A method for preparing hybrid wood chemical-mechanical pulp assisted by deep-sea complex enzyme

Abstract

The invention belongs to the technical field of papermaking, and discloses a method for preparing a hybrid wood chemical mechanical pulp assisted by a deep-sea composite enzyme. Method: 1) soaking the hybrid wood chips in water, steaming, adding alkaline hot water, adjusting the pH to 8-9, adding a deep-sea composite enzyme preparation for treatment; the deep-sea composite enzyme preparation is a mixed enzyme of cellulase, xylanase and cutinase; 2) adding an alkali solution with a mass concentration of 4-10% to the above-mentioned slurry for treatment, refining, hot water dilution and adjusting the pH to 7-9, adding a deep-sea composite enzyme preparation, treating the slurry at 70-80°C for 30-90min, screening, beating, and obtaining a hybrid wood chemical mechanical pulp; the composite enzyme preparation is a mixed enzyme of three enzymes of cellulase, xylanase and lignin oxidase. The method of the present invention is simple, reduces pulping energy consumption, and improves pulping performance, and has good practical application value and industrial application prospects.

Description

Technical Field

[0001] The invention belongs to the field of papermaking technology, and in particular relates to a method for preparing hybrid wood chemical-mechanical pulp assisted by deep-sea composite enzymes. Background Art

[0002] The papermaking industry is not only a consumer goods industry, but also an important basic raw material industry. The problem of resource shortage in the traditional papermaking industry has become more prominent, making the research and development of new papermaking raw materials urgent.

[0003] In the traditional chemical-mechanical pulping process, the amount of chemicals used is low, the pulp fibers are more densely bound, and greater force is required to separate the fibers from each other, which has the disadvantage of high refining energy consumption. In the process of mechanical pulping, the fibers are cut and ground, resulting in more fiber fragments and fine fibers. At the same time, because the intercellular layer of the fiber bundles is not removed during the pulping process, the fibers are not fully dissociated, and the lignin is wrapped around the fiber surface, the resulting paper has a loose structure, poor bonding between fibers, and a disadvantage of low pulp strength. Miscellaneous wood refers to a large number of broad-leaved trees with scattered resource distribution, mostly mixed forests, and unconcentrated resources of a single tree species, with thick branches and low yields, and are collectively referred to as "miscellaneous wood". The chemical-mechanical pulp made from acacia wood has a low bulk thickness and poor water filtration performance, which is not conducive to increasing the operating speed of the paper machine. At the same time, due to the long time spent on slicing and transportation, the wood chips are air-dried, and the chemical composition and microstructure are prone to change, resulting in the pores of the air-dried wood chips being mostly deposited and wrapped by the extracts, the pores are blocked, and the permeability of the liquid is poor, affecting the impregnation effect. Therefore, the research and development of low-pollution, low-energy, high-quality pulping methods suitable for miscellaneous wood pulp is the focus of the papermaking industry, and it is also an industry development bottleneck that urgently needs to be broken through.

[0004] The invention provides a method for preparing miscellaneous wood chemical mechanical pulp assisted by deep-sea compound enzymes. Miscellaneous wood is used as pulping raw material, steaming or hot water is used to treat miscellaneous wood chips, deep-sea compound enzymes are added to heat-saturate and soften the miscellaneous wood chips, and then the temperature of the miscellaneous wood pulp is adjusted, and then alkaline hot water is added for immersion treatment, and finally the pulp is refined. The prepared miscellaneous wood pulp can meet the requirements for producing packaging and paper-based materials.

[0005] The biological enzyme used in the present invention has higher heat resistance, alkali resistance and action efficiency than ordinary biological enzymes. Most of the working sections in the pulping production process are in a high-temperature alkaline environment, and there is no need to specifically adjust the temperature and pH in the biological enzyme treatment stage, thereby reducing production costs. Summary of the invention

