective amount of a pharmaceutical composition comprising a sialidase or sialidase conjugated to a half-life extender, thereby increasing antitumor activity (e.g., T cell activity) in the subject.
[00242] In certain embodiments, Siglec-15 binding activity is reduced by at least about 10%, at least about 20%, at least about 50%, at least about 75%, or about 100%, relative to Siglec-15 that has not been contacted with the sialidase or sialidase conjugated to a half-life extender. Binding may be measured as described in Example 16 herein.
[00243] The invention also provides a method of promoting infiltration of immune cells into a tumor in a subject in need thereof. The method comprises administering to the subject an effective amount of a sialidase or sialidase conjugated to a half-life extender, e.g., a sialidase or sialidase conjugated to a half-life extender disclosed herein. In certain embodiments, the immune cells are T-cells, e.g., CD4+ and / or CD8+ T-cells, e.g., CD69+CD8+ and / or GzmB+CD8+ T-cells. In certain embodiments, the immune cells are natural killer (NK) cells.
[00244] In certain embodiments, the infiltration of immune cells into the tumor in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical tumor and / or subject that has not been administered the sialidase or sialidase conjugated to a half-life extender. Infiltration of immune cells into a tumor may be measured by any suitable method known in the art, for example, antibody staining.
[00245] The invention also provides a method of increasing the number of circulating natural killer (NK) cells in a subject in need thereof. The method comprises administering to the subject an effective amount of a sialidase or sialidase conjugated to a half-life extender, e.g., a sialidase or sialidase conjugated to a half-life extender disclosed herein, so as to increase the number of circulating NK cells relative to prior to administration of the sialidase or sialidase conjugated to a half-life extender or pharmaceutical composition.
[00246] In certain embodiments, the number of circulating NK cells in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical subject that has not been administered the sialidase or sialidase conjugated to a half-life extender. Circulating NK cells in a subject may be measured by any suitable method known in the art, for example, antibody staining.
[00247] The invention also provides a method of increasing the number of T-cells in the draining lymph node in a subject in need thereof. The method comprises administering to the subject an effective amount of a sialidase or sialidase conjugated to a half-life extender, e.g., a sialidase or sialidase conjugated to a half-life extender disclosed herein, so as to increase the number of T-cells in the draining lymph node relative to prior to administration of the sialidase or sialidase conjugated to a half-life extender or pharmaceutical composition. In certain embodiments, the immune cells are T-cells, e.g., CD4+ and / or CD8+ T-cells.
[00248] In certain embodiments, the number of T-cells in the draining lymph node in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical subject that has not been administered the sialidase or sialidase conjugated to a half-life extender. T-cells in the draining lymph node in a subject may be measured by any suitable method known in the art, for example, antibody.
[00249] The invention also provides a method of increasing expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcdl, Lag3,116, Illb, 112, Ifng, Ifnal, Mxl, Gzmb, Cxcl9, Cxcll2, and / or Ccl5 in a cell, tissue, or subject. The method comprises contacting the cell, tissue, or subject with an effective amount of a sialidase or sialidase conjugated to a half-life extender, e.g., a sialidase or sialidase conjugated to a half-life extender disclosed herein, so as to increase the expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcdl, Lag3,116, Illb, 112, Ifng, Ifnal, Mxl, Gzmb, Cxcl9, Cxcll2, and / or Ccl5 relative to the cell, tissue or subject prior to contact with the sialidase or sialidase conjugated to a half-life extender or pharmaceutical composition.
[00250] In certain embodiments, expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcdl, Lag3,116, Illb, 112, Ifng, Ifnal, Mxl, Gzmb, Cxcl9, Cxcll2, and / or Ccl5 in the cell, tissue, or subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell, tissue, or subject that has not been contacted with the sialidase or sialidase conjugated to a half-life extender. Gene expression may be measured by any suitable method known in the art, for example, by ELISA, Luminex multiplex assays, or Nanostring technology.
[00251] Throughout the description, where compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
[00252] In the application, where an element or component is said to be included in and / or selected from a list of recited elements or components, it should be understood that the element or component can be any one of the recited elements or components, or the element or component can be selected from a group consisting of two or more of the recited elements or components.
[00253] Further, it should be understood that elements and / or features of a composition or a method described herein can be combined in a variety of ways without departing from the spirit and scope of the present invention, whether explicit or implicit herein. For example, where reference is made to a particular compound, that compound can be used in various embodiments of compositions of the present invention and / or in methods of the present invention, unless otherwise understood from the context. In other words, within this application, embodiments have been described and depicted in a way that enables a clear and concise application to be written and drawn, but it is intended and will be appreciated that embodiments may be variously combined or separated without parting from the present teachings and invention(s). For example, it will be appreciated that all features described and depicted herein can be applicable to all aspects of the invention(s) described and depicted herein.
[00254] It should be understood that the expression “at least one of’ includes individually each of the recited objects after the expression and the various combinations of two or more of the recited objects unless otherwise understood from the context and use. The expression “and / or” in connection with three or more recited objects should be understood to have the same meaning unless otherwise understood from the context.
[00255] The use of the term “include,” “includes,” “including,” “have,” “has,” “having,” “contain,” “contains,” or “containing,” including grammatical equivalents thereof, should be understood generally as open-ended and non-limiting, for example, not excluding additional unrecited elements or steps, unless otherwise specifically stated or understood from the context.
[00256] Where the use of the term “about” is before a quantitative value, the present invention also includes the specific quantitative value itself, unless specifically stated otherwise. As used herein, the term “about” refers to a ±10% variation from the nominal value unless otherwise indicated or inferred.
[00257] It should be understood that the order of steps or order for performing certain actions is immaterial so long as the present invention remain operable. Moreover, two or more steps or actions may be conducted simultaneously.
[00258] The use of any and all examples, or exemplary language herein, for example, “such as” or “including,” is intended merely to illustrate better the present invention and does not pose a limitation on the scope of the invention unless claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the present invention. EXAMPLES Example 1: Construction and expression of recombinant sialidases
[00259] This example describes the construction of recombinant human sialidases (Neul, Neu2, Neu3, and Neu4). The human sialidases Neul, Neu2, Neu3 (isoform 1), and Neu4 (isoform 1) were expressed as secreted proteins with a lOxHis tag.
[00260] To express Neul as a secreted protein, the native N terminal signal peptide (MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKA; SEQ ID NO: 27) was replaced by MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28), and the C terminal lysosomal signal motif (YGTL; SEQ ID NO: 29) was removed. To express Neu2, Neu3, and Neu4 as secreted proteins, the N terminal signal peptide MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28) was added to each.
[00261] Sialidases were expressed in a 200 mL transfection of HEK293F human cells in 24-well plates using the pCEP4 mammalian expression vector. Sialidases were purified using Ni-NTA columns, quantified with a UV-Vis spectrophotometer (NanoDrop), and examined by SDS-PAGE as shown in FIGURE 2. Neul expressed well, with a yield of-3 pg / ml, and was present primarily in a monomeric form. Neu2 and Neu3 expression each gave yields of -0.15 pg / mL and each were present primarily in a dimeric form. Neu4 had no detectable expression yield as measured by NanoDrop. Bacterial sialidase from Salmonella typhimurium (bacterial-sialidase; SEQ ID NO: 30) was expressed in the same manner as Neul-4 (above) and gave a comparable yield to Neul, and was present primarily in a monomeric form.
[00262] The activity of the recombinantly expressed sialidases was assayed by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc). As shown in FIGURE 3, Neul has no detectable activity beyond a no-enzyme control, which is consistent with previous reports indicating that Neul is inactive unless it is in complex with beta-galactosidase and protective protein / cathepsin A (PPCA). Neu2 and Neu3 were active, as was the bacterial sialidase. An enzyme kinetics assay was performed with Neu2 and Neu3. A fixed concentration of enzyme at 1 nM was incubated with fluorogenic substrate 4MU-NeuAc at concentrations ranging from 4000 pM to 7.8 pM. Assays were conducted at both acidic (pH 5.6) and neutral (pH 7) conditions. As shown in FIGURE 4, both Neu2 and Neu3 were active at acidic and neutral conditions and showed enzyme kinetics that were comparable to those previously reported. Example 2: Construction and expression of recombinant sialidase-Fc fusion proteins
[00263] This example describes the construction of recombinant Fc sialidase genetic fusions. In particular, Neu2-Fc, Neu3-Fc and ST sialidase-Fc.
[00264] Fc-sialidases utilizing wild type Neu2 (Neu2-Fc; SEQ ID NO:113, encoded by SEQ ID NO: 114) and a variant Fc-Sialidase designated M106 (SEQ ID NO: 115, encoded by SEQ ID NO: 116) (MID, V6Y, P62G, A93E, I187K, C332A, and human IgGl Fc with hole (Y407T) mutation) were expressed, purified and characterized. The Neu2-Fc molecules were expressed in a IL transfection of Expi293 human cells in using the pCEP4 mammalian expression vector. Neu2-Fc was purified using Protein A, followed by cation exchange chromatography (Hitrap SP-HP, GE Lifesciences). Neu2-Fc had a yield of 0.3 mg / liter, and Ml06 had a yield of 20 mg / liter.
[00265] FIGURE 5A depicts an SDS-PAGE gel showing recombinant wildtype human Neu2-Fc and M106 under non-reducing and reducing conditions. FIGURES 5B-C shows SEC-HPLC traces comparing wildtype Neu2-Fc versus Ml06. Monomer species have a retention time of 21 mins. Neu2-Fc (FIGURE 5B) had an SEC monomer purity of 7% and Ml06 (FIGURE 5C) had an SEC monomer purity of 85%.
[00266] The activity of Ml 06 was assayed by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc). An enzyme kinetics assay was performed using a fixed concentration of enzyme at 2pg / well was incubated with fluorogenic substrate 4MU-NeuAc at concentrations ranging from 4mM to 0.03pM. FIGURE 6 depicts the enzyme activity of M106.
[00267] An FC Sialidase utilizing wild type Neu3 (Neu3-Fc; SEQ ID NO: 117, encoded by SEQ ID NO: 118) was expressed in a 100 ml transfection of Expi293 human cells using the pCEP4 mammalian expression vector. Activity was determined using Neu3-Fc expressing cells (N3-Normal), Neu3-Fc expressing cells treated with tunicamycin (N3-Tunic), and mock transfected cells in both the cell conditioned media (Supernatant) and washed cell pellets. FIGURE 7 shows that Neu3-Fc activity was detected in the cell pellet, representing surface bound activity, and that low levels of activity detected in the supernatant, representing secreted Neu3-Fc. Treatment with tunicamycin, an inhibitor of S-acylation and N-glycosylation, did not change the surface associated activity or activity in the supernatant.
[00268] An Fc bacterial sialidase using Salmonella typhimurium (Fc-ST Sialidase) was constructed using a knob in hole-based Fc design. The Fc-ST Sialidase comprised a dimer of two polypeptides: SEQ ID NOs: 119 (pCEP-StSia-G4S2-hIgGlFc-Hole, encoded by SEQ ID NO: 121) and SEQ ID NO: 120 (pCEP-StSia-G4S2-hIgGlFc-Knob, encoded by SEQ ID NO: 122). Fc-ST Sialidase was expressed in a IL transfection of Expi293 human cells in using the pCEP4 mammalian expression vector. Fc-ST Sialidase was purified using Protein A, followed by cation exchange chromatography (Hitrap SP-HP, GE Lifesciences). FIGURE 8 depicts an SEC-HPLC trace showing that the expressed Fc-ST Sialidase was a monomer species with a retention time of 21 minutes and an SEC monomer purity of 75%.
[00269] The activity of Fc-ST Sialidase was assayed by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc). An enzyme kinetics assay was performed using a fixed concentration of enzyme at 2 pg / well was incubated with fluorogenic substrate 4MU-NeuAc at concentrations ranging from 4 mM to 0.03 pM. FC ST had an activity approaching 3 x 108 Fluorescence AU. Example 3: In vivo administration of Fc sialidases reduces tumor volume
[00270] This Example shows that in vivo administration of Fc sialidases of the current invention reduce tumor volume in syngeneic mouse tumor models.
[00271] The Fc Salmonella typhimurium sialidase construct (Fc-ST Sialidase) described in Example 2 was compared to Avelumab (anti-PD-Ll antibody) in a mouse syngeneic tumor model injected with a murine lymphoma cancer cell line A20. Female BALB / c mice, 6-8 weeks of age, were inoculated subcutaneously in the right lower flank region with A20 tumor cells (5 x 105) in 0.1 ml of PBS for tumor development. Mice were randomly allocated to 4 groups of 8 animals each when tumors reached 50-100 mm3, mean ~ 75-100 mm3.
[00272] Mice were administered a negative control (“Isotype Control,” FIGURE 9A), Fc-ST Sialidase (FIGURE 9B), Avelumab (anti-mouse PD-L1 antibody, FIGURE 9C), or the combination of Fc-ST Sialidase and Avelumab (FIGURE 9D) via intraperitoneal injection of -2 10 mg / kg twice a week for 15 days and tumor volume (mm ) was measured over time. This example demonstrates that Fc sialidases of the present invention can reduce tumor volume in vivo.
[00273] The Fc-ST Sialidase was evaluated in a second model using a mouse tumor cell line engineered to express human Her2 (EMT6-Her2 cells). Fc-ST Sialidase and the human Neu2 Fc construct Ml06 (described in Example 2) was compared to trastuzumab (anti-HER2 antibody) in a mouse syngeneic tumor model injected with EMT6-Her2 cells. Female BALB / c mice, 6-8 weeks of age, were inoculated subcutaneously in the right lower flank region with EMT6-Her2 tumor cells (5 x 105) in 0.1 ml of PBS for tumor development. Mice were randomly allocated to 4 groups of 8 animals each when tumors reached 50-100 mm3, mean ~ 75-100 mm3.
[00274] Mice were administered isotype control (Vehicle Control, FIGURE 10A), Fc-ST Sialidase (FC-ST, FIGURE 10B), trastuzumab (anti human Her2 antibody, FIGURE 10C), or Fc human Sialidase (M106, FIGURE 10D) via intraperitoneal injection at 10 mg / kg twice a week for 15 days, as indicated by the triangles, and tumor volume was measured over time. This example demonstrates that Fc sialidases of the present invention can reduce tumor volume in vivo. Example 4: Divalent cations can stabilize the activity of sialidases
[00275] This example describes the ability of divalent cations, and in particular calcium, to stabilize the activity of sialidases of the present invention. In particular, an Fc Neu2 Sialidase (SEQ ID NO: 123) (MID, V6Y, I187K, C332A) was expressed along with the heavy and light chain of trastuzumab (including a first polypeptide chain with amino acid sequence SEQ ID NO: 124, encoded by nucleotide sequence SEQ ID NO: 125, a second polypeptide chain with amino acid sequence SEQ ID NO: 126, encoded by nucleotide sequence SEQ ID NO: 127, and a third polypeptide chain with amino acid sequence SEQ ID NO: 123, encoded by nucleotide sequence SEQ ID NO: 128).
[00276] Purified protein in PBS or PBS with 4 mM CaCh was incubated at 37 °C for up to 2 weeks. Samples containing about 2 pg of protein were assayed by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc). Assays were done following 4 hours and days 1, 3, 7 and 14 at 37 °C. The results are shown in FIGURE 11. As can be seen, the addition of CaCh to the enzyme preparation greatly stabilized the enzyme activity.
[00277] To see if CaCh could stabilize enzyme activity during expression in mammalian cells, 4 mM CaCh was added to transiently transfected Expi293 cell expression media starting 24 hours after transfection. As shown in FIGURE 12A, the addition of CaCh greatly increased the amount of secreted enzyme activity through day 7. However, as shown in FIGURE 12B, 4 mM CaCh led to a decrease in cell viability.
[00278] To optimize a CaCh concentration that can stabilize enzyme activity but maintain cell viability, five concentrations of CaCh ranging from 0.05 mM, 0.5 mM, 1 mM, 2 mM and 4 mM were added at day 1 following transfection. Conditioned media was collected over a three day time course on days 4-6 and enzymatic activity (and thus viability) determined as shown in FIGURE 13A. Protein yield was also measured (FIGURE 13B). It was found that 4 mM CaCh stabilized activity and gave a moderate yield, but gave poor viability. It was found that, under the conditions tested, the use of 0.5 mM CaCh maintained the activity of the sialidase, provided a higher protein yield and was less toxic to cells. Example 5 : Sialoglycan profiles of subsets of human PBMCs
[00279] This example describes the sialoglycan profile on different subsets of human peripheral blood mononuclear cells (PBMCs) using flow cytometry. Sialoglycans present on immune cell surfaces play important roles in maintaining homeostasis. Imbalance in sialoglycan profile on immune cells is documented in autoimmunity, mechanisms of immune surveillance escape by tumor cells and so forth.
[00280] Following isolation of PBMCs using a Ficoll method, cells were washed twice with ice cold PBS using a tabletop centrifuge at 350 x g for 5 minutes, cells were counted using Countess™ II Automated Cell Counter (Thermo Fisher Scientific, Waltham, MA) and 250K cells were aliquoted into each well of a 96-well plate. Fc blocking solution containing Human Trustain FcX (1 / 20 dilution) and LIVE / DEAD™ Fixable Near-IR Dead Cell Stain (1 / 2000 dilution) in PBS was prepared and cells were incubated for 10 minutes on ice. Cells were washed using ice-cold PBS (1% BSA) at 350 x g for 5 min. Cell surface sialoglycan staining was performed using Hydra and lectin reagents as shown in TABLE 10. Hydra-3, Hydra-7 and Hydra-9 are hexameric versions of the extracellular domain of human Siglec 3, Siglec 7, and Siglec 9, respectively, (as described in International (PCT) Application Publication No. WO2019 / 237070). Lectins used included Biotinylated Sambucus Nigra (SNA, Vector Laboratories, B-1305-2), Biotinylated Machia Amurensis (MAL-II, Vector Laboratories, B-1265-1) and Biotinylated Peanut Agglutinin (PNA, Vector Laboratories, B-1075-5). SNA is a lectin that preferentially binds to sialic acid attached to terminal galactose in a-2,6 and to a lesser degree, a-2,3 linkage. MAL-II is a lectin that binds to sialic acid in an a-2,3 linkage. PNA is a lectin that binds to terminal galactose residues. An increase in PNA staining can be indicative of the removal of terminal sialic acids by a sialidase and exposure of the underlying galactose. TABLE 10 Reagent Stock Working cone. Buffer Hydra-3 Varies 250 nM FACS staining buffer Hydra-7 Varies 25 nM FACS staining buffer Hydra-9 Varies 75 nM FACS staining buffer MAL-II 1 mg / mL 2 pg / mL PBS PNA 5 mg / mL 1 pg / mL FACS staining buffer SNA 2 mg / mL 0.5 pg / mL FACS staining buffer
[00281] PBMCs were incubated with the various Hydra and lectin reagents on ice for 30 minutes. Cells were washed using 150 pL of PBS (1% BSA) into each well and centrifuged at 350 x g for 5 minutes. Plate solution was quickly decanted. AF-647 goat anti-5 mouse IgG was used with a 1 / 2000 dilution in PBS as a secondary stain for Hydra reagents (Hydra-7 and Hydra-9). Streptavidin conjugated Alexa Fluor 647 was used at a dilution of 1 / 2000 in PBS as a secondary stain for lectin reagents (PNA, MAL-II and SNA). Cells were incubated for 15 minutes on ice. Cell lineage-specific staining was performed as shown in TABLE 11 with indicated antibodies. All antibodies were purchased from Biolegend® (San 10 Diego, CA) with the exception of Live Dead stain, which was purchased from Thermo Fisher Scientific (Waltham, MA). TABLE 11 Marker Fluorochrome Clone Cat no. Marker for CD3 PE UCHT1 300441 Pan-T cells PNA / Hydra / MAL- II APC / AF647 N / A N / A CD14 BV421 MSE2 301830 Myeloid in PBLs HLA-DR PerCPcy5.5 L243 307628 CD 163 BV510 GH1 / 61 333628 CD4 BV605 SK3 344646 CD4+T CD56 BV650 5.1H11 362532 NK CD8 BV786 SKI 344740 CD8+T CD20 PE-Cy-7 2H7 302312 B cell Live dead APC-Cy-7 N / A L34975 CDllc APC-R-700 Bul5 337220
[00282] A master mix was prepared using the reagents in TABLE 11 in FACS staining buffer (“stain mix”) and 30 pl of stain mix was aliquoted into each well / tube for a final active antibody concentration ~ 1 pg / ml. Cells were incubated on ice for 15 minutes. In addition, individual cellular compensation controls were prepared. Cells were washed with PBS (1% BSA) and resuspended in 4% paraformaldehyde at room temperature for 10 min. Cells were washed twice using PBS, and pellets were resuspended in 150 pl PBS. Samples were run using a flow cytometer (BD FACSCelesta™ (BD Biosciences)).
