Nucleic acid molecules, fusion proteins and mRNA vaccines that recruit ligands to enhance antigen presentation

Abstract

The present invention belongs to the field of biomedicine, and mainly relates to a vaccine design method for enhancing the effect of antigen presentation, and is applied to the structural sequence design and preparation of nucleic acid, protein and polypeptide vaccines. The present invention co-encodes the target antigen and a ligand such as a polypeptide or protein domain with E3 ubiquitin ligase binding or recruitment function in the same nucleic acid sequence, so that the nucleic acid molecule enters the cell to realize the fusion expression of the antigen protein and the E3 ubiquitin ligase ligand, and then promotes the degradation of the antigen protein by the proteasome pathway, increases the number and abundance of antigen peptides with antigenic epitopes, forms more peptide-MHC (p-MHC) complexes, and then is presented to the cell surface, enhances subsequent immune response, and exerts an efficient tumor immunotherapy effect. The nucleic acid, protein and polypeptide vaccines provided by the present invention have efficient antigen presentation and strong immunogenicity, and have good clinical application prospects.

Description

Technical Field

[0001] The present invention belongs to the field of biomedicine, and specifically relates to nucleic acid molecules, fusion proteins and vaccines and applications thereof that can enhance antigen presentation effects, especially mRNA vaccines. Background Art

[0002] mRNA vaccine is a new type of vaccine with the advantages of high versatility, high efficacy, fast construction, and easy expansion of production. It has important clinical value and application prospects. The emerging nucleic acid vaccine (mRNA or DNA) has a very obvious timeliness advantage as an emergency vaccine. In fact, the use of mRNA vaccines to induce the body to produce anti-tumor immune effects has shown great potential, and many research results have entered the clinical trial stage. mRNA tumor vaccine is a tumor treatment method that introduces tumor antigens into the patient's body in the form of mRNA, stimulates T cells in the patient's body through tumor antigens, and activates the patient's own specific cellular immunity. At present, there are no mRNA tumor vaccines on the market, but 19 clinical trials have been registered worldwide, and the fastest is in the clinical phase II stage. Despite this, the existing mRNA tumor vaccines still need to be optimized and improved in terms of enhancing antigen presentation efficiency and T cell immune response, especially in terms of mRNA sequence design and synthesis, translation efficiency and stability, antigen presentation efficiency, T cell immune response intensity, etc., in order to further improve the anti-tumor immunotherapy activity and accelerate clinical transformation.

[0003] mRNA tumor vaccines mainly translate mRNA into target antigen proteins through the translation mechanism of antigen presenting cells (APCs), some of which are ubiquitinated and degraded through the proteasome degradation pathway, thereby producing a large number of antigen peptides with antigen epitopes. These antigen peptides are transported to the endoplasmic reticulum (ER) through the antigen processing transporter (TAP), modified by N-terminal aminopeptidases ERAP1 and ERAP2, and then loaded onto MHC-I proteins, further transported to the cell surface, and recognized by antigen-specific CD8+T cells, thereby presenting the antigen epitope information to CD8+T cells. Alternatively, the secreted antigen protein can be absorbed by professional antigen presenting cells located in tissues or lymph nodes, degraded into a large number of antigen peptides through the lysosomal degradation pathway, and then replace CLIP (MHC-II molecule-associated invariant chain peptide) in the antigen binding groove of MHC-II molecules to form a stable antigen peptide-MHC-II complex, which is then transported to the cell membrane for recognition by CD4+T cells, thereby presenting the antigen epitope information to CD8+T cells. In addition, APC can present internalized exogenous antigens to the cell surface through the MHC-I pathway, which is called "cross-presentation". The cross-presentation process is crucial for mRNA vaccines to induce cytotoxic T cell (CTL) and B cell responses.

[0004] In order to effectively induce adaptive immune responses, antigens translated in antigen-presenting cells (especially DC cells) need to be presented through MHC-I and MHC-II molecules. Therefore, the antigen presentation process is an important factor affecting the immune effect of mRNA vaccines. All endogenous proteins are affected by MHC-I antigen presentation, and only a portion of intracellular antigens are presented by MHC-II molecules. However, the presentation process of MHC-I antigens is usually not efficient. Even for high-affinity MHC-I ligands, only one in ten thousand antigen peptides are presented. Therefore, achieving efficient presentation of MHC-I and MHC-II antigens is of great significance for the development of mRNA vaccines. Common strategies currently include co-delivery of MHC molecules with antigens or targeting antigens to MHC molecules to enhance presentation efficiency. It has been reported that the combined use of DNA molecules encoding HPV-16E7 and DNA vaccines encoding heterologous MHC molecules can enhance the cross-presentation mechanism and significantly enhance E7-specific immune responses and anti-tumor effects.