[0006] In view of the above problems, the present invention provides a method for preparing miscellaneous wood chemical mechanical pulp assisted by deep-sea composite enzymes. The present invention uses miscellaneous wood as raw material, steams the pretreated miscellaneous wood chips, adds alkaline hot water to adjust the pH value to 8-9 after treatment, and adds deep-sea composite enzyme preparations to soften the fibers, degrade part of the hemicellulose and lignin, and form pores on the fiber surface; the pulp is then treated with alkaline hot water immersion, grinding, etc. to obtain a coarse pulp, hot water is added to dilute the pulp and the pH value is adjusted to 7-9, and the pulp is treated with deep-sea composite enzyme preparations to reduce the content of fiber bundles and fine fibers, so that the fiber surface is wrinkled and fibrillated, and twisted and curled fibers are stretched, the quality of the pulp is stabilized, and the strength of the pulp is improved; the pulp is then screened and beaten to obtain miscellaneous wood chemical mechanical pulp. The preparation method of the present invention is simple, can reduce pulping energy consumption, and improve the papermaking performance of pulp.

[0007] The purpose of the present invention is achieved through the following technical solutions:

[0008] A method for preparing hybrid wood chemical-mechanical pulp assisted by deep-sea complex enzymes comprises the following steps:

[0009] 1) Soaking air-dried wood in water, and then placing it in a steam treatment at 80-100° C. for 10-60 min; the air-dried wood refers to the air-dried wood that has been physically selected and dusted and cut into 2-5 cm long spare raw materials; the soaking refers to soaking at 20-30° C. for 22-28 hours;

[0010] 2) adding the treated wood chips in step 1) to alkaline hot water, adjusting the pH to 8-9, adding a deep-sea complex enzyme preparation and treating at 60-90° C. for 30-120 min; the deep-sea complex enzyme preparation is a mixed enzyme of cellulase, xylanase and cutinase, with a total dosage of 10-100 U / mL, and the enzyme activity ratio of cellulase, xylanase and cutinase is (3-6): (2-4): (1-1.5); the alkaline hot water is a sodium hydroxide aqueous solution at 60-80° C.; the material-liquid ratio of the wood chips to the alkaline hot water is 1 kg: 4-8 L;

[0011] 3) treating the slurry after the treatment in step 2) with an alkali solution having a mass concentration of 4-10% at 80-120° C. for 20-60 min. After the reaction is completed, the slurry is taken out for refining treatment, using two-stage refining with a refining gap of 0.1-0.5 mm; the alkali solution is a sodium hydroxide solution;

[0012] 4) adding hot water to the slurry treated in step 3) to dilute the slurry, adjusting the pH value to 7-9, adding a deep-sea composite enzyme preparation, and treating the slurry for 30-90 minutes; the temperature of the hot water is 70-80°C; the liquid ratio of the slurry to the hot water is 1kg:20-30L; the temperature of the treated slurry is 70-80°C, the deep-sea composite enzyme preparation is a mixed enzyme of three enzymes: cellulase, xylanase and lignin oxidase, the total dosage is 10-100U / mL, and the enzyme activity ratio of cellulase, xylanase and lignin oxidase is (1-1.5):(3-6):(2-4);

[0013] 5) The pulp treated in step 4) is screened and beaten to a beating degree of 39-41° SR to obtain a hybrid wood chemical mechanical pulp.

[0014] The present invention provides a hybrid wood chemical mechanical pulp prepared by the above preparation method.

[0015] The xylanase and cutinase in the deep-sea composite enzyme of the present invention are genes extracted from deep-sea organisms and are prepared by fermentation of Escherichia coli. The three enzymes are compounded in different proportions to act synergistically. The energy consumption of refining and beating of miscellaneous wood chemical mechanical pulp prepared by the deep-sea enzyme of the present invention is significantly reduced, and the amount of chemicals used is reduced.

[0016] Compared with the prior art, the present invention has the following advantages and effects:

[0017] The invention can reduce the energy consumption of pulping and improve the papermaking performance of pulp.

[0018] The preparation method of the invention is simple, has low requirements on equipment, and is suitable for production in a large number of small and medium-sized papermaking enterprises. This is of great significance to the industrial production of miscellaneous wood pulp and the development of the papermaking industry. DETAILED DESCRIPTION

[0019] The present invention is further described in detail below in conjunction with specific examples, but the embodiments of the present invention are not limited thereto.