[00283] Human PBMCs from two different healthy donors were stained with Hydra-3, Hydra-7 and Hydra-9, as depicted in FIGURE 14 (black and grey bars represent the two donors). As shown, monocytes and DC cell populations exhibit increased Hydra-9 staining in comparison with other cell populations (FIGURE 14A). Monocytes and DC cell populations exhibit increased Hydra-7 staining in comparison with other cell populations (FIGURE 14B). One donor demonstrated increased Hydra-7 staining on CD4+ T cells. Monocytes and DC cell populations exhibited increased Hydra-3 staining in comparison with other cell populations (FIGURE 14C). One donor demonstrated increased Hydra-3 staining on CD4+ T cells.
[00284] Lectin staining (MAL-II, PNA and SNA) of human PBMCs from healthy donors is depicted in FIGURE 15 (black and grey bars represent two independent donors). As shown, PNA staining is relatively low in comparison with Hydra-9 staining (see scale of Y-axis in comparison to FIGURE 14) but specific for monocytes and DCs (FIGURE 15A). MAL-II stains most of the immune cell populations (FIGURE 15B). T cells (CD4+ and CD8+) exhibit increased MAL-II staining as compared to other cell populations. SNA stains most of the immune cell populations (FIGURE 15C), with NK cells exhibiting less SNA staining in comparison with other cell populations. Example 6: Sialidases efficiently desialylate dendritic cells (DCs)
[00285] This example demonstrates the desialylation efficiency of sialidase molecules of the current invention on human monocyte-derived dendritic cells (DCs).
[00286] DCs are known to express high levels of Siglecs (sialic acid-binding immunoglobulin-like lectins, e.g., Siglec-3, -7, and -9), which inhibit the NK cell-mediated killing of tumor cells. Additionally, DCs express numerous sialoglycans that are ligands for Siglec molecules, as demonstrated in the previous example. Interactions of the Siglecs on DCs with sialoglycans, either on the same cell or on another interacting cell (e.g., a cancer cell), regulate DC activation.
[00287] PBMCs were isolated from leukopaks (blood samples enriched in PBMCs) using a standard Ficoll density gradient method. After PBMC isolation, the cells were washed twice with cold autoMACS® rinsing solution (containing 5% BSA; Miltenyi Biotec) by centrifuging at 350 x g for 5 minutes. CD14+ monocytes were magnetically purified using CD14 microbeads (Miltenyi Biotec) and differentiated into dendritic cells. Specifically, CD 14+ cells were resuspended in complete medium (10% FBS-containing RPMI media) containing 50 ng / ml of recombinant human GM-CSF and 50 ng / mL of recombinant human IL-4 at a concentration of 0.8 cells x 106 / mL. On Day 0, the cells were plated in 6-well plates with 3 ml of cell suspension per well (2.4 x 106 cells / well). At Day 3 and Day 6, half of the medium from each well was removed, taking care not to disturb the loosely attached cells. Each well was replenished with 1.5 mL of fresh medium containing 100 ng / mL each of rhGM-CSF and rhIL-4. At Day 7, the differentiated DCs were harvested by gentle flushing with medium, washed once with complete medium and resuspended at 2 x 106 / mL.
[00288] For the desialylation assay, M106 (MID, V6Y, P62G, A93E, I187K, C332A, and human IgGl Fc with hole (Y407T) mutation and an EPKSS (SEQ ID NO: 163) linker) (SEQ ID NO: 152, encoded by SEQ ID NO: 193) was used. This is construct is as described in Example 2, but with an EPKSS (SEQ ID NO: 163) linker instead of a GGGGSGGGGS (SEQ ID NO: 162) linker. The term “M106: used in the Examples going forward refers to this construct. In addition, a Neu2-FC variant termed LOF (MID, V6Y, K9D, I187K, C332A, A93E, V363R, L365R, E218A, C219N, and human IgGl Fc with hole (Y407T) mutation (SEQ ID NO: 175, encoded by SEQ ID NO: 176)) was used as a negative control. 100,000 DCs per well were plated out in a 96-well U bottom format, with 200 pl dispensed per well. LPS was used where indicated at 0.3 ng / mL, and M106 and LOF constructs were used at the following concentrations (in pg / mL): 0, 6.25, 12.5, 25, 50 and 100. DCs were incubated overnight (16 hours) followed by flow analysis of CD83, CD86 and MHCII (HLA-DR). Desialylation was measured by PNA staining as described in Example 5.
[00289] After incubation, the plates were centrifuged at 350 x g for 4 minutes and the medium was removed. Cells were washed once with FACS staining buffer. Cells were blocked and stained for dead cells simultaneously by adding 100 pl of solution containing Human Trustain FcX (1 / 20 dilution) and LIVE / DEAD™ Fixable Near-IR Dead Cell Stain (1 / 2000 dilution) in PBS and incubating on ice for 10 minutes. Cells were centrifuged and washed once with FACS buffer. 50 pL of PNA-biotin (1 pg / mL in FACS staining buffer) was added to each well and incubated on ice for 10 minutes. Cells were centrifuged and - 88 - washed twice with FACS buffer. 50 pL of the antibody cocktail (described in TABLE 12 below) including Streptavidin Alexa Fluor™ 647 was added to each well and incubated on ice for 30 minutes. After incubation, the cells were washed twice with 150 pL of FACS buffer and resuspended in 125 pL of FACS buffer for flow cytometric acquisition. The flow 5 cytometric data was acquired on a flow cytometer (BD FACSCelesta™ (BD Biosciences)) using a HTS (High Throughput Sampler) option. After data acquisition signals were analyzed using FlowJo flow analysis software (BD Biosciences). TABLE 12 Reagent Vendor Cat# Dilution / Concentration used PNA Vector Labs NB-1075-5 1 pg / mL Streptavidin Alexa Fluor 647 Thermo Fisher S21734 1 / 2000 LIVE / DEAD™ Fixable Near-IR Dead Cell Stain Thermo Fisher L34976 1 / 2000 Anti-CD209-FITC Biolegend® 330104 1 / 25 Anti-CD83-PE Biolegend® 305308 1 / 25 Anti-HLA-DR-PE- Cy7 Biolegend® 307616 1 / 100 Anti-CD 11 c-Alexa Fluor 700 Biolegend® 337220 1 / 50 Anti-CD86-Brilliant Violet 785 Biolegend® 305442 1 / 50
[00290] FIGURE 16 depicts the degree of desialylation of DCs by M106 based on PNA staining. An increase in PNA staining is indicative of removal of the terminal sialic acid, exposing the underlying galactose residues recognized by the PNA lectin. FIGURE 16A shows the increase in fluorescence (MFI), indicative of PNA staining, with increasing 15 Ml06 concentration. FIGURE 16B shows the fold increase in PNA signal as compared to untreated DCs. A clear dose-dependent increase in PNA signal was observed indicating a robust desialylation of the DCs.
[00291] Taken together, this example shows that M106 causes a robust desialylation of DCs in a dose-dependent manner. Example 7: Desialylation of tumor cell lines by sialidases
[00292] Sialoglycans play role in maintaining tolerance and homeostasis in human physiological conditions. Overexpression of sialoglycans is observed in tumor cell lines. This example demonstrates the ability of M106 to desialylate tumor cell lines BT-20, SKBR-3, HT-29 as determined by Hydra-9 and lectin staining.
[00293] BT-20 and HT-29 cells were grown to 70-80% confluence on plates using appropriate media. Cells were dissociated using Accutase® (Innovative Cell Technologies, Inc.), an enzyme mixture containing proteolytic and collagenolytic enzyme activity, by incubating the plates at 37° C for 15 minutes. When the cells were dissociated, an equal volume of complete media was added to neutralize Accutase®. The cell suspension was transferred and centrifuged at 300 x g for 5 min. The supernatant was discarded and cells were washed twice with cold PBS. Cells were counted and resuspended in media at 1 x 106 cells per ml. M106 and LOF were added at varying dilutions to cells. Cells were incubated for 10 hours at 37° C. After the incubation, cells were washed with PBS and transferred to 96-well round bottom plates for staining. Staining was performed with Hydra-9 and PNA as in Example 5.
[00294] FIGURE 17 depicts the degree of desialylation of BT-20 cells following treatment with Ml 06 (triangles) or LOF control (squares) as determined by loss of Hydra 9 binding (FIGURE 17A) or increase in PNA staining (FIGURE 17B), as measured by fluorescence (gMFI). An IC50 for desialylation by Ml06 was 3.088 pg / mL for Hydra 9 and 58.75 pg / mL for SNA. FIGURE 18 depicts the degree of desialylation of BT-20 cells following treatment with Ml06 (triangles) or LOF control (squares) as determined by loss of Hydra 9 binding (FIGURE 18A) or increase in PNA staining (FIGURE 18B), as measured by fluorescence (gMFI). The IC50 for desialylation by Neu2-Fc variant M106 was 2.95 pg / ml for Hydra 9 and 131.5 pg / mL for SNA.
[00295] A similar experiment was performed with SKBR-3 cells, in which cells were stained with MAL-II lectin in addition to Hydra 9 and PNA. For MAL-II staining, a final concentration of 2 pg / mL in PBS was used and cells were stained for 10 minutes at room temperature. FIGURE 19 depicts the degree of desialylation of SKBR-3 cells following treatment with Ml 06 (triangles) or LOF control (circles) as determined by loss of Hydra 9 binding (FIGURE 19A), loss of MAL-II staining (FIGURE 19B) or increase in PNA staining (FIGURE 19C), as measured by fluorescence. An IC50 for desialylation by M106 was 4.4 pg / ml with Hydra 9, approximately 120 pg / mL for MAL-II and 22 pg / ml for SNA.
[00296] Taken together, this example shows that M106 demonstrated a dose dependent removal of cell surface sialic acid from tumor cells. Loss of Hydra 9 staining is a more sensitive indicator with EC50s around 3 to 4 ug / mL of M106 as compared to loss of MAL II staining or gain of PNA staining. Example 8: Desialylation of tumor cell lines by sialidases enhances human dendritic cell activation
[00297] Sialoglycans play role in maintaining tolerance and homeostasis in human physiological conditions. Although overexpression of sialoglycans is observed in tumor cell lines, the resulting sialoglycans can be removed using sialidases of the present invention as shown in the previous examples. This example demonstrates the effect of desialylation of tumor cell lines on dendritic cell activity.
[00298] Briefly, dendritic cells (DCs) were generated from CD14+ monocytes isolated from PBMCs of healthy donors. CD14+ cells were magnetically purified using manufacturer’s protocol (Miltenyi Cat# 130-050-201). The purified cells were then cultured for 7 days in presence of GM-CSF (R&D Systems Cat# 7954-GM / CF) and IL-4 (R&D Systems Cat# 6507-IL / CF) to generate immature DCs.
[00299] On the day of the experiment, SKBR-3 tumor cells were harvested from T-75 flasks using Accutase® and washed twice with 10% FBS McCoy’s 5A medium. The cells were then resuspended at 5 x 106 / mL of 10% FBS McCoy’s 5A medium. 100 pg / mL of Ml06 was added to the sample and incubated at 37 °C for 4 hours. The no treatment group was treated identically except for the addition of Ml 06 to the tube. After 4 hours, the cells were washed twice with 10% FBS McCoy’s 5A medium and resuspended at 2 x 106 / mL in complete medium (10% FBS RPMI). 50 pl (100,000 DCs) of the suspension was added to the designated wells.
[00300] DCs were harvested, washed in complete medium (10% FBS RPMI) and resuspended at 2 x 106 / ml. 50 pL (100,000 DCs) of the suspension was added to the designated wells.
[00301] LPS (InvivoGen Cat# tlrl-pb51ps) was added to a final concentration of 0.3 ng / mL. Complete medium (10% FBS RPMI) was added where needed to reach a final volume of 200 pL per well. The assay plate was incubated overnight at 37 °C. On the -91 - following day, the cells were washed with staining buffer and stained for DC markers (CD11c, CD209, CDlc, CD83, CD86 and HLA-DR). The desialylation of the tumor cells was confirmed by staining with Hydra-9 as described in Example 6.
[00302] FIGURE 20 depicts the effects of dendritic cell activation under various conditions as determined by CD83hi expression (FIGURE 20A) or CD86hi expression (FIGURE 20B). Untreated DCs (“No Tx”) have a low percentage of CD83hi and CD86hi. Addition of LPS to the DCs strongly induces activation, as shown by an increased percentage of CD83hi and CD86hi (“LPS”). LPS-induced expression of both CD83 and CD86 was inhibited when DCs were co-incubated with untreated SKBR-3 tumor cells (see horizontal line in FIGURES 20A and 20B). The inhibition of DCs by SKBR-3 tumor cells is reversed following desialylation of the SKBR-3 tumor cells by Ml 06 prior to co-incubation with DCs and LPS (“LPS+ M106 FC”). In addition, sialidase treatment slightly enhances activation of DCs in the absence of LPS (compare no treatment and untreated SKBR-3 tumor cells to M106-treated SKBR-3 tumor cells (“Ml06 FC”)).
[00303] This example demonstrates that desialylation of tumor cells can reverse the sialoglycan-induced immunosuppression of DCs which suggests that desialylation of tumor cells can lead to a stronger anti-tumor response. Example 9: Effect of sialidases on phagocytosis of tumor cells by macrophages
[00304] Sialoglycans present on immune cell surfaces play important roles in maintaining homeostasis. This example demonstrates the effect of sialidases of the present invention on phagocytosis of HT-29 tumor cells by M2-like human macrophages.
[00305] PBMCs from whole blood of human volunteers were isolated by a Ficoll method. CD 14+ monocytes were magnetically purified using CD 14 microbeads. Monocytes were differentiated into M2-like macrophages by resuspending CD14+ cells in RPMI media (10% FBS) at a concentration of 1 x 106 / mL with 50 ng / mL of recombinant human M-CSF. On Day 0, the cells were plated in 150 mm tissue culture plates in 20 mL volume (~20 x 106 cells seeded per plate). At Day 3 and Day 6, half of the medium from each well was removed, taking care not to disturb the attached cells. M-CSF was replenished to a final concentration of 50 ng / mL. On Day 7, the supernatant media was collected in 50 mL tubes and the plate was gently washed with 20 mL PBS. 20 mL Accutase® was added and plates were incubated for 20 minutes to dissociate cells from the plate. Cells were resuspended in complete RPMI media supplemented with 10% FBS and non-essential amino acids (NEAA), sodium pyruvate and HEPES with 10 ng / ml M-CSF, and seeded at 50K cells / well / 100 pL in flat bottom 96-well plate.
[00306] HT-29 cells were harvested from flask using Accutase®. Cells were washed with PBS. Cells were labelled with Cell Trace™ CFSE labelling dye (FITC) conjugate (Thermo Fisher) at a 1:1000 dilution by volume (final concentration of 10 pM). Cells were incubated at room temperature for 10 minutes and the labelling reaction was quenched by adding an equal volume of chilled FBS. Cells were washed twice and resuspended in media (10% FBS supplemented McCoy’s media) at 1.2 x 106 / ml cells. M106 and LOF were added at a top concentration of 100 pg / ml followed by 2-fold dilutions. A no treatment control group was reserved with untreated HT-29 cells. Cells were incubated at 37° C for ~20 hours.
[00307] Following the incubation, cells were spun down, washed with PBS, and resuspended into complete RPMI (10% FBS) media at a final cell density of 2.5 x 106 cells / mL. 100 pL HT-29 cell suspension was added to M2-like macrophages in appropriate wells at a macrophage: tumor cell ratio of 1:5 (E:T). Plates with macrophage and tumor cells were incubated for 2 hours to allow for phagocytosis. After 2 hours, the media was gently removed using multi-channel pipette and 200 pL of Accutase® was added to the plates incubated for 45 minutes on ice to detach both HT-29 and macrophages from the plate. The cells were resuspended and collected in a new 96-well bottom plate. The plates were spun down, the supernatant was discarded, and the cell pellets were washed in 200 pL of PBS.
[00308] Cell pellets were resuspended and blocked using Human Trustain Fc blocker on ice for 5-7 minutes. After incubation, cells were washed with PBS. Cells were stained for CD45 and CD 14 fluorochrome markers as below in TABLE 13. Antibodies were purchased from Biolegend®. TABLE 13 Marker Fluorochrome Clone Cat no. Marker for CD14 BV421 MSE2 301830 Macrophages CD45 APC 2D1 368512 Macrophages
[00309] A master mix was made in FACS staining buffer with staining antibodies added at 1:30 dilution. 30 pl of master mix was added / well. Appropriate compensation controls (e.g., single color staining controls for compensation as per standard flow cytometry practice for multi-color flow cytometry) were stained in parallel. Cells were incubated on ice for 15 minutes and then washed with PBS at 350 g for 8 minutes. The cells were then fixed with 4% formaldehyde for 10 minutes at room temperature and afterwards washed twice with PBS. Cells were resuspended in 150 pL of PBS and run on a flow cytometer (BD FACSCelesta™ (BD Biosciences)).
[00310] The percentage of CFSE-positive, CD14+CD45+ macrophages were determined. CFSE-positive, CD14+CD45+ macrophages are indicative of percentage phagocytosis of tumor cells by macrophages, because CFSE-positive tumor cells that are phagocytosed by CD14+CD45+ macrophages are CFSE positive.
[00311] FIGURE 21 depicts the dose dependent enhancement of phagocytosis of desialylated HT-29 tumor cells by M2 like macrophages derived from two different healthy donors (FIGURE 21A and FIGURE 21B). HT-29 pretreated with sialidase at concentrations above 25 pg / mL demonstrated a reproducible increase in phagocytosis by macrophages. A similar increase in phagocytosis of desialylated BT20 and SKBR-3 tumor cells by M2-like macrophages was observed (FIGURE 21C and FIGURE 21D respectively).
[00312] Accordingly, treating tumor cells with a sialidase as described herein resulted in an increase in phagocytosis of the tumor cells by macrophages. Example 10: Sialidase treatment enhances MHC class-II expression on monocytes
[00313] This example demonstrates the effect of sialidases of the current invention on MHC class-II (HLA-DR) expression on monocytes. MHC-II expression represents antigen presentation capacity on the monocytes. Enhanced class-II expression is indicative of enhanced antigen presentation to T cells to generate an effective immune response.
[00314] PBMCs were isolated from healthy volunteers using Ficoll method and cells were washed twice with ice cold PBS using a tabletop centrifuge at 350 x g for 10 minutes. Cells were resuspended in media and counted using a Countess™ II Automated Cell Counter. The final suspension was adjusted to 2.5 x 106 cells / L. About 250,000 cells (100 pL) were seeded in 96-well round bottom plates. The cells were incubated with M106 or LOF at a top concentration of 50 pg / mL, with 2-fold dilutions. A no treatment group was included. The cells were incubated for 18 hours at 37° C. The plates were spun at 350 x g for 10 minutes. Cell pellets were washed with cold PBS, and subjected to blocking and staining steps using the FACS staining panel described in TABLE 14. All antibodies were purchased from Biolegend® with the exception of Live Dead stain, which was purchased from Thermo Fisher. Sialoglycan staining was performed using PNA lectin as confirmation of desialylation using the methods described in Example 7. TABLE 14 Marker Fluorochrome Clone Cat no. Marker for CD3 PE UCHT1 300441 Pan-T cells PNA APC N / A Glycosylation specific Lectin CD14 BV421 MSE2 301830 Myeloid in PBLs CD19 PerCPcy5.5 HIB19 302230 B cell CD 163 BV510 GH1 / 61 333628 CD4 BV605 SK3 344646 CD4+T CD56 BV650 5.1H11 362532 NK CD8 BV786 SKI 344740 CD8+T HLA-DR+ PE-Cy-7 L243 307628 Live dead APC-Cy-7 N / A L34975 CDllc APC-R-700 Bul5 337220
[00315] FIGURE 22 depicts the dose dependent enhancement of HLA-DR expression following Ml06 desialylation compared to LOF in monocytes from two different healthy donor (FIGURE 22A and FIGURE 22B)
[00316] Accordingly, this example shows that desialylation of monocytes by a 10 sialidase described herein leads to an increased MHC class-II (HLA-DR) expression on monocytes. MHC-II expression represents antigen presentation capacity on the monocytes. Thus, enhanced class-II expression is indicative of enhanced antigen presentation to T cells, which can enhance the ability of T cells to generate an effective immune response. Example 11: Sialidase treatment does not result in adverse cytokine release
[00317] Conditioned media from PBMCs incubated with Ml06 or LOF was assayed for stimulation of cytokine release. LPS (1 ng / mL) was used as a positive control. M106 (as well as LOF) treatment of PBMCs demonstrated no increase across all treatment doses of TNF-alpha, IL-6, IL-lb eta, IL-IRA or IL-10 in two independent donors as measured by LEGENDplex™ Human M1 / M2 Macrophage Panel (10-plex; BioLegend®). In contrast, LPS demonstrated a clear cytokine induction. These results demonstrate that sialidase treatment of PBMCs does not result in adverse cytokine release. Example 12: Sialidase treatment leads to complete and partial remission of tumor growth alone and in combination with an anti-PD-1 antibody
[00318] This example shows that in vivo administration of sialidases of the present invention can result in complete and partial remission of tumor growth in various mouse syngeneic tumor models.
[00319] Sialidase treatment alone and in combination with other cancer treatments were tested using the MC38 colon cancer cell model. Each mouse was inoculated subcutaneously in the right lower flank region with 5 x 105 tumor cells in 0.1 mL of PBS to induce tumor development. Mice were randomized when the mean tumor size reached approximately 50 mm3. 32 mice were randomly allocated to 4 study groups. The mice were dosed with either M106, anti-mouse PD-1, a combination of Neu2-Fc variant M106 and anti-PD-1 or isotype control at 10 mg / kg of each agent twice per week for 5 doses. FIGURE 23 depicts the tumor growth for each mouse in either the isotype control group (FIGURE 23A), Ml 06 group (FIGURE 23B), anti-PD-1 group (FIGURE 23C) or a combination of Ml 06 and anti-PD-1 (FIGURE 23D). M106-treated mice demonstrated complete remission (CR) of tumor growth in one animal compared to no mice responding in the isotype treated group. The combination of Ml 06 and anti-PD-1 demonstrated 1 CR and 1 partial response (PR) as well as an overall reduction in tumor growth in all mice compared to isotype control.
[00320] Next, sialidase treatment alone and in combination with other cancer treatments were tested using the Bl6F10 melanoma cancer cell model. Each mouse was inoculated subcutaneously in the right lower flank region with 5 x 105 tumor cells in 0.1 mL of PBS for tumor development. Mice were randomized when the mean tumor size reached approximately 50 mm3. 24 mice were randomly allocated to 3 study groups. The mice were dosed with either M106, anti-mouse PD-1 or isotype control at 10 mg / kg twice per week for 5 doses. FIGURE 24 depicts the tumor growth for each mouse in either the isotype control group (FIGURE 24A), M106 group (FIGURE 24B) or anti-PD-1 group (FIGURE 24C). FIGURE 24D is an overlay of the isotype control group on the Ml 06 group demonstrating a clear benefit of Ml 06 in reducing tumor growth in what is considered a difficult-to-treat tumor model.
[00321] Next, sialidase treatment alone and in combination with other cancer treatments were tested using the cell line EMT6 expressing human Her2 as a polyclonal cell line. Each mouse was inoculated subcutaneously in the right lower flank region with 5 x 105 tumor cells in 0.1 mL of PBS for tumor development. The mice were randomized when the mean tumor size reached approximately 100 mm3. 16 mice were randomly allocated to 2 study groups. The mice were dosed with either M106 or isotype control at 10 mg / kg twice per week for 5 doses. FIGURE 25 depicts the tumor growth for each mouse in either the isotype control group (FIGURE 25A) or Ml06 FC group (FIGURE 25B). 4 out of 8 Ml 06-treated mice demonstrated complete remissions (CR) of tumor growth compared to only 1 out of 8 mice in the isotype treated group.
[00322] Accordingly, as demonstrated in this example, treatment with the sialidases disclosed herein leads to the reduction in cancer growth and, in some instances, complete remission, in a variety of cancer types. Example 13: Sialidase treatment leads to complete and partial remission of tumor growth alone and in combination with an anti-PD-Ll antibody
[00323] This example describes in vivo testing of Ml 06 and / or avelumab (anti-PD-Ll) in an A20 syngeneic mouse model. Mouse A20 cells express endogenous mouse PD-L1 which is bound by avelumab. Female Balb / c mice, 5-6 weeks of age, were inoculated subcutaneously in the right lower flank region with murine A20 B cell lymphoma cells in matrigel (1:1 by volume). Mice were randomly allocated into groups of 8 mice when tumors reached approximately 100 mm3 (the average tumor volume of each group ranged from 86 to 90 mm3). TABLE 15 describes the various arms of the study. The mice were treated intraperitoneally with 5 or 10 mg / kg Ml06, avelumab, and / or antibody isotype control (as indicated) twice a week for a total of 5 doses. Tumor volumes and body weights were recorded three times a week. TABLE 15 Group No. Mice Treatment Dose Schedule 1 8 Isotype control 10 mg / kg Twice weekly for 5 doses 2 8 Avelumab 5 mg / kg Twice weekly for 5 doses 3 8 Avelumab 10 mg / kg Twice weekly for 5 doses 4 8 M106-Fc 10 mg / kg Twice weekly for 5 doses 5 8 Avelumab in combination withM106-FC 10 mg / kg each Twice weekly for 5 doses
[00324] FIGURE 26 depicts the tumor growth in each mouse in each of the groups. Complete responders (CR) and partial responders (PR) for each group are shown. As can be seen, Ml06 demonstrated anti-tumor activity alone and in combination with avelumab (“Ave”).
[00325] Mice with tumors that demonstrated CR from Ml06 treatment groups (alone or in combination with avelumab) were grouped and rechallenged with murine A20 cells (all approximately 12 weeks of age) and compared to naive control mice injected with A20 cells of either 6 or 12 weeks of age. Tumor volumes and body weights were recorded three times a week. Tumors grew as expected in both the 6 week and 12 week naive mice, no tumor growth was observed in the rechallenged mice (data not shown.)
[00326] Accordingly, as demonstrated in this example, treatment with a sialidase disclosed herein leads to the reduction in cancer growth and, in some instances, complete remission, in a B cell lymphoma model. Example 14: Sialidase treatment leads to complete and partial remission of tumor growth alone and in combination with an anti-PD-Ll antibody
[00327] This example describes in vivo testing of Ml 06 and / or avelumab (anti-PD-Ll) in an A20 syngeneic mouse model. The experiment was performed as in Example 13, except that 6 doses were given (twice weekly for 3 weeks). TABLE 16 describes the various arms of the study. Mice were treated intraperitoneally with 10 mg / kg Ml 06, avelumab and / or antibody isotype control twice a week for a total of 6 doses. Tumor volumes and body weights were recorded three times a week. TABLE 16 Group Treatment Route / dose Schedule 1 Isotype 10 mg / kg IP Twice weekly for 3 weeks 2 Avelumab 10 mg / kg IP 3 Avelumab + M106 FC 10 mg / kg IP + 10 mg / kg IP 4 M106 FC 10 mg / kg IP
[00328] FIGURE 27 depicts the results of tumor growth in each mouse in each of the groups. The avelumab-based ASCs demonstrated varying degrees of efficacy. As in Example 13, Ml06 demonstrated activity as does Ml06 combined with avelumab.
[00329] Accordingly, as demonstrated in this example, treatment with a sialidase disclosed herein, alone or in combination with an anti-PD-Ll antibody, leads to the reduction in cancer growth and, in some instances, complete remission, in a B cell lymphoma model. Example 15: Sialidase treatment leads to improved survival in combination with an anti-CD20 antibody in tumor-bearing mice
[00330] This Example describes the in vivo administration of M106 in combination with an anti-CD20 antibody (ofatumumab) in a mouse syngeneic intravenous dissemination model using a murine breast cancer cell line expressing human CD20 (EL4 CD20 cells). Female C57 / BL6 mice, 6-8 weeks of age, were IV injected with 500,000 cells per mouse. Mice were subsequently dosed as described in TABLE 17 with isotype control, ofatumumab, an or a combination of ofatumumab and Ml06. Body weights and clinical observations were recorded daily. TABLE 17 Group # of mice Treatment Dose (mg / kg) Tumor route Route Dose volume mL / kg Schedule 1 10 Isotype control 10 IV IP 5 Twice weekly for 4 doses 2 20 Ofatumumab 10 IV IP 10 Twice weekly for 4 doses 5 20 Ofatumumab and Ml06 10 each IV IP 10 and 5 Twice weekly for 4 doses
[00331] FIGURE 28 depicts survival curves for mice in each group. FIGURE 28A depicts the survival as of day 28 and FIGURE 28B depicts the overall survival (as of day 41). Compared to isotype control, mice treated with ofatumumab demonstrated a shift in survival, with the 50% survival point shifting from 17 days to 24 days. Mice treated with a combination of ofatumumab and Ml06 demonstrated an even greater shift in survival to 30 days.
[00332] Accordingly, this example showed that treatment with a sialidase of the invention led to increased survival in mice treated with an anti-CD20 antibody.
[00333] Example 16: Sialidase treatment disrupts Siglec-15 activity on T cells
[00334] Siglec-15 is an important immune suppressor. Siglec-15 is only expressed on certain myeloid cells under normal conditions, but it is broadly upregulated on human cancer cells and tumor-infiltrating myeloid cells. Siglec-15 acts as a ligand and supresses antigenspecific T cell responses in vitro and in vivo. Genetic ablation or antibody blockade of Siglec-15 increases anti-turn or immunity in the tumor microenvironment (TME) and inhibits tumor growth in some mouse models.
[00335] This example demonstrates that neuraminidase treatment removes the Siglec-15 ligand, thereby disrupting Siglec-15 binding activity. It is believed that the disruption of Siglec-15 binding activity in vivo would cause increased anti-turn or immunity in the TME and inhibit tumor growth.
[00336] Human PBMCs were thawed and stimulated with anti-CD3 (OKT3 clone) and anti-CD28 (clone CD28.2) antibodies (both from eBiosciences, Thermo Fisher Scientific) at final concentration of 1 pg / mL in complete RPMI media (supplied with 10% heat inactivated FBS, non-essential amino acids and sodium pyruvate). On day 2, the floating cells were collected and re-plated in fresh complete RPMI media, anti-CD3 and anti-CD28 antibodies were replenished at 1 pg / mL to stimulate cells continuously. After 3 more days, cells were re-seeded in 15 mL conical tube at 106 / ml density and treated with different groups as follows: (1) no treatment; (2) a loss of function sialidase (“LOF FC,” as described in previous examples) at a 50 pg / mL final concentration; (3) M106 at a 50 pg / mL final concentration, and (4) BiNanH2 - 2 pg / mL final concentration. BiNanH2 is a strong sialidase from Bifidobacterium infantis that was used as a positive control.
[00337] Cells were supplied with anti-CD3 anti-CD28 antibodies and incubated in the 37 °C incubator overnight. The next day (~14 hours later), cells were spun down, media was - 100- removed and then cells were blocked with Human TruStain FcX Fc receptor blocker (Biolegend®) along with LIVE / DEAD™ Fixable Near-IR Dead Cell Stain in PBS. The cells were then blocked with heat inactivated human serum (5% in PBS).
[00338] Cells were stained with Human Siglec-15-Fc (prepared by Palleon Pharmaceuticals; MW: -100 KDa) at final concentration of 1 pM / 100 pg / mL. Cells were incubated on ice for 15 minutes and then washed with PBS.
[00339] Next, cells were stained with anti-human Fc-AF647 antibody in FACS staining buffer. Cells were incubated on ice for 5 minutes and then washed.
[00340] Then, cells were stained for CD4 and CD8 markers in FACS staining buffer as described in earlier examples. Cells were incubated on ice for 15 minutes and then washed. Cells were fixed and run on a flow cytometer (BD FACSCelesta™ (BD Biosciences)) and data was analyzed.
[00341] FIGURE 29 depicts the results of Siglec-15-Fc staining of CD4+ cells (FIGURE 29A) and CD8+ cells (FIGURE 29B) following the various treatments. As a control, Isotype IgGl staining is also shown. As shown, treatment of activated CD4 and CD8 cells with M106 FC or BiNaNH2 (positive control) decreased Siglec-15-Fc staining as compared to no treatment or treatment with LOF FC. FIGURE 30 depicts the results of Siglec-15-Fc staining of CD4+ cells (FIGURE 30A) and CD8+ cells (FIGURE 30B) using PBMCs from a second healthy donor. These results demonstrate that Siglec-15 binding to activated T cells is sialic acid-dependent and removal of sialic acids by neuraminidase disrupts this interaction.