[0020] The present invention provides a method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme, comprising the following steps:

[0021] (1) Cut the air-dried wood after physical selection and dust removal into 2-5 cm long raw materials for use;

[0022] (2) Soak the spare raw materials in water at 20-30°C for 24±1h, with the liquid ratio controlled at 1kg:4-6L;

[0023] (3) placing the slurry after treatment in step (2) under steaming at 80-100° C. for 0-60 min;

[0024] (4) adding alkaline hot water (sodium hydroxide solution) to the wood chips treated in step (3), controlling the liquid ratio at 1 kg:4-8 L, adjusting the pH value to 8-9, adding a deep-sea complex enzyme preparation (the complex enzyme is a mixed enzyme of cellulase, xylanase and cutinase, with a total dosage of 10-100 U / mL, and the enzyme activity ratio of cellulase, xylanase and cutinase is (3-6): (2-4): (1-1.5)) and treating at 60-90° C. for 30-120 min;

[0025] (5) adding alkaline hot water (sodium hydroxide solution with a mass concentration of 4-10%) to the slurry after treatment in step (4) and boiling it at 80-120° C. for 20-60 min;

[0026] (6) taking out the pulp after the treatment in step (5) and performing high-concentration refining treatment, using two-stage refining, a spindle speed of 3000-3500 r / min, and a refining gap of 0.1-0.5 mm;

[0027] (7) adding hot water to dilute the slurry after treatment in step (6), controlling the liquid ratio at 1 kg:20-30 L, adjusting the pH value to 7-9, and using a deep-sea complex enzyme preparation to treat the slurry with hot water for 30-90 min;

[0028] (8) The pulp treated in step (7) is screened and then beaten to a beating degree of 39-41° SR to obtain a hybrid wood chemical mechanical pulp.

[0029] The present invention firstly adopts soaking and steaming treatment, which can dissolve part of the cold / hot water extract and soften the fiber structure. The deep-sea composite enzyme is used to treat the miscellaneous wood chips, which can degrade the hemicellulose, lignin, pectin and other substances, and break and open the connecting bonds between cellulose, hemicellulose and lignin. During the enzyme treatment, a trace amount of alkali is added to make the pH of the slurry alkaline, which can quickly dissolve the lignin and form channels between the fibers. After the deep-sea composite enzyme treatment, it is then immersed in alkaline hot water. The hot alkali solution can enter the fiber through the channel, so that the lignin, hemicellulose and the like swell and are extracted, and the slurry is further softened. At the same time, the damage to the fiber caused by grinding is reduced, and the quality of the pulp is guaranteed. The alkaline hot water immersion treatment can also completely inactivate the deep-sea enzyme in the slurry, avoiding the influence of the deep-sea enzyme on the subsequent pulping. The pulp obtained after refining is treated with deep-sea composite enzyme preparations to reduce the content of fiber bundles and fine fibers, make the fiber surface wrinkled and fibrillated, reduce the energy consumption of pulping, reduce the damage to the fibers during pulping, and at the same time stretch the twisted and curled fibers, stabilize the quality of the pulp, and improve the strength of the pulp.

[0030] In the prior art, in order to protect the activity of biological enzymes, hot water or steam is often used to pre-treat pulping raw materials, so that a large amount of metal ions in the materials are dissolved, thereby reducing the influence of metal ions on the activity of biological enzymes. In the present invention, the deep-sea composite enzymes cooperate with each other, and the improvement effect is significant.

[0031] Example 1

[0032] A method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzymes comprises the following steps:

[0033] (1) Cut the air-dried wood after physical selection and dust removal into 2-5 cm long raw materials for use;

[0034] (2) Soak the spare raw materials in water at 25°C for 24 hours, with the liquid ratio controlled at 1kg:5L;

[0035] (3) placing the slurry after treatment in step (2) under steaming at 90° C. for 30 min;

[0036] (4) adding alkaline hot water (80° C. sodium hydroxide solution) to the wood chips treated in step (3), controlling the liquid ratio at 1 kg:6 L, adjusting the pH value to 8, adding a deep-sea complex enzyme preparation (the complex enzyme is a mixed enzyme of three enzymes: cellulase, xylanase and cutinase, with a total dosage of 100 U / mL, and the enzyme activity ratio of cellulase, xylanase and cutinase is 3:2:1) and treating at 80° C. for 90 min;