[00342] Accordingly, this example demonstrates that neuraminidase treatment with a sialidase of the invention removes the Siglec-15 ligand, thereby disrupting Siglec-15 binding activity. It is believed that the disruption of Siglec-15 binding activity in vivo would cause increased anti-tumor immunity in the TME and inhibit tumor growth. INCORPORATION BY REFERENCE
[00343] The entire disclosure of each of the patent and scientific documents referred to herein is incorporated by reference for all purposes. EQUIVALENTS
[00344] The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting on the invention described herein. 5 Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are intended to be embraced therein. SEQUENCE LISTING
[00345] SEQ ID NO: 1: MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP IQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00346] SEQ ID NO: 2: MEDLRPMATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKTDEHAELIVLRR GSYNEATNRVKWQPEEWTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEHHQLHTK VNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGHCLQLRNPAGSLLVPAYA YRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVAEVGTGAQRMVYLNARSFLGA RVQAQSPNDGLDFQDNRWSKLVEPPHGCHGSWAFHNPISKPHALDTWLLYTHPTDSRNRT NLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMGQGPDGSPQFGCLYESGNYEEIIFLIF TLKQAFPTVFDAQ
[00347] SEQ ID NO: 3: EDLRP
[00348] SEQ ID NO: 4: MEDLRP
[00349] SEQ ID NO: 5: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[00350] SEQ ID NO: 6: ACAGTGGAAAAGTCCGTGGTGTTCAAGGCCGAGGGCGAGCACTTCACCGACCAGAAAGGCAA TACCATCGTCGGCTCTGGCAGCGGCGGCACCACCAAGTACTTTAGAATCCCCGCCATGTGCA CCACCAGCAAGGGCACCATTGTGGTGTTCGCCGACGCCAGACACAACACCGCCAGCGATCAG AGCTTCATCGATACCGCTGCCGCCAGATCTACCGATGGCGGCAAGACCTGGAACAAGAAGAT CGCCATCTACAACGACCGCGTGAACAGCAAGCTGAGCAGAGTGATGGACCCTACCTGCATCG TGGCCAACATCCAGGGCAGAGAAACCATCCTGGTCATGGTCGGAAAGTGGAACAACAACGAT AAGACCTGGGGCGCCTACAGAGACAAGGCCCCTGATACCGATTGGGACCTCGTGCTGTACAA GAGCACCGATGACGGCGTGACCTTCAGCAAGGTGGAAACAAACATCCACGACATCGTGACCA AGAACGGCACCATCTCTGCCATGCTCGGCGGCGTTGGATCTGGCCTGCAACTGAATGATGGC AAGCTGGTGTTCCCCGTGCAGATGGTCCGAACAAAGAATATCACCACCGTGCTGAATACCAG CTTCATCTACAGCACCGACGGCATCACATGGTCCCTGCCTAGCGGCTACTGTGAAGGCTTTG GCAGCGAGAACAACAT CATC GAG TTCAACGCCAGCCTGGTCAACAACATCCGGAACAGCGGC CTGCGGAGAAGCTTCGAGACAAAGGACTTCGGAAAGACGTGGACCGAGTTTCCTCCAATGGA CAAGAAGGTGGACAACCGGAACCACGGCGTGCAGGGCAGCACAATCACAATCCCTAGCGGCA ACAAACTGGTGGCCGCTCACTCTAGCGCCCAGAACAAGAACAACGACTACACCAGAAGCGAC ATCAGCCTGTACGCCCACAACCTGTACAGCGGCGAAGTGAAGCTGATCGACGACTTCTACCC CAAAGTGGGCAATGCCAGCGGAGCCGGCTACAGCTGTCTGAGCTACCGGAAAAATGTGGACA AAGAAACCCTGTACGTGGTGTACGAGGCCAACGGCAGCATCGAGTTTCAGGACCTGAGCAGA CATCTGCCCGTGAT CAAGAG C TACAAC
[00351] SEQ ID NO: 7: ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFI ALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAWSDVETGWFLFYSLCAHKAGCQVASTML VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLS DDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSWINARNQNNYHCHCRIVLRS YDACDTLRPRDVTFDPELVDPWAAGAWTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWR KETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISV
[00352] SEQ ID NO: 8: MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGL RIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAA RLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSW FFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPN RCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSWSFRPLEIPHRCQDSSSKDAPTIQQSS PGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSD LAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN
[00353] SEQ ID NO: 9: MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPAL LYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCP VWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSEL KHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHG RLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPH GCQGSWSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQ RVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRL FTHREILSHLQGDCTSPGRNPSQFKSN
[00354] SEQ ID NO: 10: MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLA GGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARL CCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRREC FGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSR VQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLG PGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPP QSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLV FACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS
[00355] SEQ ID NO: 11: MMSSAAFPRWLSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSH AHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEA VQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLV PAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSF LYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSV GPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSW TLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDL ASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS
[00356] SEQ ID NO: 12: MASLP
[00357] SEQ ID NO: 13: ASLP
[00358] SEQ ID NO: 14: TVEKSWF
[00359] SEQ ID NO: 15: GDYDAPTHQVQW
[00360] SEQ ID NO: 16: SMDQGSTW
[00361] SEQ ID NO: 17: STDGGKTW
[00362] SEQ ID NO: 18: PRPPAPEA
[00363] SEQ ID NO: 19: QTPLEAAC
[00364] SEQ ID NO: 20: NPRPPAPEA
[00365] SEQ ID NO: 21: SQNDGES
[00366] SEQ ID NO: 22: LSHSLST
[00367] SEQ ID NO: 23: GAGAACGACTTTGGACTGGTGCAGCCTCTGGTCACCATGGAACAGCTGCTGTGGGTTTCCGG CAGACAGATCGGCAGCGTGGACACCTTCAGAATCCCTCTGATCACCGCCACACCTAGAGGCA CCCTGCTGGCCTTTGCCGAGGCCAGAAAGATGAGCAGCTCTGACGAGGGCGCCAAGTTTATT GCCCTGAGGCGGTCTATGGACCAGGGCTCTACATGGTCCCCTACCGCCTTCATCGTGAACGA TGGCGACGTGCCCGATGGCCTGAATCTGGGAGCTGTGGTGTCCGATGTGGAAACCGGCGTGG TGTTCCTGTTCTACAGCCTGTGTGCCCACAAGGCCGGTTGTCAGGTGGCCAGCACAATGCTC GTGTGGTCCAAGGACGACGGCGTGTCCTGGTCTACCCCTAGAAACCTGAGCCTGGACATCGG CACCGAAGTGTTTGCTCCAGGACCTGGCTCTGGCATCCAGAAGCAGAGAGAGCCCAGAAAGG GCAGACTGATCGTGTGTGGCCACGGCACCCTTGAGAGAGATGGCGTTTTCTGCCTGCTGAGC GACGATCATGGCGCCTCTTGGAGATACGGCAGCGGAGTGTCTGGAATCCCTTACGGCCAGCC TAAGCAAGAGAACGATTTCAACCCCGACGAGTGCCAGCCTTACGAGCTGCCTGATGGCAGCG TCGTGATCAACGCCCGGAACCAGAACAACTACCACTGCCACTGCCGGATCGTGCTGAGAAGC TACGACGCCTGCGATACCCTGCGGCCTAGAGATGTGACCTTCGATCCTGAGCTGGTGGACCC TGTTGTTGCCGCTGGTGCCGTCGTGACATCTAGCGGCATCGTGTTCTTCAGCAACCCTGCTC ACCCCGAGTTCAGAGTGAATCTGACCCTGCGGTGGTCCTTCAGCAATGGCACAAGCTGGCGG AAAGAAACCGTGCAGCTTTGGCCTGGACCTAGCGGCTACTCTTCTCTGGCTACACTGGAAGG CAGCATGGACGGCGAAGAACAGGCCCCTCAGCTGTACGTGCTGTACGAGAAGGGCAGAAACC AC TAGAC C GAGAG CAT CAGC G T G G C CAAGAT CAG C G T T
[00368] SEQ ID NO: 24: ATGGCCAGCCTGCCTGTGCTGCAGAAAGAAAGCGTGTTCCAGTCTGGCGCCCACGCCTACAG AATTCCCGCTCTGCTGTATCTGCCAGGCCAGCAGTCTCTGCTGGCTTTCGCTGAACAGCGGG CCAGCAAGAAGGATGAGCACGCCGAACTGATCGTGCTGCGGAGAGGCGATTACGACGCCCCT ACACATCAGGTGCAGTGGCAGGCTCAAGAGGTGGTGGCTCAGGCTAGACTGGACGGCCACAG ATCTATGAACCCCTGTCCTCTGTACGATGCCCAGACCGGCACACTGTTTCTGTTCTTTATCG CTATCCCCGGCCAAGTGACCGAGCAGCAGCAGCTGCAGACAAGAGCCAACGTGACCAGACTG TGTCAAGTGACCTCCACCGACCACGGCAGAACCTGGTCTAGCCCTAGAGATCTGACCGACGC CGCCATCGGACCTGCCTATAGAGAGTGGTCCACCTTCGCCGTTGGACCTGGACACTGTCTCC AGCTGCACGACAGGGCTAGATCTCTGGTGGTGCCTGCCTACGCCTATAGAAAGCTGCACCCC ATCCAGCGGCCTATTCCTAGCGCCTTCTGCTTTCTGAGCCACGATCACGGCAGGACATGGGC CAGAGGACATTTCGTGGCCCAGGACACACTGGAATGCCAGGTGGCCGAAGTGGAAACCGGCG AGCAGAGAGTCGTGACCCTGAACGCCAGATCTCACCTGAGAGCCAGAGTGCAGGCCCAGAGC ACAAACGACGGCCTGGATTTCCAAGAGAGCCAGCTGGTCAAGAAACTGGTGGAACCTCCTCC ACAGGGCTGTCAGGGAAGCGTGATCAGCTTTCCATCTCCTAGAAGCGGCCCTGGCTCTCCTG CTCAGTGGCTGCTGTATACACACCCCACACACAGCTGGCAGAGAGCCGATCTGGGCGCCTAC CTGAATCCTAGACCTCCTGCTCCTGAGGCTTGGAGCGAACCTGTTCTGCTGGCCAAGGGCAG CTGTGCCTACAGCGATCTGCAGTCTATGGGCACAGGCCCTGATGGCAGCCCTCTGTTTGGCT GTCTGTACGAGGCCAACGACTACGAAGAGATCGTGTTCCTGATGTTCACCCTGAAGCAGGCC TTTCCAGCCGAGTACCTGCCTCAA
[00369] SEQIDNO:25: ATGGAGGAAGTGACCACCTGTAGCTTCAACAGCCCTCTGTTCCGGCAAGAGGACGACCGGGG CATCACCTACAGAATCCCTGCTCTGCTGTACATCCCTCCTACACACACCTTTCTGGCCTTCG CCGAGAAGCGGAGCACCAGACGAGATGAAGATGCCCTGCACCTGGTGCTGAGAAGAGGCCTG AGAATCGGACAGCTGGTGCAGTGGGGACCTCTGAAGCCTCTGATGGAAGCCACACTGCCCGG CCACAGAACCATGAATCCTTGTCCTGTGTGGGAGCAGAAAAGCGGCTGCGTGTTCCTGTTCT TCATCTGCGTGCGGGGCCACGTGACCGAGAGACAGCAAATCGTGTCCGGCAGAAACGCCGCC AGACTGTGCTTCATCTACAGCCAGGATGCCGGCTGCTCTTGGAGCGAAGTTCGGGATCTGAC CGAAGAAGTGATCGGCAGCGAGCTGAAGCACTGGGCCACATTTGCTGTTGGCCCTGGCCACG GAATCCAGCTGCAATCTGGCAGACTGGTCATCCCCGCCTACACCTACTATATCCCCAGCTGG TTCTTCTGCTTCCAACTGCCTTGCAAGACCCGGCCTCACAGCCTGATGATCTACAGCGACGA TCTGGGCGTGACATGGCACCACGGCAGACTGATCAGACCCATGGTCACCGTGGAATGCGAGG TGGCCGAAGTGACAGGCAGAGCTGGACACCCTGTGCTGTACTGCTCTGCCAGAACACCCAAC CGGTGTAGAGCCGAGGCTCTGTCTACAGATCACGGCGAGGGCTTTCAGAGACTGGCCCTCTC TAGACAGCTGTGCGAACCTCCTCATGGCTGTCAGGGCAGCGTGGTGTCCTTCAGACCTCTGG AAATCCCTCACCGGTGCCAGGACAGCAGCTCTAAGGATGCCCCTACCATCCAGCAGTCTAGC CCTGGCAGCAGCCTGAGACTGGAAGAGGAAGCCGGAACACCTAGCGAGAGCTGGCTGCTGTA CTCTCACCCCACCAGCAGAAAGCAGAGAGTGGACCTGGGCATCTACCTGAATCAGACCCCTC TGGAAGCCGCCTGTTGGAGCAGACCTTGGATTCTGCACTGTGGCCCTTGCGGCTACTCTGAT CTGGCCGCTCTGGAAGAAGAGGGCCTGTTCGGCTGCCTGTTTGAGTGCGGCACAAAGCAAGA GTGCGAGCAGATCGCCTTCCGGCTGTTCACCCACAGAGAGATCCTGAGCCATCTGCAGGGCG ACTGCACAAGCCCAGGCAGAAATCCCAGCCAGTTCAAGAGCAAC
[00370] SEQ ID NO: 26: ATGGGCGTGCCCAGAACACCCAGCAGAACCGTGCTGTTCGAGAGAGAGAGGACCGGCCTGAC CTACAGAGTGCCTTCTCTGCTGCCTGTGCCTCCTGGACCTACACTGCTGGCCTTCGTGGAAC AGAGACTGAGCCCCGATGATTCTCACGCCCACAGACTGGTGCTGAGAAGAGGAACACTGGCT GGCGGCTCTGTTAGATGGGGAGCACTGCATGTGCTGGGCACAGCTGCTCTTGCCGAGCACAG ATCCATGAATCCCTGTCCTGTGCACGACGCCGGAACCGGCACAGTGTTTCTGTTCTTTATCG CCGTGCTGGGCCACACACCTGAGGCCGTTCAAATTGCCACCGGCAGAAATGCCGCCAGACTG TGTTGTGTGGCCTCCAGAGATGCCGGCCTGTCTTGGGGATCTGCCAGAGATCTGACCGAGGA AGCCATTGGCGGAGCCGTTCAGGATTGGGCCACATTTGCTGTTGGACCTGGACACGGCGTGC AGCTGCCAAGTGGTAGACTGCTGGTGCCTGCCTACACATACAGAGTGGATCGGAGAGAGTGC TTCGGAAAGATCTGCCGGACAAGCCCTCACAGCTTCGCCTTCTACTCCGACGATCACGGCCG GACTTGGAGATGTGGTGGCCTGGTGCCTAATCTGAGAAGCGGCGAATGTCAACTGGCCGCCG TTGATGGTGGACAGGCTGGCAGCTTCCTGTACTGCAACGCCAGATCTCCTCTGGGCTCTAGA GTGCAGGCCCTGTCTACCGATGAGGGCACCAGTTTTCTGCCCGCCGAAAGAGTTGCCTCTCT GCCTGAAACAGCCTGGGGCTGTCAGGGCTCTATCGTGGGATTTCCTGCTCCTGCTCCAAACA GACCCCGGGACGATTCTTGGAGTGTCGGCCCTGGATCTCCACTGCAGCCTCCATTGCTTGGA CCAGGCGTTCACGAGCCACCTGAAGAGGCTGCCGTTGATCCTAGAGGCGGACAAGTTCCTGG CGGCCCTTTTAGCAGACTGCAGCCAAGAGGCGACGGCCCTAGACAACCTGGACCAAGACCTG GCGTCAGCGGAGATGTTGGCTCTTGGACACTGGCCCTGCCTATGCCTTTTGCCGCTCCTCCT CAGTCTCCTACCTGGCTGCTGTACTCTCACCCTGTTGGCAGACGGGCCAGACTGCACATGGG CATCAGACTGTCTCAGAGCCCTCTGGACCCCAGAAGCTGGACAGAGCCTTGGGTCATCTATG AGGGCCCTAGCGGCTACAGCGATCTGGCCTCTATTGGCCCAGCTCCTGAAGGCGGACTGGTG TTCGCTTGTCTGTATGAGAGCGGCGCCAGAACCAGCTACGACGAGATCAGCTTCTGCACCTT CAGCCTGCGCGAGGTGCTGGAAAATGTGCCCGCCTCTCCTAAGCCTCCTAACCTGGGCGATA AGCCTAGAGGCTGTTGCTGGCCATCT
[00371] SEQ ID NO: 27: MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKA
[00372] SEQ ID NO: 28: MDMRVPAQLLGLLLLWLPGARC
[00373] SEQ ID NO: 29: YGTL
[00374] SEQ ID NO: 30: MTVEKSWFKAEGEHFTDQKGNTIVGSGSGGTTKYFRIPAMCTTSKGTIWFADARHNTASD QSFIDTAAARSTDGGKTWNKKIAIYNDRVNSKLSRVMDPTCIVANIQGRETILVMVGKWNNN DKTWGAYRDKAPDTDWDLVLYKSTDDGVTFSKVETNIHDIVTKNGTISAMLGGVGSGLQLND GKLVFPVQMVRTKNITTVLNTSFIYSTDGITWSLPSGYCEGFGSENNIIEFNASLVNNIRNS GLRRS EE TKDFGKTWTE FPPMDKKVDNRNHGVQGS TITIPS GNKLVAAHS SAQNKNNDYTRS DISLYAHNLYSGEVKLIDDFYPKVGNASGAGYSCLSYRKNVDKETLYWYEANGSIEFQDLS RHLPVIKSYN