[0037] (5) adding alkali solution (7 wt %, liquid ratio controlled at 1 kg:5 L) to the slurry after treatment in step (4) and boiling the slurry at 100° C. for 40 min;

[0038] (6) taking out the pulp after the treatment in step (5) and performing high-concentration refining treatment, using two-stage refining, a spindle speed of 3000 / min, and refining gaps of 0.5 and 0.2 mm;

[0039] (7) adding 80° C. hot water to dilute the slurry after treatment in step (6), controlling the liquid ratio at 1 kg:25 L, adjusting the pH value to 8, controlling the treatment temperature at 80° C., and using a deep-sea composite enzyme preparation (total dosage of 50 U / mL, the enzyme activity ratio of cellulase, xylanase and lignin oxidase being 1:5:3) to synergistically treat the slurry with hot water for 60 min;

[0040] (8) The pulp treated in step (7) is screened and then beaten to a beating degree of 40±1°SR to obtain a hybrid wood chemical mechanical pulp.

[0041] Control method 1: inactivated xylanase was used, and other steps were the same as those in Example 1.

[0042] Control method 2: without deep-sea enzyme treatment, other steps were the same as those in Example 1.

[0043] The obtained pulp is made into a paper with a basis weight of 60g / m 2 The base paper was tested for physical indexes. The pulp tensile index was measured according to GB / T453-2002, the bursting strength was measured according to GB / T 454-2002, and the pulp tearing index was measured according to GB / T455-2002. The indexes are shown in Table 1.

[0044] Table 1 Determination of properties of biomechanical pulp by different methods

[0045]

[0046] Example 2

[0047] A method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzymes comprises the following steps:

[0048] (1) Cut the air-dried miscellaneous wood seeds after physical selection and dust removal into 2-5 cm long raw materials for use;

[0049] (2) Soak the spare raw materials in water at 25°C for 24 hours, with the liquid ratio controlled at 1kg:5L;

[0050] (3) placing the slurry after treatment in step (2) under steaming at 90° C. for 30 min;

[0051] (4) adding alkaline hot water (80° C. sodium hydroxide solution) to the wood chips treated in step (3), controlling the liquid ratio at 1 kg:6 L, adjusting the pH value to 8, adding a deep-sea complex enzyme preparation (the complex enzyme is a mixed enzyme of three enzymes: cellulase, xylanase and cutinase, with a total dosage of 100 U / mL, and the enzyme activity ratio of cellulase, xylanase and cutinase is 3:2:1) and treating at 80° C. for 90 min;

[0052] (5) adding alkali solution (7 wt %, liquid ratio controlled at 1 kg:5 L) to the slurry after treatment in step (4) and subjecting the slurry to steaming treatment at 100° C. for 40 min;

[0053] (6) taking out the pulp after the treatment in step (5) and performing high-concentration refining treatment, using two-stage refining, a spindle speed of 3000 / min, and refining gaps of 0.5 and 0.2 mm;

[0054] (7) adding 80° C. hot water to dilute the slurry after treatment in step (6), controlling the liquid ratio at 1 kg:25 L, adjusting the pH value to 8, controlling the treatment temperature at 80° C., and using a deep-sea composite enzyme preparation (total dosage of 50 U / mL, the enzyme activity ratio of cellulase, xylanase and lignin oxidase being 1.5:3:2) to synergistically treat the slurry with hot water for 60 min;

[0055] (8) The pulp treated in step (7) is screened and then beaten to a beating degree of 40±1°SR to obtain a hybrid wood chemical mechanical pulp.

[0056] Control method 3: The deep-sea enzyme used was inactivated xylanase, and the other steps were the same as those in Example 2.

[0057] Control method 4: without deep-sea enzyme treatment, other steps were the same as those in Example 2.

[0058] The obtained pulp is made into a paper with a basis weight of 60g / m 2 The base paper was tested for physical indexes. The pulp tensile index was measured according to GB / T453-2002, the bursting strength was measured according to GB / T 454-2002, and the pulp tearing index was measured according to GB / T455-2002. The indexes are shown in Table 2.