[00375] SEQ ID NO: 31: EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[00376] SEQ ID NO: 32: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL TSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[00377] SEQ ID NO: 33: EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLYCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[00378] SEQ ID NO: 34: ATGAGACCTGCGGACCTGCCCCCGCGCCCCATGGAAGAATCCCCGGCGTCCAGCTCTGCCCC GACAGAGACGGAGGAGCCGGGGTCCAGTGCAGAGGTCATGGAAGAAGTGACAACATGCTCCT TCAACAGCCCTCTGTTCCGGCAGGAAGATGACAGAGGGATTACCTACCGGATCCCAGCCCTG CTCTACATACCCCCCACCCACACCTTCCTGGCCTTTGCAGAGAAGCGTTCTACGAGGAGAGA - 108 - TGAGGATGCTCTCCACCTGGTGCTGAGGCGAGGGTTGAGGATTGGGCAGTTGGTACAGTGGG GGCCCCTGAAGCCACTGATGGAAGCCACACTACCGGGGCATCGGACCATGAACCCCTGTCCT GTATGGGAGCAGAAGAGTGGTTGTGTGTTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCAC AGAGCGTCAACAGATTGTGTCAGGCAGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGG ATGCTGGATGTTCATGGAGTGAGGTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTG AAGCACTGGGCCACATTTGCTGTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACT GGTCATCCCTGCGTATACCTACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTA AAACCAGGCCTCATTCTCTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGT AGACTCATTAGGCCCATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGG CCACCCTGTGCTATATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCA CTGACCATGGTGAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACAT GGTTGCCAAGGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGACTC TAGCAGCAAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGG AGGAAGCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAG AGGGTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCC CTGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGCT TGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGCCTG TTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGGAACCC AAGCCAATTCAAAAGCAAT
[00379] SEQIDNO:35: ATGATGAGCTCTGCAGCCTTCCCAAGGTGGCTGAGCATGGGGGTCCCTCGTACCCCTTCACG GACAGTGCTCTTCGAGCGGGAGAGGACGGGCCTGACCTACCGCGTGCCCTCGCTGCTCCCCG TGCCCCCCGGGCCCACCCTGCTGGCCTTTGTGGAGCAGCGGCTCAGCCCTGACGACTCCCAC GCCCACCGCCTGGTGCTGAGGAGGGGCACGCTGGCCGGGGGCTCCGTGCGGTGGGGTGCCCT GCACGTGCTGGGGACAGCAGCCCTGGCGGAGCACCGGTCCATGAACCCCTGCCCTGTGCACG ATGCTGGCACGGGCACCGTCTTCCTCTTCTTCATCGCGGTGCTGGGCCACACGCCTGAGGCC GTGCAGATCGCCACGGGAAGGAACGCCGCGCGCCTCTGCTGTGTGGCCAGCCGTGACGCCGG CCTCTCGTGGGGCAGCGCCCGGGACCTCACCGAGGAGGCCATCGGTGGTGCCGTGCAGGACT GGGCCACATTCGCTGTGGGTCCCGGCCACGGTGTGCAGCTGCCCTCAGGCCGCCTGCTGGTA CCCGCCTACACCTACCGCGTGGACCGCCGAGAGTGTTTTGGCAAGATCTGCCGGACCAGCCC TCACTCCTTCGCCTTCTACAGCGATGACCACGGCCGCACCTGGCGCTGTGGAGGCCTCGTGC CCAACCTGCGCTCAGGCGAGTGCCAGCTGGCAGCGGTGGACGGTGGGCAGGCCGGCAGCTTC CTCTACTGCAATGCCCGGAGCCCACTGGGCAGCCGTGTGCAGGCGCTCAGCACTGACGAGGG CACCTCCTTCCTGCCCGCAGAGCGCGTGGCTTCCCTGCCCGAGACTGCCTGGGGCTGCCAGG GCAGCATCGTGGGCTTCCCAGCCCCCGCCCCCAACAGGCCACGGGATGACAGTTGGTCAGTG GGCCCCGGGAGTCCCCTCCAGCCTCCACTCCTCGGTCCTGGAGTCCACGAACCCCCAGAGGA GGCTGCTGTAGACCCCCGTGGAGGCCAGGTGCCTGGTGGGCCCTTCAGCCGTCTGCAGCCTC GGGGGGATGGCCCCAGGCAGCCTGGCCCCAGGCCTGGGGTCAGTGGGGATGTGGGGTCCTGG ACCCTGGCACTCCCCATGCCCTTTGCTGCCCCGCCCCAGAGCCCCACGTGGCTGCTGTACTC CCACCCAGTGGGGCGCAGGGCTCGGCTACACATGGGTATCCGCCTGAGCCAGTCCCCGCTGG ACCCGCGCAGCTGGACAGAGCCCTGGGTGATCTACGAGGGCCCCAGCGGCTACTCCGACCTG GCGTCCATCGGGCCGGCCCCTGAGGGGGGCCTGGTTTTTGCCTGCCTGTACGAGAGCGGGGC CAGGACCTCCTATGATGAGATTTCCTTTTGTACATTCTCCCTGCGTGAGGTCCTGGAGAACG TGCCCGCCAGCCCCAAACCGCCCAACCTTGGGGACAAGCCTCGGGGGTGCTGCTGGCCCTCC
[00380] SEQ ID NO: 36: MRFKNVKKTALMLAMFGMATSSNAALFDYNATGDTEFDSPAKQGWMQDNTNNGSGVLTNADG MPAWLVQGIGGRAQWTYSLSTNQHAQASSFGWRMTTEMKVLSGGMITNYYANGTQRVLPIIS LDSSGNLWEFEGQTGRTVLATGTAATEYHKFELVFLPGSNPSASFYFDGKLIRDNIQPTAS KQNMIVWGNGSSNTDGVAAYRDIKFEIQGDVIFRGPDRIPSIVASSVTPGWTAFAEKRVGG GDPGALSNTNDIITRTSRDGGITWDTELNLTEQINVSDEFDFSDPRPIYDPSSNTVLVSYAR WPTDAAQNGDRIKPWMPNGIFYSVYDVASGNWQAPIDVTDQVKERSFQIAGWGGSELYRRNT SLNSQQDWQSNAKIRIVDGAANQIQVADGSRKYWTLSIDESGGLVANLNGVSAPIILQSEH AKVHSFHDYELQYSALNHTTTLFVDGQQITTWAGEVSQENNIQFGNADAQIDGRLHVQKIVL TQQGHNLVEFDAFYLAQQTPEVEKDLEKLGWTKIKTGNTMSLYGNASVNPGPGHGITLTRQQ NISGSQNGRLIYPAIVLDRFFLNVMSIYSDDGGSNWQTGSTLPIPFRWKSSSILETLEPSEA DMVELQNGDLLLTARLDFNQIVNGVNYSPRQQFLSKDGGITWSLLEANNANVFSNISTGTVD ASITRFEQSDGSHFLLFTNPQGNPAGTNGRQNLGLWFSFDEGVTWKGPIQLVNGASAYSDIY QLDSENAIVIVETDNSNMRILRMPITLLKQKLTLSQN
[00381] SEQ ID NO: 37: T T G T CAAT CAAGAT GAG T T CACAAC GAAGAAGAG CAT C GAT T CACAAG GAAACAGAT T C TAA TATAAAGGGAGTAGATATGCGTTTCAAAAACGTAAAGAAAACCGCTTTAATGCTTGCAATGT TCGGTATGGCGACAAGCTCAAACGCCGCACTTTTTGACTATAACGCAACGGGTGACACTGAG TTTGACAGTCCAGCCAAACAGGGATGGATGCAAGACAACACGAATAATGGCAGCGGCGTTTT AACCAATGCAGATGGAATGCCCGCTTGGTTGGTGCAAGGTATTGGAGGGAGAGCTCAATGGA CATATTCTCTCTCTACTAATCAACATGCCCAAGCATCAAGTTTCGGTTGGCGAATGACGACA GAAATGAAAGTGCTCAGTGGTGGAATGATCACAAACTACTACGCCAACGGCACTCAGCGTGT CTTACCCATCATTTCATTAGATAGCAGTGGTAACTTAGTTGTTGAGTTTGAAGGGCAAACTG GACGCACCGTTTTGGCAACCGGCACAGCAGCAACGGAATATCATAAATTTGAATTGGTATTC CTTCCTGGAAGTAACCCATCCGCTAGCTTTTACTTCGATGGCAAACTCATTCGTGACAACAT CCAGCCGACTGCATCAAAACAAAATATGATCGTATGGGGGAATGGCTCATCAAATACGGATG GTGTCGCCGCTTATCGTGATATTAAGTTTGAAATTCAAGGCGACGTCATCTTCAGAGGCCCA GACCGTATACCGTCCATTGTAGCAAGTAGCGTAACACCAGGGGTGGTAACCGCATTTGCAGA GAAACGTGTGGGGGGAGGAGATCCCGGTGCTCTGAGTAATACCAATGACATAATCACTCGTA CCTCACGAGATGGCGGTATAACTTGGGATACCGAGCTCAACCTCACTGAGCAAATCAATGTC AGTGATGAGTTTGATTTCTCCGATCCTCGGCCTATCTATGATCCTTCCTCCAATACGGTTCT TGTCTCTTATGCTCGATGGCCGACCGATGCCGCTCAAAACGGAGATCGAATAAAACCATGGA TGCCAAACGGTATTTTTTACAGCGTCTATGATGTTGCATCAGGGAACTGGCAAGCGCCTATC GATGTTACCGATCAGGTGAAAGAACGCAGTTTCCAAATCGCTGGTTGGGGTGGTTCAGAGCT GTATCGCCGAAATACCAGCCTAAATAGCCAGCAAGACTGGCAATCAAACGCTAAGATCCGAA TTGTTGATGGTGCAGCGAACCAGATACAAGTTGCCGATGGTAGCCGAAAATATGTTGTCACA CTGAGTATTGATGAATCAGGTGGTCTAGTCGCTAATCTAAACGGTGTTAGTGCTCCGATTAT CCTGCAATCTGAACACGCAAAGGTACACTCTTTCCATGACTACGAACTTCAATATTCGGCGT TAAACCACACCACAACGTTATTCGTGGATGGTCAGCAAATCACAACTTGGGCTGGCGAAGTA TCGCAGGAGAACAACATTCAGTTTGGTAATGCGGATGCCCAAATTGACGGCAGACTGCATGT GCAAAAAATTGTTCTCACACAGCAAGGCCATAACCTCGTGGAGTTTGATGCTTTCTATTTAG CACAG CAAAC C C C T GAAG TAGAGAAAGAC C T T GAAAAG CTTGGTTG GACAAAAAT TAAAAC G GGCAACACCATGAGTTTGTATGGAAATGCCAGTGTCAACCCAGGACCGGGTCATGGCATCAC CCTTACTCGACAACAAAATATCAGTGGCAGCCAAAACGGCCGCTTGATCTACCCAGCGATTG TGCTTGATCGTTTCTTCTTGAACGTCATGTCTATTTACAGTGATGATGGCGGTTCAAACTGG CAAACCGGTTCAACACTCCCTATCCCCTTTCGCTGGAAGAGTTCGAGTATCCTAGAAACTCT CGAACCTAGTGAAGCTGATATGGTTGAACTCCAAAACGGTGATCTACTCCTTACTGCACGCC TTGATTTTAACCAAATCGTTAATGGTGTGAACTATAGCCCACGCCAGCAATTTTTGAGTAAA GATGGTGGAATCACGTGGAGCCTACTTGAGGCTAACAACGCTAACGTCTTTAGCAATATCAG TACTGGTACCGTTGATGCTTCTATTACTCGGTTCGAGCAAAGTGACGGTAGCCATTTCTTAC TCTTTACTAACCCACAAGGAAACCCTGCGGGGACAAATGGCAGGCAAAATCTAGGCTTATGG TTTAGCTTCGATGAAGGGGTGACATGGAAAGGACCAATTCAACTTGTTAATGGTGCATCGGC ATAT T C T GATAT T TATCAAT T GGAT T CGGAAAAT GCGATTGTCATTGTT GAAACGGATAAT T CAAATATGCGAATTCTTCGTATGCCTATCACATTGCTAAAACAGAAGCTGACCTTATCGCAA AACTAA
[00382] SEQ ID NO: 38: MVGADPTRPRGPLSYWAGRRGQGLAAIFLLLVSAAESEARAEDDFSLVQPLVTMEQLLWVSG KQIGSVDTFRIPLITATPRGTLLAFAEARKKSASDEGAKFIAMRRSTDQGSTWSSTAFIVDD GEASDGLNLGAWNDVDTGIVFLIYTLCAHKVNCQVASTMLVWSKDDGISWSPPRNLSVDIG TEMFAPGPGSGIQKQREPGKGRLIVCGHGTLERDGVFCLLSDDHGASWHYGTGVSGIPFGQP KHDHDFNPDECQPYELPDGSVIINARNQNNYHCRCRIVLRSYDACDTLRPRDVTFDPELVDP WAAGALATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWLKERVQVWPGPSGYSSLTALEN STDGKKQPPQLFVLYEKGLNRYTESISMVKISVYGTL
[00383] SEQ ID NO: 39: MTVQPSPWFSDLRPMATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKTDEH AELIVLRRGSYNEATNRVKWQPEEWTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVS EHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGHCLQLRNPAG SLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVAEVGTGAQRMVYL NARSFLGARVQAQSPNDGLDFQDNRWSKLVEPPHGCHGSWAFHNPISKPHALDTWLLYTH PTDSRNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMGQGPDGSPQFGCLYESGNY EEIIELIFTLKQAFPTVFDAQ
[00384] SEQ ID NO: 40: MEEVPPYSLSSTLFQQEEQSGVTYRIPALLYLPPTHTFLAFAEKRTSVRDEDAACLVLRRGL MKGRSVQWGPQRLLMEATLPGHRTMNPCPVWEKNTGRVYLFFICVRGHVTERCQIVWGKNAA RLCFLCSEDAGCSWGEVKDLTEEVIGSEVKRWATFAVGPGHGIQLHSGRLIIPAYAYYVSRW FLCFACSVKPHSLMIYSDDFGVTWHHGKFIEPQVTGECQVAEVAGTAGNPVLYCSARTPSRF RAEAFSTDSGGCFQKPTLNPQLHEPRTGCQGSWSFRPLKMPNTYQDSIGKGAPATQKCPLL DSPLEVEKGAETPSATWLLYSHPTSKRKRINLGIYYNRNPLEVNCWSRPWILNRGPSGYSDL AWEEQDLVACLFECGEKNEYERIDFCLFSDHEVLSCEDCTSPSSD
[00385] SEQ ID NO: 41: METAGAPFCFHVDSLVPCSYWKVMGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAF AEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLF FIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGH GVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQL AAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEP QDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDG DKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPS GYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQG HCWPS
[00386] SEQ ID NO: 42: GGGTCACATGCTGATGGACTAATTGGAGTCGCGGCAGCGCGGGCTGCGGCCCCCAAGGGGAG GGGTCGGAGTGACGTGCGCGCTTTTAAAGGGCCGAGGTCAGCTGACGGCTTGCCACCGGTGA CCAGTTCCTGGACAGGGATCGCCGGGAGCTATGGTGGGGGCAGACCCGACCAGACCCCGGGG - Ill - ACCGCTGAGCTATTGGGCGGGCCGTCGGGGTCAGGGGCTCGCAGCGATCTTCCTGCTCCTGG TGTCCGCGGCGGAATCCGAGGCCAGGGCAGAGGATGACTTCAGCCTGGTGCAGCCGCTGGTG ACCATGGAGCAGCTGCTGTGGGTGAGCGGGAAGCAGATCGGCTCTGTAGACACTTTCCGCAT CCCGCTCATCACAGCCACCCCTCGGGGCACGCTCCTGGCCTTCGCTGAGGCCAGGAAAAAAT CTGCATCCGATGAGGGGGCCAAGTTCATCGCCATGAGGAGGTCCACGGACCAGGGTAGCACG TGGTCCTCTACAGCCTTCATCGTAGACGATGGGGAGGCCTCCGATGGCCTGAACCTGGGCGC TGTGGTGAACGATGTAGACACAGGGATAGTGTTCCTTATCTATACCCTCTGTGCTCACAAGG TCAACTGCCAGGTGGCCTCTACCATGTTGGTTTGGAGTAAGGACGACGGCATTTCCTGGAGC CCACCCCGGAATCTCTCTGTGGATATTGGCACAGAGATGTTTGCCCCTGGACCTGGCTCAGG CATTCAGAAACAGCGGGAGCCTGGGAAGGGCCGGCTCATTGTGTGTGGACACGGGACGCTGG AGCGAGATGGGGTCTTCTGTCTCCTCAGTGATGACCACGGTGCCTCCTGGCACTACGGCACT GGAGTGAGCGGCATTCCCTTTGGCCAGCCCAAACACGATCACGATTTCAACCCCGACGAGTG CCAGCCCTACGAGCTTCCAGATGGCTCGGTCATCATCAACGCCCGGAACCAGAATAACTACC ATTGCCGCTGCAGGATCGTCCTCCGCAGCTATGACGCCTGTGACACCCTCAGGCCCCGGGAT GTGACCTTCGACCCTGAGCTCGTGGACCCTGTGGTAGCTGCAGGAGCACTAGCCACCAGCTC CGGCATTGTCTTCTTCTCCAATCCAGCCCACCCTGAGTTCCGAGTGAACCTGACCCTGCGCT GGAGTTTCAGCAATGGTACATCCTGGCAGAAGGAGAGGGTCCAGGTGTGGCCGGGACCCAGC GGCTACTCGTCCCTGACAGCCCTGGAAAACAGCACGGATGGAAAGAAGCAGCCCCCGCAGCT GTTCGTTCTGTACGAGAAAGGCCTGAACCGGTACACCGAGAGCATCTCCATGGTCAAAATCA GCGTCTACGGCACGCTCTGAGCCCCGTGCCCAAAGGACACCAAGTCCTGGTCGCTGACTTCA CAGCTCTCTGGACCATCTGCAGAGGGTGCCTGAAACACAGCTCTTCCTCTGAACTCTGACCT TTTGCAACTTCTCATCAACAGGGAAGTCTCTTCGTTATGACTTAACACCCAGCTTCCTCTCG GGGCAGGAAGTCCCTCCGTCACCAAGAGCACTTTTTTCCAGTATGCTGGGGATGGCCCCTGT CCATTCTCTTCCAGGACAACGGAGCTGTGCCTTTCTGGGACAGGATGGGGGAGGGGCTCCCC CTGGAGAGATGAACAGATACGAACTCAGGGAACTGAGAAGGCCCGGTGTCCTAGGGTACAAA GGCAGGTACTAGATGTGATTGCTGAAAGTCCCCAGGGCAGAGTGTCCTTTCAGAGCAAGGAT AAGCACACCTACGTGTGCACCTTTGATTATTTATGAATCGAAATATTTGTAACTTAAAATTT TTGATGCAGAAAAAGCGTTTGTGGAGTCTGTGGTTCTGTCTGCTCACGCCTTCCCAATTGCC TCCTGGAGAGACAGGAAGGCAGCTGGAAGAGGAGCCGATGTACTTACTGGGAAGCAGAAACC CCTAGATTCCATCCTGGCTGCTGCTGTTTGCAAGTGTCAAAGATGGGGGGGCGTGTTTATAT TTTATATTTCTAAGATGGGGTGGCATAGGAAATAGGGAACAGATGTGTAAAACCAGATGGGA AGGACAGTCTGTGAGAAAGGAGCAAGCAGTTGCTGCAGGTGTGGGAGAGCAAAGCCCTTCTC CACGTGGAAAGAGCCCAGATGGACGCTAAGCATGTTGGGCACCTGTAACCCCGCACTCGCTG GACTGACGGTGTAGCTCAGTGGTGGAGCTAGTACTTGGAACGCCTAAGACTCTGGGTTCAGT CCTTGGGGGGGGGGGTATGTGTTTATTGAGAGGAAGGTGTACGTACTGTAGGTCAGAGGACA GCTTACTGGAGTTGTCTCTCTCCTTCACGCTGTGAGTCCTGTGGAATGACCTCAGGTGTCAG AGTTGGGGGCAGGTGCCTTTGCCAGCTGAGCCATCTTGCTGTCTCTGCTTTAATTTAAAAAA AAAAAAAAAAAAGAATATTAAGGTCTGAGGGATTCGGGCTGCGTTCATTTCAATTAGAGGGT CATATTTCTTTTGACATTTCTTCTCTAAGAAATGTTAAGATCATTTGTTCTGTGTGATAGAG GTATAGCTCCATTGTATGTCAGCAGTGAGGGATCCTGTGCATTTTATCCAGAGTTTGTACGG TGTTCTAGGGGCTGCTAGTGCAGCCCAGTGCTAAACACTTCAGCATGCACAAGGCCTCAATC AG T G CAT G CAT G T G CACACACACACAGACACACAC G TAGACAC T GACACAG G TACACAAATA CACAC T G G C C CACAT G TACACAT C GAC T CACAG G TAGACAGAC C CAC T T T GACACACATATA CACAGACACAAACGCAC T GGCACACACATATACACAGGCACACAT GGATAGAT GGACACACG T G TAGACATACACACACACACAGAAATACAAAT G T T CAG G T T T T C TAAAAAAAAAAAAAT TA GAGACGTGTTGACTTCATTTTTAGCAAAAATCCTGTCATGTATCTTAAAGTGGATTGAACCC ACTATGTAGCCCAGGCTGGCCTCCAAATGGGCATCCTTCTGCCTCAGTCTCCCGAGGGCTAG GATAACAGGAGTATGCCATCACACCTGGCTAATAGAAATTTTCAAAATTGTTTGTTTGAAGG TGACTCTTACTATATTGCCTAACTGATCTCCAGTTCGTGAAATCCTCCTGCCTCAGAACCAG GAC T G T CAATATAAC C CAC CAAGACAG G C CAACAT T CACAAT TGATTGTTAGTTTGTGGTCT GAATCAAGGTCTTATACTGTAGCCCAGGCTAGCCCGGAATACACGATATCTCCAGTGCTTCA GAT C C T GAG T T C TAAC TAAG CAT G G C GAGAT C CAT G T T TAAC T G CAAAT T T GAT G T TAC CAT GGTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTGGTTTTTTGGCCATTTTTTTTT TCTCATGCTGAGGCCTTGTGCTCTCAAGTTGGGGAGACAGCATGGAGGGTAGCTGCAACTGT AACCCCAGTTCCAGGGGACCTGACACCCTCTGGCCTCCACAAGTATTAGGCACATCTGTGGT GCACAGACATACAAT CAGGCAAAATAT T CATACACATAAAATAAAATAAT T TAAAACAAAAG CAAAAATCAGGACCTAAGAAAAAAATCTATTCCTGATTCTTTTATGTTTTGTTTGTATTTTA TCAAGACAGGGTTGTTTCTCTGTATAGCCCTGGCTGTCTTGGAATTCACTCTGTAGACCAGG CTGGCCTCAAACTCAGAAATCCTCCTGCCTTTGCCTTCCAAGTGCTGGAATTAAAGGCATGC GCCACC
[00387] SEQIDNO:43: GACATGACCCAAACGGCCCCTGGCTGCAAGGTAATATCGGAAGTTGACTAAGAATGGACGCC CCACCACTGACTGACCCGCCCCCTGAGTCTGAGATTGGACTTGTCTCTGGATACAGTCATAC T T T GAG G TAC TAGAAG T TAGAAAC TGTTAGGTTACT CAG T T CAG T C CAT GACAG T C CAAC C T TCTCCATGGTTTTCCGATCTCAGGCCCATGGCGACCTGCCCTGTCCTGCAGAAGGAGACACT GTTCCGCACAGGCGTCCATGCTTACAGAATCCCTGCTCTGCTCTACCTGAAGAAGCAGAAGA CCCTGCTGGCCTTTGCGGAAAAGCGAGCCAGCAAGACGGATGAGCACGCAGAGTTGATTGTC CTGAGAAGAGGAAGCTACAACGAAGCCACCAACCGTGTCAAGTGGCAGCCTGAGGAAGTGGT GACCCAAGCCCAGCTGGAAGGCCACCGCTCCATGAATCCATGTCCCTTGTATGACAAGCAAA CAAAGACCCTCTTCCTTTTCTTCATCGCTGTCCCTGGGCGTGTATCAGAACATCATCAGCTC CACACTAAGGTTAATGTCACACGGCTGTGCTGTGTCAGCAGCACTGACCATGGGAGGACCTG GAGCCCCATCCAGGACCTCACAGAGACCACCATTGGCAGCACTCATCAGGAATGGGCCACAT TTGCTGTGGGTCCTGGGCATTGTCTGCAGCTGCGGAACCCAGCTGGGAGCCTGCTGGTACCT GCTTATGCCTACCGGAAACTGCACCCTGCTCAGAAGCCTACCCCCTTTGCCTTCTGCTTCAT CAGCCTTGACCATGGGCACACATGGAAACTAGGCAACTTTGTGGCTGAAAACTCACTGGAGT GCCAGGTGGCTGAGGTTGGCACTGGAGCTCAGAGGATGGTATATCTCAATGCTAGGAGCTTC CTGGGAGCCAGGGTCCAGGCACAAAGTCCTAATGATGGTCTGGATTTCCAGGACAACCGGGT AGTGAGTAAGCTTGTAGAGCCCCCCCACGGGTGTCATGGAAGTGTGGTTGCCTTCCACAACC CCATCTCTAAGCCACATGCCTTAGACACATGGCTTCTTTATACACACCCTACAGACTCCAGG AATAGAACCAACCTGGGTGTGTACCTAAACCAGATGCCACTAGATCCCACAGCCTGGTCAGA GCCCACCCTGCTGGCCATGGGCATCTGTGCCTACTCAGACTTACAGAACATGGGGCAAGGCC CTGATGGCTCCCCACAGTTTGGGTGTCTGTATGAATCAGGTAACTATGAAGAGATCATTTTC CTCATATTCACCCTGAAGCAAGCTTTCCCCACTGTATTTGATGCCCAGTGATCTCAGTGCAC GTGGCCCAAAGGGCTTCCTTGTGCTTCAAAACACCCATCTCTCTTTGCTTCCAGCATCCTCT GGACTCTTGAGTCCAGCTCTTGGGTAACTTCCTCAGGAGGATGCAGAGAATTTGGTCTCTTG ACTCTCTGCAGGCCTTATTGTTTCAGCCTCTGGTTCTCTTTTCAGCCCAGAAATCAAAGGAG CCTGGCTTTCCTCAGCCTGTTGGCAGGGCAGGTGGGGACAGTATATATAGAGGCTGCCATTC TGCATGTCGGTTGTCACTATGCTAGTTTAACCTGCCTGTTTCCCCATGCCTAGTGTTTGAAT GAG TAT TAATAAAATAT C CAAC C CAG CCCATTTCTTCCTG GAAAAAAA
[00388] SEQ ID NO: 44: ACTGCGCGGTGAAGGGGCGTGGCCTGGCCGGGGAGGTTGACACCCAGACGCTGCTCTCAGTC CTCTGGCGCCTGCTCCCCAGCGCATTCCTTCTGCTCCTGGGATATTTGTCTCATTACTGCCA GTTCTTGCGCAGCGGTCACTGGGTTCGTTTCAGCGTCTGTGGTTTCTGTCGCTGTTATCCAG TCTCCATCGCCCCAGCTCAGCTTCAGGCCTTCTTCCGAGACTCCACGGGAGAGCCCAGAGAG CCTCCGGAGCCGAAGCCATGGAGGAAGTCCCACCCTACTCCCTCAGCAGCACCCTGTTCCAG CAGGAAGAACAGAGTGGGGTGACCTACCGGATCCCAGCCCTGCTGTACCTTCCTCCCACCCA CACCTTCCTGGCCTTTGCAGAGAAGCGGACCTCAGTCAGAGATGAGGATGCTGCCTGCCTGG TGCTCAGACGAGGGCTGATGAAGGGGCGCTCTGTACAGTGGGGCCCCCAACGGCTACTGATG GAGGCCACATTACCTGGGCATCGCACCATGAACCCCTGCCCTGTGTGGGAGAAAAATACTGG CCGTGTGTACCTGTTTTTCATCTGTGTGCGGGGCCATGTTACTGAGAGGTGCCAGATTGTGT GGGGCAAAAATGCCGCCCGTCTCTGCTTCCTTTGCAGTGAAGATGCCGGCTGCTCTTGGGGT GAAGTGAAAGACTTGACCGAGGAGGTCATTGGCTCAGAGGTGAAGCGCTGGGCCACATTTGC TGTGGGCCCAGGTCATGGCATCCAGCTACACTCGGGAAGGCTGATCATCCCCGCCTATGCCT ACTATGTCTCACGTTGGTTTCTCTGCTTTGCGTGTTCAGTCAAGCCCCATTCCCTGATGATC TACAGTGATGACTTTGGAGTCACATGGCACCATGGCAAGTTCATTGAGCCCCAGGTGACAGG GGAGTGCCAAGTGGCCGAAGTGGCTGGGACGGCTGGTAACCCTGTGCTCACTGCAGTGCCCG AACACCAAGCCGATTTCGAGCAGAGGCTTTTAGTACTGATAGTGGTGGCTGCTTTCAGAAGC CAACCCTGAACCCACAACTCCATGAGCCTCGAACCGGCTGCCAAGGTAGTGTAGTGAGCTTC CGGCCTTTGAAGATGCCAAATACCTATCAAGACTCAATTGGCAAAGGTGCTCCCGCTACTCA GAAGTGCCCTCTGCTGGACAGTCCTCTGGAGGTGGAGAAAGGAGCTGAAACACCATCAGCAA CATGGCTCTTGTACTCACATCCAACTAGCAAGAGGAAGAGGATTAACCTAGGCATCTACTAC AACCGGAACCCCTTGGAGGTGAACTGCTGGTCCCGCCCGTGGATCTTGAACCGTGGGCCCAG TGGCTACTCTGATCTGGCTGTTGTGGAAGAACAGGACTTGGTGGCGTGTTTGTTTGAGTGTG GGGAGAAGAATGAGTATGAGCGGATTGACTTCTGTCTGTTTTCAGACCATGAGGTCCTGAGC TGTGAAGACTGTACCAGCCCTAGTAGCGACTAAAGCCAAATCAAGACGGATGAGTGAGGCCC AGCTTCCCACAGAAAGGAATGGCAGCTACAGCCAGGGTAACAGAGGTCTCTGATGTCTAGAG AAAACTCTAAAAACTAATAATCTGCTCCTTGAATTTTTTCACTTTTCCCTTCAATGAGCATG GTGAAAATTGTGCCATATCTTACATAACGAGGCTCTTGAACTGGGAGTTTGAATCTCTTCTC TTCCCATTAAAAGGAGAGGCCATGTGCTCGCTTCGCGTTCGACAAAGCCTGGATTCTGATCT TGAGTGGAAGCCACAGGCTTGTCTTTTCCAATGGTTCACTGCTCACCTGAGTATTAGGTGAT GTGTAGGTGCCTTGGCCAGAAGAAAGATCTGTGTTGTTGTATTTTTTTAAATTTATTTATTT AC TATAT G TAAG TAGAC T GCAG C T G T C T T CAGACACAC CAGAAGAG G G C G T CAGAT C T CAT T AGAGATGGTTGTGAGCCACCATGTGGTTGCTGGGATTTGAACTCAGGACCTTCAGAAGAGCA GTCAGTGCTCTTAACTACTGAGCCATCTCTCAAGCCCCGCATTGCTGTATTTTTAATAAGAA AAATGCCCTTATCCTTCCAATAATGCCTGGAGCTGTACAAATTCTCTGTCTTAGAAGACTTG AGAAAGCAGAACTGTAAGGTCAGATGCTTTCTCCAGCCTTGATGCTGTGTTCCACCTTCCCT TCCTCATCCAGAAAACAGTTACTAGGGAGAAAATGAGAAACCCATGCCAGCTGCCCTTGATG ATGGTTGATAACGGTGCTTATTGCTTTTGATGTCATTACCTCTGTTAGAGATGAATCAGAGT CAGAGGTCCTTAGCTGCATCCACCCATTTCCAGGGGGACATTCTAACACTGCTGAACAGTCA GCTAAAATGAGAGCTGTGTGTCCTAGCCTGATTCCAGGTTAGTCATGATGCTTCCTGGAGCT GGGCTTTTATCTAATCCCAGGAGCCATCTAGGGGAGGCTCAGAGCTAGCAGGTGATCTTCCT GAGATGGTTTCACCGTGACAGGTGAACCATGAGCCCTTCCAAGCAAGGCCAAAGGACAACAT TATAGGAAAGATTTCTAGTATTAATATGCCTTTTCTCTGTGTGTGTACTGTCTTGTAGTGAT GCTATATAGACAAATAGATGATTTCTTATTTTTTGTTTGTTTGTTTGTTTTTTTGTTTTTCT GTAGCCCTAGCTGTCCTGGAACTCACTTTGTAAACCAGGCTGGCCTCGATCTCAGAAATCCG CCTGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGTGTGCACCACCACACCTTAATGATGATC C TATAAG TAT T C C TAAAAT TATACTAGTAATTAT TAAC TCCTTTATAATAG GAC TGCTATTA AAG CCCTCGCTGATAT GAAAAC TAGAG T GAGAAC T C T G C CAG T C T T CACAT G T CATAAT TAC T T C T GAGATAGAAAGCAGGCAT T TACAAC T TAGAACACAT T T C T TAGAGC T GTAAAACAAT T AAC TAGAGGT CATAAAAGGGAAT GAAAGAT T TAT T GTAGGT GC TAGGACAGAACATAAAATA T T GAC T GGGC T TAT C TATAT GAAAC T T CAT T GT TAAC T T T TACACAAGAAT TAT GGT T T T TA AC T T T CAG T GAAC C T G C G GAG C TAG T GACAGAAGAGAAAT G T C TAG T TAGATAAC TAC T C T T AATGGAAATTCACATAAACATCTGTTGCCATCTTCTTTTTGAATTTATGTTTAAACTTGTGA AT G T T T GAAT TAGACAC TAC G C GAG CACATAGAAAATAAAGAAC TAAG C G T GAA
[00389] SEQIDNO:45: GGACAGTGTGCATCACGGAGCTTGTGGCCCAGACTGTGCCTGGCAGACCCAGAGGACCTAAG GCTTGGCTCTAGTGGTGGTCAGCACAGCCCTCGGTGGTCTGCGGAGCCTGATATTGCTTTAC GTAAGGGCTGTTCTGCTGTGCATCTCCTGTGTCTGAAGCTATTCGCCATGGAGACTGCTGGA GCTCCCTTCTGCTTCCATGTGGACTCCCTGGTACCTTGCTCCTACTGGAAGGTTATGGGGCC CACGCGTGTTCCCAGGAGAACGGTGCTCTTCCAGAGGGAAAGGACGGGCCTGACCTACCGTG TGCCTGCGTTACTCTGTGTGCCTCCCAGGCCTACTCTGCTGGCCTTCGCGGAACAGCGACTT AGCCCTGATGACTCCCATGCCCACCGCCTGGTGCTACGGAGGGGCACGCTGACCAGGGGCTC AGTGCGGTGGGGCACTCTGAGTGTACTGGAGACTGCAGTACTGGAGGAGCACAGGTCTATGA ACCCTTGCCCGGTGCTGGATGAGCACTCTGGTACCATCTTCCTCTTCTTCATTGCCGTGCTG GGCCACACACCGGAGGCCGTGCAAATCGCCACTGGCAAGAACGCTGCTCGCCTCTGCTGTGT GACCAGCTGTGACGCTGGCCTCACCTGGGGCAGTGTTCGAGATCTCACTGAGGAAGCCATTG GTGCTGCATTGCAGGACTGGGCCACCTTTGCTGTGGGTCCGGGCCATGGAGTTCAGCTGCGC TCGGGTCGCCTGCTTGTTCCTGCTTACACCTATCATGTGGACCGACGGGAATGTTTTGGCAA GATCTGCTGGACCAGTCCCCACTCCTTGGCATTCTACAGTGATGATCATGGGATCTCCTGGC ATTGTGGAGGCCTTGTGCCCAACCTACGCTCTGGAGAGTGCCAACTGGCTGCGGTAGATGGA GACTTTCTCTACTGTAATGCTCGAAGCCCTCTGGGTAACCGTGTGCAGGCACTGAGTGCTGA TGAAGGCACGTCCTTCCTACCAGGGGAGCTGGTGCCTACATTGGCAGAGACGGCTCGTGGTT GCCAGGGTAGCATTGTGGGCTTCCTAGCTCCACCCTCAATCGAGCCTCAGGATGACCGGTGG ACAGGGAGTCCTAGGAACACCCCACATTCCCCATGCTTCAATCTCAGAGTACAGGAGTCTTC GGGGGAAGGTGCCAGAGGTCTTCTTGAACGTTGGATGCCCAGGTTGCCTCTCTGCTACCCAC AGTCCCGGAGCCCAGAGAATCATGGCCTAGAGCCTGGGTCAGATGGAGATAAGACATCCTGG ACTCCGGAATGTCCTATGTCCTCTGATTCCATGCTTCAGAGCCCCACATGGCTACTATATTC CCACCCAGCAGGGCGTAGAGCTCGGCTCCACATGGGAATCTACCTGAGCCGATCCCCCTTGG ATCCCCACAGCTGGACAGAGCCCTGGGTGATCTATGAGGGCCCCAGTGGCTACTCTGACCTT GCCTTTCTTGGGCCTATGCCTGGGGCATCCCTGGTTTTTGCCTGTCTGTTTGAGAGCGGGAC CAGGACTTCCTATGAAGACATTTCTTTTTGCTTGTTCTCACTGGCGGATGTCCTGGAGAATG TGCCCACTGGCTTAGAGATGCTAAGTCTCAGGGATAAGGCTCAGGGGCATTGCTGGCCCTCT TGATGGCCTCACCCTCTCGTAGCCGCCTGGAGAGGAAGGGTAGACTATATAGAGGAGGTTAG GGGTAGGTCAGCATGATGCTAGGATGGAGAGAGCTCTGTCCCCTCGTGGATGGTGGTGGTGA CTCACCCGGGGGGCCAGCTGCTTTCTGAGTGCAAATGAGAAAAATAAAGAGCTGCGCTGTGA CTTTTCTTTCCACATCAAAGCTTGGGTGTCAGTGCTTTAGCTTGATGCTCTGATCACCATGC AAATCTTCCACCGGCGCCTTGCTCAGCTTTCATATCCCAAGGGTGCCTGGGAGGAAGGCAAC AGGGACAGTGGACATCACTGCACCACTTTCCACGACCCTGTGTGCCAACCTCAGCCACTTTG AAACATGCTGATGACTGAGGTCTGTTCACTTTCTTAATTTCAAGCAGGAGAAGCAGGTTGGG GAGCCAGCCTCCCCAGCTAGAGGGGACAGAACTTGACTTGAGCAGGGGGGTACCTCCTAGGA CCTGCTCCATGTGCCTACTTCTTTACCCTTCTCTAGAGAGGGCTCTTGTCCTGTCAGAGCTG TTTTCTCCCTTCTCTTGTTTTTTCTTTTTCAAGACTGTTTCTCTGTGTTAGCCCTGGCTGTC CTGGATCTCACTCTGTAGATCAGGCTGACCTTGAGTTCAAAGCTCCATCTGCCTCTACTTCT CACATTACTGTGATTAAAGGCATATACTACCACTGCCTGGTGCCCTTTTGTATTTCTTATTA AAGTCCTAATGTCTGATTATAAAAACAGTCTGTGTGGGCTGGAGTGATGGCTTACTCAGTAA AGCACTTGCCATGGAATCTGGGCAATCTGAGTTTCATTTTTAGCATCCTGTAAAAATCCCAA TTTGATGGTGTACTTGTAATGTCAGCATGGAGAGGCAGAGATAGGTAAGTTCCCCAAGACTC TTTGAACCGACAGCTTGGCCTCACTGGCACATTCCAGGTCTCAGTGAGAGACCCTGCCTCAA AATACAAAGAAAGAGCTGCTGAAGAGTGGGTCAGAGTTGACCTCTGATCTCCGGAAGTATAT GATACACAC CCGTGCATG CAC T C T T C C T TACAAAATAAAAAG CAAAACAAAAC C C CAACAG G TATAT GGCCAT T T TAGAAAAAT TAGAAGAT T TAGAAAGC TATACATAAAAAAAAAT GACC TA AAGAAAAATCTTTACTGTTCTGGGCACTATCCCTATCAAACCACTGTGTTCTTTGGCCAAGC CTTGGGGTGGACACTGTTTTGAGGTGGGTCCTGTTATCTCCACTAGGTAGTGGAGTTTTGTG TCAGACTAACTGGGTCTTAAAGCTGTCTTTAAGGCCATCAGGAGCTACTGACTTGCCTGCCT CAGCAGAGCATATCCTGAAGGTCGGGGTTAAGTCTCCTTCCCGAGCGAGTTGCCTTCCAGTG GGCCCCTGGACTCCTAGGTCCTCAGCGCTCATCAGCTGCCAAGGACTCTGAGGGAATGTCCT CTGACTGTGGCCCCGAAAGGTAGGGGAGGGGGATGTGCTTAGGCTTAGGACAGGGTCCTGTT TCAGTCTGCCTTCACTGTTAGTAGCACTGTGCCACATGGCACAGACTGGGCGAGCTTTAAAG GAAGGAGGTTGATATTGGTTCCCACTTCTGGGGATCATGGTTGAGCAGCCTTGTCTGATGAT GGTTGTCTTGATGGTAGATCGTGAGGTAGTTGATGAAGGTATGACATGGTGAGAAACTCTGT GTGTGTGTGTTATTTTCTCTGTGTTCTACCTATACATCTATCTATGTATATATGTATCTATC TATCTACCTGGAGGCTGGAGAGATAGCTTAGTGGTTAAGAACATTTGTTGTTCTTGCATAGT C C T G GAT T TAAAT T T T CAGCAC C GAGAT G G GAG C T CACAACAAC C CATAAAT C CAG T T T CAG AGGATCCAACCTCTGATATACCATGTCAGCCAGAGCAGACACGGCTGAAGGTGGTTTGATCC CCGTATGGAGAGGTGACAATTGGGAAGAGAGAAAGATCAACTTAACCATGCAAGGAACAGGA AGTTAAATACTGAACAGGGAAGGTAAAGGCAGGAAGTAGATGTAGAGGGCAAATCAATGAAA CCCAAACATACCCAAATTACGCTAAACACACACTGACATGCCAATTAAAAGGACAAATTGGC TCCACTGGCAAAACCAAAACAGACACTGAAGATCCAAACAGTCACATGCCAACTACCGCGGA GGGAGACAGACACAGAGAAGACCGTGACAGACACTTGGACACTCTTGAGAGTGGATGTGCAG GAAGAGAGC T C T GCCAGT GGAGAAGAAAGCAC T CAGAAGAAAGT GACAGCAGC T GTAAAT T T GTATTCTGCTAATGTTATGTTC CAAAG T T GAAAG CAAAAT T G TAC CAAT T CATAAGAACAAA CAGGCTGACTCTCAGTTGTGACTGAACGTCTCTCAGTAACTGACGGGGCGAGCAGGCCAAAG GAGAGTCGGCTCAGAAGGGTGCATAGCCACGCCAAATCAAATAAGCAAGTACAACCGGCAGG CTCTATTTCTAGCACAAAGGGGTCTGTGCCTCATTCTGTGCTTGGGTCAGAGCTTGGGTCTC TCATTTGGATGTAAGTGGTGTAGTGGAGAAGCAGGAAATAATCCGGAGCGCATATTTTGATT TTAACATAAGTGCTGATTTGGGAGGGAGTTTTGTCAAATTGTGTTTTTACAATGTTTTTTTT TTTTTAAATGATGCTTTTTTGTAAAGTGTACAAATGTGATATAAGATTGGTTCTGCTACATT CAGTTTCTATAAAAGTGGTTCTAAAATATTGTACTGTCAATCATCTCATGATTATTCTACTG TAGACAT TACT GAC TTTGTATGTAATAATTAATAT TAGAAGAAAATATAAT T TAT T T GAATA TAAAAAAAAAAAAAAAAAAA