[0059] Table 2 Determination of properties of biomechanical pulp by different methods

[0060]

[0061] Example 3

[0062] A method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzymes comprises the following steps:

[0063] (1) Cut the air-dried miscellaneous wood seeds after physical selection and dust removal into 2-5 cm long raw materials for use;

[0064] (2) Soak the spare raw materials in water at 25°C for 24 hours, with the liquid ratio controlled at 1kg:5L;

[0065] (3) placing the slurry after treatment in step (2) under steaming at 90° C. for 30 min;

[0066] (4) adding alkaline hot water (80° C. sodium hydroxide solution) to the wood chips treated in step (3), controlling the liquid ratio at 1 kg:6 L, adjusting the pH value to 8, adding a deep-sea complex enzyme preparation (the complex enzyme is a mixed enzyme of three enzymes: cellulase, xylanase and cutinase, with a total dosage of 100 U / mL, and the enzyme activity ratio of cellulase, xylanase and cutinase is 3:2:1) and treating at 80° C. for 90 min;

[0067] (5) adding alkali solution (7 wt %) to the slurry after treatment in step (4) and subjecting the slurry to steaming treatment at 100° C. for 40 min;

[0068] (6) taking out the pulp after the treatment in step (5) and performing high-concentration refining treatment, using two-stage refining, a spindle speed of 3000 / min, and refining gaps of 0.5 and 0.2 mm;

[0069] (7) adding 80° C. hot water to dilute the slurry after treatment in step (6), controlling the liquid ratio at 1 kg:25 L, adjusting the pH value to 8, controlling the treatment temperature at 80° C., and using a deep-sea composite enzyme preparation (total dosage of 50 U / mL, the enzyme activity ratio of cellulase, xylanase and lignin oxidase being 1.5:4:1.5) to synergistically treat the slurry with hot water for 60 min;

[0070] (8) The pulp treated in step (7) is screened and then beaten to a beating degree of 40±1°SR to obtain a hybrid wood chemical mechanical pulp.

[0071] Control method 5: The deep-sea enzyme used was inactivated xylanase, and the other steps were the same as those in Example 3.

[0072] Control method 6: without deep-sea enzyme treatment, other steps were the same as those in Example 3.

[0073] The obtained pulp is made into a paper with a basis weight of 60g / m 2 The base paper was tested for physical indexes. The pulp tensile index was measured according to GB / T453-2002, the bursting strength was measured according to GB / T 454-2002, and the pulp tearing index was measured according to GB / T455-2002. The indexes are shown in Table 3.

[0074] Table 3 Performance determination of biomechanical pulp by different methods

[0075]

[0076] The xylanase and cutinase in the deep-sea composite enzyme of the present invention are genes extracted from the deep-sea organism Verrucosispora maris AB-18-032, and are prepared by fermentation of Escherichia coli. The three enzymes are compounded in different proportions to act synergistically. The deep-sea enzyme of the present invention is used to prepare miscellaneous wood chemical mechanical pulp, and the energy consumption of pulping and beating is significantly reduced, and the amount of chemicals used is reduced.

[0077] Xylanase is described in the literature (Longmei Zhao, et al. Expression of the Thermobifida fuscaxylanase Xyn11A in Pichia pastoris and its characterization).

[0078] Cutinase, see patent application number 202310516302.3.

[0079] Or the sequence used in the preparation of cutinase:

[0080] Protein sequence (>gi|330470287|ref|YP_004408030.1|Phospholipase a2 [Verrucospora maritima AB-18-032]):

[0081] MLKRLATLLTSGILALLTAFATASPAAAAVTPAQKLSVLSSWTQTSVSSYNAWNSARQNRAAWAEYKFDWSTDYCSSSPDNPLGFNFSLSCFRHDFGYRNYKAVGQFSANKSRLDSAFYEDLKRVCATYNSVVRPACTSLAWTYYQAVSIFGSVAAVEQADIDRAARMKADAERHARL.