[00390] SEQ ID NO: 46: X1ASLPX2LQX3ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYD AX4THQVQWQAQEWAQARLDGHRSMNPCPLYDX5QTGTLFLFFIAIPGQVTEQQQLQTRANV TRLCQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRK LHPX6QRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQ AQSTNDGLDFQESQLVKKLVEPPPXvGCQGSVISFPSPRSGPGSPAQWLLYTHPTHXgXgQRA DLGAYLNPRPPAPEAWSEPVLLAKGSX10AYSDLQSMGTGPDGSPLFGCLYEANDYEEIX11FX 12MFTLKQAFPAEYLPQ
[00391] SEQ ID NO: 47: X1X2SX3X4X5LQX6ESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASX7X8DEHAELIVX9RR GDYDAX10THQVQWX11AQEWAQAX12LDGHRSMNPCPLYDX13QTGTLFLFFIAIPX14X15VT EX16QQLQTRANVTRLX17X18VTSTDHGRTWSSPRDLTDAAIGPX19YREWSTFAVGPGHX20LQ LHDRX21RSLWPAYAYRKLHPX22QRPIPSAFX23FLSHDHGRTWARGHFVAQDTX24ECQVAE VETGEQRWTLNARSHLRARVQAQSX25NX26GLDFQX27SQLVKKLVEPPPX28GX29QGSVISF PSPRSGPGSPAQX30LLYTHPTHX31X32QRADLGAYLNPRPPAPEAWSEPX33LLAKGSX34AYS DLQSMGTGPDGSPLFGX35LYEANDYEEIX36FX37MFTLKQAFPAEYLPQ
[00392] SEQ ID NO: 48: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAG THQVQWQAQEWAQARLDGHRSMNPCPLYDEQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00393] SEQ ID NO: 49: DASLPYLQDESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDEQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIRFIMFTLKQA FPAEYLPQ
[00394] SEQ ID NO: 50: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAN THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00395] SEQ ID NO: 51: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPAGCQGSVISFPSPRSGPGSPAQWLLYTHPTHRKQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00396] SEQ ID NO: 52: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAS THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPAGCQGSVISFPSPRSGPGSPAQWLLYTHPTHRKQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00397] SEQ ID NO: 53: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAT THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPAGCQGSVISFPSPRSGPGSPAQWLLYTHPTHRKQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00398] SEQ ID NO: 54: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAN THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPAGCQGSVISFPSPRSGPGSPAQWLLYTHPTHRKQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00399] SEQ ID NO: 55: ASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPT HQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLC QVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLWPAYAYRKLHPK QRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQST NDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYL NPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAF PAEYLPQ
[00400] SEQ ID NO: 56: MASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00401] SEQ ID NO: 57: ASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPT HQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLC QVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLWPAYAYRKLHPK QRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQST NDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYL NPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAF PAEYLPQ
[00402] SEQ ID NO: 58: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00403] SEQ ID NO: 59: DASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00404] SEQ ID NO: 60: AASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00405] SEQ ID NO: 61: MASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00406] SEQ ID NO: 62: AASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVT S TDHGRTWS S PRDLTDAAIGPAYREWS T FAVGPGHCLQLHDRARS LWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
[00407] SEQ ID NO: 63: MNPNQKIIALGSVSLTIAAICLLMQIAILATTMTLHLQQDGCTNPPNNQAVPHEPIIIERNR TEIVYVNNTTIEKENCPKVAEYKNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSC GLGKCYQFALGQGTTLNNRHSNGTTHDRSPHRTLLMNELGVPFHLGTKQVCIAWSSSSCHDG KAWLHVCITGDDRNATASIIYDGLLTDSIGTWSKNILRTQESECICINGTCTWMTDGSASG WADTRILFIREGKIVHISPLSGSAQHVEECSCYPRYPEVRCVCRDNWKGSNR PVLYINVEDYSIDS SYLCS GLVGDT PRNEDS S S S SNCRDPNNERGGPGVKGWAFDS GNDVWM GRTIRKDSREGYETFRWGGWTTANSKSQINRQVIVDSDNLSGYSGMFSVEGKSCINRCFYV ELIRGRPQETRVWWTSNSIIVFCGTSGTYGTGSWPDGANINFMSI
[00408] SEQ ID NO: 64: MLPSTIQTLTLFLTSGGVLLSLYVSASLSYLLYSGILLKFSPTEITAPTMPLNCANASNVQA VNRSATKGVTLLLPEPEWTYPRLSCPGSTFQKALLISPHRFGETKGNSAPLIIREPFIACGP KECKHFALTHYAAQPGGYYNGTREDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGR EWTYIGVDGPDSNALLKIKYGEAYTDTYHSYANNILRTQESACNCIGGDCYLMITDGSASGI SECRFLKIREGRIIKEIFPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETD TAEIRLMCTETYLDTPRPDDGSITGPCESHGDKGSGGIKGGFVHQRMASKIGRWYSRTMSKT KRMGMGLYVKYDGDPWIDSGALTLSGVMVSMEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGG KKTWHSAATAIYCLMGSGQLLWDTVTGVDMAL
[00409] SEQ ID NO: 65: MEYWKHTNHGKDVGNELETSTATHGNKLTNKITYILWTITLVLLSIVFIIVLTNSIKSEKAR ESLLQDINNEFMEVTEKIQVASDNTNDLIQSGVNTRLLTIQSHVQNYIPISLTQQISDLRKF ISEITIRNDNQEVPPQRITHDVGIKPLNPDDFWRCTSGLPSLMKTPKIRLMPGPGLLAMPTT VDGCVRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLNPRISHTFN INDNRKSCSLALLNTDVYQLCSTPKVDERSDYASSGIEDLVLDIVNYDGSISTTRFKNNNIS FDQPYAALYPSVGPGIYYKGKIIFLGYGGLEHPINENAICNTTECPGKTQRDCNQASHSPWF SDRRMVNSIIWDKGLNSVPKLKVWSISMRQNYWGSEGRLLLLGNKIYIYTRSTSWHSKLQL GIIDITDYSDIRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTDAYPLNPTGSIVSSVIL DSQKSRVNPVITYSTATERVNELAIRNETLSAGYTTTSCITHYNKGYCFHIVEINHKSLNTF QPMLFKTEIPKSCS
[00410] SEQ ID NO: 66: MEYWRHTNNAKNTNTEFQTETTRRNNKVTNVMMSIFGAILSTILLTVFIMILVGLIQEGNHN KIASQQMRREFAEIERKIQQATDEIGTSIQSGINTRLLTIQSHVQNYIPLSLTQQISDLRKF INELANKRDQQEVPIQRMTHDSGIEPLNPDKFWRCTSGNPSLASNPKIRLIPGPSLLAASTT VNGCIRIPSFVINNLIYAYTSNLIVQGCQDIGKSYQVLQIGIITINSDLVPDLNPRVTHTFN IDDNRKSCSLALLNTDVYQLCSTPKVDERSDYASTGIEDIVLDIITNNGLIITTRFTNDNIT FDKPYAALYPSVGPGIYYKGKVIFLGYGGLEHAENGDVICNLTGCPGKTQRDCNQASYSPWF SNRRMVNSIIWNKGVDTTFNLRVWTIPMRQNYWGSEGRLLLLGNKIYIYTRSTSWHSKLQL GTIDINNYSDIRINWTWHDALSRPGNDDCPWGHSCPDGCITGVYTDAYPLNPSGSWSSVIL DSRKSRENPIITYATDTRRVNELAIYNRTLPAAYTTTNCIMHYDKGYCFHIVEINHRSLNTF QPMLFKTEIPKNCS
[00411] SEQ ID NO: 67: MDGDRGKRDSYWSTSPSGSTTKPASGWERSSKADTWLLILSFTQWALSIATVIICIIISARQ GYSMKEYSMTVEALNMSSREVKESLTSLIRQEVIARAVNIQSSVQTGIPVLLNKNSRDVIQM IDKSCSRQELTQHCESTIAVHHADGIAPLEPHSFWRCPVGEPYLSSDPEISLLPGPSLLSGS TTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMFPDLNPWSHT YDINDNRKSCSWATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDVLDLKGRTKSHRYRNSE VDLDHPFSALYPSVGNGIATEGSLIFLGYGGLTTPLQGDTKCRTQGCQQVSQDTCNEALKIT WLGGKQWSVIIQVNDYLSERPKIRVTTIPITQNYLGAEGRLLKLGDRVYIYTRSSGWHSQL QIGVLDVSHPLTINWT PHEAL S RPGNKE CNWYNKC PKE CIS GVYT DAYPL S PDAANVATVT L YANTSRVNPTIMYSNTTNIINMLRIKDVQLEAAYTTTSCITHFGKGYCFHIIEINQKSLNTL QPMLFKTSIPKLCKAES
[00412] SEQ ID NO: 68: MTSHSPFSRRRLPALLGSLPLAATGLIAAAPPAHAVPTSDGLADVTITQVNAPADGLYSVGD VMTFNITLTNTSGEAHSYAPASTNLSGNVSKCRWRNVPAGTTKTDCTGLATHTVTAEDLKAG GFTPQIAYEVKAVEYAGKALSTPETIKGATSPVKANSLRVESITPSSSQENYKLGDTVSYTV RVRSVSDKTINVAATESSFDDLGRQCHWGGLKPGKGAVYNCKPLTHTITQADVDAGRWTPSI TLTATGTDGATLQTLTATGNPINWGDHPQATPAPAPDASTELPASMSQAQHLAANTATDNY RIPAITTAPNGDLLISYDERPKDNGNGGSDAPNPNHIVQRRSTDGGKTWSAPTYIHQGTETG KKVGYSDPSYWDHQTGTIFNFHVKSYDQGWGGSRGGTDPENRGIIQAEVSTSTDNGWTWTH RTITADITKDKPWTARFAASGQGIQIQHGPHAGRLVQQYTIRTAGGAVQAVSVYSDDHGKTW QAGTPIGTGMDENKWELSDGSLMLNSRASDGSGFRKVAHSTDGGQTWSEPVSDKNLPDSVD NAQIIRAFPNAAPDDPRAKVLLLSHSPNPRPWSRDRGTISMSCDDGASWTTSKVFHEPFVGY TTIAVQSDGSIGLLSEDAHNGADYGGIWYRNFTMNWLGEQCGQKPAEPSPAPSPTAAPSAAP TEKPAP SAAP SAE P T QAPAP S SAFE P SAAPE P S SAPAPE P T TAP S TE P T PAPAP S SAPE QT D GPTAAPAPETSSAPAAEPTQAPTVAPSVEPTQAPGAQPSSAPKPGATGRAPSWNPKATGAA TEPGTPSSSASPAPSRNAAPTPKPGMEPDEIDRPSDGTMAQPTGGASAPSAAPTQAAKAGSR LSRTGTNALLILGLAGVAWGGYLLLRARRSKN
[00413] SEQ ID NO: 69: MRSNSTSAPSLVRRAATGVLTCAVSIGLLAGLGLPAQAAPTPPNSPTLPPGSFSETNLAADR TAANFFYRIPALTYLGNDWLAAWDGRPGSAADAPNPNSIVQRRSTDGGKTWGPVQVIAAGH VADASGPRYGYSDPSYIYDAEANKVFAFFVYSKDQGFGGSQFGNDDADRNVISSAVIESSDA GVTWS QPRLIT SVTKPGTSKTNPAAGDVRSNFAS S GEGIQLKYGPHKGRLIQQYAGDVRQAD GSNKIQAYSVYSDDHGVTWHKGANVGDRMDENKTVELSDGRVLLNSRDNANRGYRKVAVSTD GGATYGPVSQDTELPDPANNGAIARMFPNAAQGSADAKKLIFTNANSKTGRENVSARVSCDD GETWPGVRTIRSGFSAYSTVTRLADGKFGVLYEGNYTDNMPFATFDDAWLNYVCAPLAVPAV N TAP SAT QEVPVTVTNQEAT T L S GATATVY T P S GW SAT TVPVP DVAP GASVTVTVAL TAPAD ASGPRSLNAAFTTADGRVSQFTFTATTPVAPQVGLTITGSAPARDVAANPYQAGDVLGYTLN VKSTANVAANSVPLTGTFDSGFLPPAAPNCRYNNLAAGASYNCTTAKHTITAADMERGYFVP EATFSITSTTTPSLTKTVQFTGAAVALRDGLISADISGARTDVGRDLATRPYAAGELVPYAF TVKNTSPFVEQWPTAGNFSPFLPAGAGNCRYLSLPAGQSYECATPRHAVTAEEVEQGFFVP DTTWEVSAAGQSTRTYRINGGEVDLLVRDAALSATWAEWKDADGDRFASAGDPVTFTYTVG NAGNVAL T GLEAP DAGIS L P FLAPGDTATATREHVL TAADVAGGS LAASAFEATARNGS KEV TATAEGQPLELKVQPAQPSKEPELTVQDLEDQTPPFDLGTAFKYRTGQKVSLAGLEYGQWYY VYLNKTGYRLGWMFPTTGDTVEFILPPEVRNGRDDVWLDKDGRRVSFDRLQVTPKGEKI
[00414] SEQ ID NO: 70: MCNKNNTFEKNLDISHHPEPLILFNKDANIWNSKYFRIPNVQLLNDVTILTFSDIRYNAPDD HAYIDIASARSTDFGKTWSYNIAMKNNRIDSTYSRAMDSTTLITNTVRIILIASSWNTNGNW AMTTSARRSDWSVQMIYSDDNGLTWSNKIDLTKDSSKVKNQPSNTIGWLGGVGSGITMDDGT IVMPSQISARENNENNYYSLIIYSKDNGETWTMGNKVPNSNTSENMVIELDVALIMSTRYDY SGYRAAYISHDLGTTWEIYEPLNGKILTGKGSGCQGSFIHATTSNGKRIALISAPKNTHGEY IRDQIAVYMIDFDDLSKGVQEICIPYPEDGNKLGGGYSCLSFKNNHLGIVYDFNGNIEYQDL YPYYSLINKQ
[00415] SEQ ID NO: 71: MNYKGITLILTAAMVISGGNYVLVKGSTLDSGKNNSGYEIKVNNSENLSSLGEYKDINLESS NASNITYDLEKYKNLDEGTIWRFNSKDSKIQSLLGISNSKTKNGYFNFYVTNSRVGFELRN QKNEGNTQNGTENLVHMYKDVALNDGDNTVALKIEKNKGYKLFLNGKMIKEVKDTNTKFLNN IENLDSAFIGKTNRYGQSNEYNFKGNIGFMNIYNEPLGDDYLLSKTGETKAKEEVLVEGAVK TEPVDLFHPGFLNSSNYRIPALFKTKEGTLIASIDARRQGGADAPNNDIDTAVRRSEDGGKT WDEGQIIMDYPDKSSVIDTTLIQDDETGRIFLLVTHFPSKYGFWNAGLGSGFKNIDGKEYLC LYDSSGKEFTVRENWYDKDGNKTEYTTNALGDLFRNGTKIDNINSSTAPLKAKGTSYINLV YSDDDGKTWSEPQNINFQVKKDWMKFLGIAPGRGIQIKNGEHKGRIWPVYYTNEKGKQSSA VIYSDDSGKNWTIGESPNDNRKLENGKIINSKTLSDDAPQLTECQWEMPNGQLKLFMRNLS GYLNIATSFDGGATWDETVEKDTNVLEPYCQLSVINYSQKIDGKDAVIFSNPNARSRSNGTV RIGLINQVGTYENGEPKYEFDWKYNKLVKPGYYAYSCLTELSNGNIGLLYEGTPSEEMSYIE MNLKYLESGANK