[0082] Gene sequence (>gi|330464883:6048191-6048727 Chromosome of Verrucospora maritima AB-18-032, complete genome):

[0083] GTGCTCAAACGACTCGCCACCCTCCTCACCTCGGGCATTCTCGCGCTGCTCACCGCGTTCGCCACCGCCTCCCCCGCGGCAGCGGCCGTCACTCCGGCACAGAAGCTGTCCGTGCTGTCGAGTTGGACGCAGACCAGCGTCAGCAGCTACAACGCCTGGAACTCGGCCCGGCAGAACCGCGCCGCCTGGGCGGAGTACAAGTTCGACTGGTCCACCGACTACTGCTCGTCCAGCCCGGACAACCCGCTCGGATTCAACTTCTCCCTCTCCTGCTTCCGGCACGACTTCGGCTACCGCAACTACAAGGCGGTCGGCCAGTTCAGCGCCAACAAGTCCCGCCTGGACAGCGCCTTCTACGAGGACCTGAAGCGGGTCTGCGCCACCTACAACTCCGTCGTCCGGCCGGCCTGCACCAGCCTCGCCTGGACCTACTACCAGGCCGTCTCCATCTTCGGCTCGGTTGCCGCCGTCGAACAGGCCGACATCGACCGGGCCGCCCGGATGAAGGCCGACGCCGAGCGCCACGCCCGACTCTGA。

Claims

1. A method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme, characterized in that: The following steps are involved: 1) Soak the wood chips in water and then steam them; 2) adding alkaline hot water to the wood chips treated in step 1) to adjust the pH to 8-9, adding deep-sea complex enzyme preparation I and treating at 60-90°C for 30-120 min; deep-sea complex enzyme preparation I is a mixed enzyme of cellulase, xylanase and cutinase, with a total dosage of 10-100 U / mL, and the enzyme activity ratio of cellulase, xylanase and cutinase is (3-6): (2-4): (1-1.5); 3) adding alkali solution with a mass concentration of 4-10% to the pulp treated in step 2), treating at 80-120° C. for 20-60 minutes, and then refining the pulp; 4) adding hot water to dilute the slurry treated in step 3) and adjusting the pH value to 7-9, adding compound enzyme preparation II, and treating the slurry at 70-80° C. for 30-90 min; the compound enzyme preparation II is a mixed enzyme of three enzymes: cellulase, xylanase and lignin oxidase, with a total dosage of 10-100 U / mL, and the enzyme activity ratio of cellulase, xylanase and lignin oxidase is (1-1.5): (3-6): (2-4); 5) screening the pulp treated in step 4) and beating the pulp to a beating degree of 39-41°SR to obtain a hybrid wood chemical mechanical pulp; The amino acid sequence of the cutinase is SEQ ID NO.1; the amino acid sequence of the xylanase is SEQ ID NO.

2.

2. The method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme according to claim 1, characterized in that: The steaming condition in step 1) is 80-100° C. for 10-60 min; The alkaline hot water in step 2) is a 60-80° C. sodium hydroxide aqueous solution; the liquid ratio of the wood chips to the alkaline hot water is 1 kg:4-8 L.

3. The method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme according to claim 1, characterized in that: In step 3), the ratio of the slurry to the alkali solution is 1kg:4-6L; the alkali solution is a sodium hydroxide solution; The refining process in step 3) is high-concentration refining, with a main shaft speed of 3000-3500 r / min, two-stage refining, and a refining gap of 0.1-0.5 mm.

4. The method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme according to claim 1, characterized in that: The miscellaneous wood chips described in step 1) are pretreated by physical screening and dust removal, and the miscellaneous wood chips are cut into small segments of 2-5 cm; the liquid ratio of the miscellaneous wood chips to water described in step 1) is 1kg:4-6L, and the soaking conditions are soaking at 20-30°C for 22-28h.

5. The method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme according to claim 1, characterized in that: In step 4), the liquid ratio of slurry to hot water is 1kg:20-30L; The gap of the sieve plate used for screening in step 5) is 0.25 mm.

6. The method for preparing hybrid wood chemical mechanical pulp assisted by deep-sea complex enzyme according to claim 1, characterized in that: The beating process described in step 5) uses a PFI grinding beating machine with a beating gap of 0.3 mm.

7. A hybrid wood chemical mechanical pulp obtained by the method according to any one of claims 1 to 6.

8. The use of the hybrid wood chemical mechanical pulp according to claim 7, characterized in that: The hybrid wood chemical mechanical pulp is used for preparing paper-based materials.

Images