[00416] SEQ ID NO: 72: MKSKKIIATLVASLVISNMGGYLVKANPNVNHKAVIIEDRQAIIETAIPQSEMTASATSEEG QDPASSAIDGNTNTMWHTKWNGSDALPQSLSVNLGSSRKVSSIAITPRTSGNNGFITKYEIH AINNGVEALVAEGTWEENNLVKTVTFDSPIDAEEIKITAIQGVGGFASIAELNVYEIKGEVD EIANYGNLKITKEEERVNITGDLEKFSSLEEGTIVTRFNMNDTSIQSLIGLSDGNKANNYFS LYVSGGKVGYELRRQEGNGDFNVHHSADVTFNRGINTLALKIEKGIGAKIFLNGSLVKTVSD PNIKFLNAINLNSGFIGKTDRANGYNEYLFRGNIDFMNIYDKPVSDNYLLRKTGETKAPLED SLLPDDVYKTQPVELFYPGYLESRGYRIPALETTKKGTVLASIDVRNNGDHDAPNNNIDVGI RRKEVNGEWEEGKVILDYPGKSAAIDTSLMSATIEENGIEKERIFLIVTHFPEGYGFPNTEG GSGYREIDGKYYFILKDAQNNEYTVREDGIVYNSEGNQTDYVMKNDKTLIQNGEEVGNALLS NSPLKAVGTAHIEMIYSDDDGKTWSEPEDLNPGLKKEWMKFFGTAPGKGIQIKNGEHKDRLI EPIYYTNQNNFQSSAVIYSDDFGETWKLGESPIDTASVSSETVSSGTQLTECQWEMPNGQL KLFMRNTGSYTRIATSFDGGATWHDEVPEDTSLREPYCQLSVINYSGKINGKDAIIFSNPDA SSRVNGSVKVGLINENGTYDNGEPRYEFDWIYNKTVKPGSFAYSCLTELPDGNLGLFYEGEG AGRMAYTEFDLNYLKFNASEDSPSASVQSIEVLDEDLAYNSGEEVSIKVNFNQLVSIIGDRK ITLDIGGVDVPLNMVNYEGKSSAIFKGTIPEGINQGNYEIKLKENNTLELNTVYNKVSTFNG LDNTGINVQIGELKTTVGNSTIKVNDEVQVGSAFEAILGIEGLNGDTEVYSAEYLFEYNAEA FILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEKDSDLVKVNLTPKISSELEVLGLTT ALVGAGDGNTHDLELS SKEVKINEEASGEIWNPVQNFEIPEINKKNVKLTWNAPITTEGLE GYVIYKDGKKLSEVPAESTEFWSKLNRHTIYNFKVAAKYSNGELSAKESKTIRTAR
[00417] SEQ ID NO: 73: MYSLIKKSISTIALSTLAITSLPTYSVSSQTTEEYGARKYFINNNIENIKNIENKSFDLIQN LNTKILEKENIETLSGTWDFTKEATSNSTIPNGLIIEKSNINITAGKGYDLSSEMGSEYVK ALEKGTIIVSYKSTSNNSIQSLVSIGNNTSGNRDRHFHIYITNTGEVGMELRNTDSVLKYTL GRPAAVRSIYKNNLVFNTIAFKADPSNKQYKLFANGELLATLNTDVYKFINDITGVNNVMLG GTVRDGVIAYPFGGTIGNVKIYNEILTDEALKAETGATTYGKNIFYAGDSTKSNYFRIPSLL SLRSGTWSAADARYGGTHDSKSNIDIAFSKSLDGGIIWKNPTIPLQFNDYVARNIDWPRDS IGKNVQIQGSASFIDPVLLEDKETKRLFIFADAMPAGIGSSNASTGSGYKDIAGKKYMKLRW HQDGSSTYNYSIRENGVIYNDVTNLPTEYKIDGDYNLYKNGIALLYKQYDYNFSGTTLLETA TNIDVNMNVFYKDSLFKVFPTTYLDMKYSDDEGETWSNLNIVSSFKPENSKFLVLGPGVGKQ ISKGQYKGRLIVPLYSSSYAELGFMYSDDHGQTWNYVAADNRNTGTTAEAQIVEMPDGSLKS YLRTGSGVIAEVTSINGGETWSDRVTVPNMHTTSYGTQLSVINYAGLIDGKEAIILSAPDSS SARRNGKIWIGLISDTGASGINKYSIEWKYCYSVDSSNMGYSYSCLTELPNGDIGLLYEKYD SWSRNELHLKNILKYETFSINELKQPISN
[00418] SEQ ID NO: 74: MYSSNRTYSRAILGLSAVLTLSFTSLVAPVNAEEPETWPATAELEGEVAATLPSAETGLLD AAPPKPVARGAAGDLQLPAVNEKEVFEEGRVIRAPEPDQSRCYRIPALVTAKNGDLLLAFDN RYGGGDGAKTWCRDAPYENMKRINRQNMQTDIQLYRSVDNGQSFEDFGYIAQGTADVRELSY TDPALVTDRTTGKIFAFFVRAYDYRVGQSSAGFNEGDVEAEIQKRDVQDTVWESLDGGQTW GNMRLLSALTAKVS SIS TGDTIFDGRGRFVT S GAGIQLQYGEHAGRLIVPISVDIDPKDSAK FINLAIYSDDHGQTWQAGIGTAGGAGFSGDVSKIVELSDGRLMMSSKDNDKPRWVSYSEDQG ENWSTPKRKIIAPPQHPEKHNTGINVGLIRAYPNAPENSAAARVLLYSAPIDQRYSHKHTED GRNNGWVMGSCDDGKTWSFGRQIEKNRFQYSSMTVMSDGNIGMVYESGDFSTGMNLKFAKFN MAWLGADCHSNEALGLTGDIDKEIVEAQEKAAEATKEAQEAAEKVQKLTEELAAARKENDEL KNQVKGFKEAVGDLANEAEDLADKVFKLETAVTEAKEKATVAEKAASDAVTQLQKAESIAEE QKAKAESAAAEAQALREKLERLEGSILTVKENPEAEEIADLSSTAKDAADAARRAATDANGA LSGQKQDEEKPAMGLMGILKVLAGIIPLVAIIATIFQTFRLPFNIPGMR
[00419] SEQ ID NO: 75: MTANPYLRRLPRRRAVSFLLAPALAAATVAGASPAQAIAGAPVPPGGEPLYTEQDLAVNGRE GFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGEQQWSAGQTTA PIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGTDPADPNVLHANVATSTDGGLTWSH RTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQYTIINAAGAFQAVSVYSDDHGRTW RAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRKVAVSTDGGHSYGPVTIDRDLPDPTN NASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIRMSCDDGQTWPVSKVFQPGSMSYST LTALPDGTYGLLYEPGTGIRYANFNLAWLGGICAPFTIPDVALEPGQQVTVPVAVTNQSGIA VPKPSLQLDASPDWQVQGSVEPLMPGRQAKGQVTITVPAGTTPGRYRVGATLRTSAGNASTT FTVTVGLLDQARMSIADVDSEETAREDGRASNVIDGNPSTFWHTEWSRADAPGYPHRISLDL GGTHTISGLQYTRRQNSANEQVADYEIYTSLNGTTWDGPVASGRFTTSLAPQRAVFPARDAR YIRLVAL S E QT GHKYAAVAE LEVE GQR
[00420] SEQ ID NO: 76: MKKPVFLLSLLALSTSMAVHGNSFWKADLHENLTNVTKRVGVDGFTVNKEGQPWPGIGPNGE AGGTVTLPYSRIPAMTITDDNKMWMFDLRWKTASDQNRIDPGAAISEDGGHSWKRITAWNF NDSKISLRRAMDPTLLFNSFDGSLYVMHGTWAAGTQNWYRDRLSYFNQNIWAATIYKSTDGG LSWQKNTEFSNTVNRDVFMKVQKGVGNPTIGFLGGVGTGIVMKDGTLVFPIQTAHREGIATT IMYSKDNGRTWDMPTINNALAPNPSSLENMVFEIDNKLVMTGREDNGKKTRWAYYTEDLGQT WHVYE PVNG FSAT TAAP S QG S SIYVT L PIGKRFLLLS KPNGNGNDRYAKGNLALWMLNAKNP NHKHQVPIIKPGSGNSAGAGYSPLAYKKGNLFIAFENNGDITVKNLSAHMQAIEKKATEWGL TDEIATEVEKINSLEHLNKGQKETLSAKMRRANDNAVAESNVLNREMHELKDEATSLEQKSV AMRKALPSKMKQFKRDLGEVRDLTQLTNETYLNYLGIQGLMAMLNGSFLALNTPLDFSKYIK QGEKLNSYDTDILYSTYNKVFVEYDSVIKNSQHRPTIALGLNTRLTDQTQAGVFYEYENKKQ KVDAFGVRAQYTKGDNVLAPFLRYRTVKHDDVIDRNHNVDLYINYAKNVNIDPHLTLSPFVG AYTSLSSRTLLDEDVAVNKRLVMAGDVGLDIRYRLADISVSIRPNIAFIKDGFTFSQAIYRD NPF
[00421] SEQ ID NO: 77: MMKKFNPSVLALSISSLLLTSTLTFGQIQQQDKAHFGVKEHQESLLFHQSLVKQGSDNVPIW RIPSLLRTKDGVLIAAADKRWQHRGDWGDIDTAIRISHDDGKTWGNITTILDLPSQNGEKSP IRDDAPTFNPWAHRNNSSVATYRNSAFLIDAQMVQDKRNGRIFLAVDMFPESTGLSGPSDNG VTEFGSGYVNIDGKQYLRLNKKEGYTSKQWTLRENGIVFNEKNEKTGYRWINGDPKKNFKD LGDVYDQDNNKLGNIYLKQTERNATVPFIAPNTSYFWLTHSDDNGKTWSSPIDLTSQVKKDW MRFFGTGPGVGIQTKKGNLLFPIYYINRHGKQSSALIISKDGGKTWDLGQSPNDTRTELYGK NSETLNSNSSGHELTESQLVELQNGDLKLFMRNTSGRVMMSTSKDGGYSWIETKQVPELNHG YSQLSVIKYSKKINGKEYIVFSGQSVSGNSGDKLRRDGKLFLGEVQDNGDINWDTTNLVRNI KSSGLAKQGSEVYPNGYVYSSMAELGDGSIGLAYENTTDYTTIMYLPIEMQEFFWKAGKIFS DVRQKEPLVFTYDGTETLEKIGDGIAIKRGEGESQSGINVSEGLLVLDQQTKDGKNKAFTQL TLNNSGVAQVNSTQNIDRFWNNGATGYLQFTVTDTHSPRLKINQDVTAHGQIVAVQVNLQK KLKPNDKGYYHAQGEELIAFKDNGQVKWRLVNDELKDGMYVYTLASVAKPSGLRTPSQPHSL YLTNKLITADGKAVSTVAPLKAPLTVNARPQVNPVLASYLTANLALNKMSEQLQQSFMHETR LLQEKDRSIFVKYLNGKQKYGSNLSFYDYGYDFNASYSGVMLGGKVWQSERGNHALYTALNK TSYKVTPKAVDGETKAKYQSWGGSINWHSNLPHNLIVDLSTGYQKHKGDIEHAGHVKGYTFN IGADLGYRYQWMKNAFITPMVGLHYLYASLSDVNDQANKALLKYNNFNALKTNLGVDVNYRI GKFEVKGLLSYDMYQQKTRQLYVDDVAYKQGKLADTLHLNTQFVAHLTPRFAFSTEVGFQHA RNKGQSSFAVGAHYQF
[00422] SEQ ID NO: 78: MNTYFDIPHRLVGKALYESYYDHFGQMDILSDGSLYLIYRRATEHVGGSDGRWFSKLEGGI WSAPTIVAQAGGQDFRDVAGGTMPSGRIVAASTVYETGEVKVYVSDDSGVTWVHKFTLARGG ADYNFAHGKSFQVGARYVIPLYAATGVNYELKWLESSDGGETWGEGSTIYSGNTPYNETSYL PVGDGVILAVARVGSGAGGALRQFISLDDGGTWTDQGNVTAQNGDSTDILVAPSLSYIYSEG GTPHWLLYTNRTTHFCYYRTILLAKAVAGSSGWTERVPVYSAPAASGYTSQWLGGRRILG NLFRETSSTTSGAYQFEVYLGGVPDFESDWFSVSSNSLYTLSHGLQRSPRRVWEFARSSSP STWNIVMPSYFNDGGHKGSGAQVEVGSLNIRLGTGAAVWGTGYFGGIDNSATTRFATGYYRV RAW I
[00423] SEQ ID NO: 79: MTRHLLNCRILYMHPPLDMHTHPFIKEGKSMTVEKSWFKAEGEHFTDQKGNTIVGSGSGGT TKYFRIPAMCTTSKGTIWFADARHNTASDQSFIDTAAARSTDGGKTWNKKIAIYNDRVNSK LSRVMDPTCIVANIQGRETILVMVGKWNNNDKTWGAYRDKAPDTDWDLVLYKSTDDGVTFSK VETNIHDIVTKNGTISAMLGGVGSGLQLNDGKLVFPVQMVRTKNITTVLNTSFIYSTDGITW SLPSGYCEGFGSENNIlEFNASLVNNIRNSGLRRSFETKDFGKTWTEFPPMDKKVDNRNHGV QGSTITIPSGNKLVAAHSSAQNKNNDYTRSDISLYAHNLYSGEVKLIDDFYPKVGNASGAGY SCLSYRKNVDKETLYWYEANGSIEFQDLSRHLPVIKSYN
[00424] SEQ ID NO: 80: MNKRGLYSKLGISWGISLLMGVPTLIHANELNYGQLSISPIFQGGSYQLNNKSIDISSLLL DKLSGESQTWMKFKADKPNSLQALFGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQEGIN YLFSRPASLWGKHKGQAVENTLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNINGIDKA TLGAVNREGKEHYLAKGSIGEISLFNKAISDQEVSNIPLSNPFQLIFQSGDSTQANYFRIPT LYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFNDYEEQLVYWPR DNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADSGFKEINGHYYLK LKKNGDNDFRYTVRENGWYDETTNKPTNYTINDKYEVLEGGKSLTVEQYSVDFDSGSLRER HNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPFLGEKHNGTYLCPGQGL ALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFKNATAEAQMVELRDGVIRTFFRT TTGKIAYMTSRDSGETWSKVSYIDGIQQTSYGTQVSAIKYSQLIDGKEAVILSTPNSRSGRK GGQLWGLVNKEDDSIDWRYHYDIDLPSYGYAYSAITELPNHHIGVLFEKYDSWSRNELHLS NWQYIDLEINDLTK
[00425] SEQ ID NO: 81: MKKFFWIIGLFISMQMTRAADSVYVQNPQIPILIDRTDNVLFRIRIPDATKGDVLNRLTIRF GNEDKLSEVKAVRLFYAGTEAATKGRSRFAPVTYVSSHNIRNTRSANPSYSVRQDEVTTAAN TLTLKTRQPMVKGINYFWVSVEMDRNTSLLSKLTPTVTEAVINDKPAVIAGEQAAVRRMGIG VRHAGDDGSASFRIPGLVTTNEGTLLGVYDVRYNNSVDLQEHVDVGLSRSTDKGQTWEPMRI AMSFGETDGLPSGQNGVGDPSILVDERTNTVWWAAWTHGMGNARAWTNSMPGMTPDETAQL MMVKSTDDGRTWSEPINITSQVKNPSWCFLLQGPGRGITMRDGTLVFPIQFIDSLRVPHAGI MYSKDRGETWHIHQPARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAVSITRDLGKSWTEHSS NRSALPESICMASLISVKAKDNIIGKDLLLFSNPNTTEGRHHITIKASLDGGVTWLPAHQVL LDEEDGWGYSCLSMIDRETVGIFYESSVAHMTFQAVKIKDLIR
[00426] SEQ ID NO: 82: MSIKMTSQRRRASIHKETDSNIKGVDMRFKNVKKTALMLAMFGMATSSNAALFDYNATGDTE FDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGWRMTT EMKVLSGGMITNYYANGTQRVLPIISLDSSGNLWEFEGQTGRTVLATGTAATEYHKFELVF LPGSNPSASFYFDGKLIRD...
Claims
1. A pharmaceutical composition comprising a fusion protein comprising a sialidase and anFc domain, wherein the sialidase is a recombinant mutant human Neu2 sialidase comprising:(a) a substitution of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 with an aspartic acid (M1D);(b) a substitution of a valine residue at a position corresponding to position 6 of wild-type human Neu2 with a tyrosine (V6Y);(c) a substitution of a proline residue at a position corresponding to position 62 of wildtype human Neu2 with a glycine (P62G);(d) a substitution of an alanine residue at a position corresponding to position 93 of wildtype human Neu2 with a glutamic acid (A93E);(e) a substitution of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 with a lysine (I187K); and(f) a substitution of a cysteine residue at a position corresponding to position 332 of wildtype human Neu2 with an alanine (C332A).
2. The pharmaceutical composition of claim 1, wherein the sialidase is not conjugated to a cancer antigen targeting agent that binds a cancer antigen associated with a cancerous cell.
3. The pharmaceutical composition of claim 1 or 2, wherein the fusion protein comprises the amino acid sequence of SEQ ID NOs: 115 or 152..
4. The pharmaceutical composition of any one of claims 1-3, comprising from about 0.01 mg / kg to about 100 mg / kg of the sialidase.
5. The pharmaceutical composition of any one of claims 1-4, wherein the pharmaceutical composition further comprises a stabilizing amount of a sialidase stabilizing agent.
6. The pharmaceutical composition of claim 5, wherein the sialidase stabilizing agent is acation.
7. The pharmaceutical composition of claim 6, wherein the cation is selected from the groupconsisting of calcium and magnesium.
8. The pharmaceutical composition of any one of claims 1-7, wherein the pharmaceutical2020300680 30 Jun 2026composition is disposed in a sterile container.
9. The pharmaceutical composition of claim 8, wherein the pharmaceutical composition islyophilized in the sterile container.
10. The pharmaceutical composition of claim 8, wherein the pharmaceutical composition ispresent as a solution in the sterile container.
11. The pharmaceutical composition of any one of claims 8-10, wherein the sterile container is sealed with a septum.
12. The pharmaceutical composition of any one of claims 1-11 for use in the manufacture of a medicament.
13. A method of treating a disease or disorder in a subject in need thereof, the method comprising administering to the subject the pharmaceutical composition of any one of claims 112.
14. The method of claim 13, wherein the disease or disorder is a sialic acid-related disorder.
15. A method of removing sialic acid from a cell in a subject, the method comprisingadministering to the subject an effective amount of the pharmaceutical composition of any one of claims 1-11, thereby to remove sialic acid from the cell.
16. The method of claim 15, wherein the cell is an immune cell.
17. The method of claim 13 or 14, wherein the pharmaceutical composition is administeredto the subject in combination with another therapeutic agent.
18. The method of claim 17, wherein the therapeutic agent is an anti-CD20 antibody.