[0005] A series of steps in antigen processing and presentation will affect the amount of epitope / MHC complex presented to the cell surface. In addition to using MHC-I and MHC-II class molecules to enhance antigen presentation, increasing the number of degraded antigen peptide molecules with antigen epitopes is also an important and effective means to enhance antigen presentation. Most MHC-I class antigen peptides are generally produced in a proteasome-dependent manner. Increasing antigen proteasome-dependent degradation strategies have been shown to improve MHC-I class presentation of antigens, thereby enhancing E7-specific CD8+T cell immune responses and significantly improving vaccine efficacy. Therefore, targeting the proteasome to increase antigen proteasome degradation may provide a new approach for the development of nucleic acid drugs. Summary of the invention

[0006] To solve the problems existing in the prior art, the present invention provides a vaccine design strategy for enhancing the antigen presentation effect, which is applied to the structural sequence design and preparation of nucleic acid, protein and polypeptide vaccines, providing a new way to promote the immune efficacy of vaccines and providing new ideas for the research and development of new treatment methods.

[0007] The present invention is proposed based on the following inventive works of the inventors:

[0008] Taking OVA as a model antigen protein, three peptide ligands of E3 ligases MDM2, VHL and Keap1 were selected to couple with it, including PMI, VHL Ligand (hereinafter referred to as VHLL) and Keap1 binding element (hereinafter referred to as Keap1B). At the same time, according to the structural characteristics of the protein complex of MDM2 binding to the tumor suppressor protein P53, the 17-26 positions of the helical residues of P53 were selected as the E3 ligase ligand (hereinafter referred to as P53B), and it was further verified that the binding or recruitment of ligands of E3 ubiquitin enzyme ligase can enhance the degradation of OVA antigen protein in the proteasome pathway in cells, and improve the tumor inhibition effect and anti-tumor activity of mRNA tumor vaccines. The technical scheme of the present invention can be further applied to the design of other mRNA tumor vaccines, and studies in a variety of tumor models have confirmed that it promotes the efficacy of antigen presentation and plays a role in activating specific T cells to kill tumor cells, achieving the effect of efficient tumor immunotherapy. The technical scheme of the present invention can also be further applied to the design of preventive mRNA vaccines to obtain enhanced immunogenicity.

[0009] In one aspect, the invention provides a nucleic acid molecule.

[0010] The open reading frame of the nucleic acid molecule comprises at least one antigenic element and at least one E3 ligand element, wherein the E3 ligand element is a binding or recruiting ligand of the E3 ubiquitin enzyme ligase.

[0011] The E3 ubiquitinase ligase in the nucleic acid molecule is selected from one or more of VHL (Von Hippel-Lindau), MDM2, CRBN, IAPs, RNF, β-TrCP, DCAF, Keap1 or its truncated form or its extended form;

[0012] Further, the E3 ubiquitinase ligase is selected from the group consisting of RING type, HECT type and RBR type;

[0013] Furthermore, the E3 ubiquitinase ligase in the nucleic acid molecule is preferably one or more of VHL (Von Hippel-Lindau), MDM2, β-TrCP, Keap1 or its truncated form or its extended form;

[0014] Further, the E3 ubiquitin enzyme ligase binding or recruiting ligand binds to one or more E3 ubiquitin enzyme ligases.

[0015] Furthermore, the amino acid sequence corresponding to the ligand bound or recruited by Keap1 is LDPETGEYL or a sequence with a homology greater than 60%.

[0016] Furthermore, the amino acid sequence corresponding to the ligand bound or recruited by the β-TrCP is DRHDSGLDSM or a sequence with a homology greater than 60%.

[0017] Furthermore, the amino acid sequence corresponding to the VHL binding or recruiting ligand is at least one of LAP(OH)YI or ALAPYIP, or a sequence with a homology greater than 60%.

[0018] Furthermore, the amino acid sequence corresponding to the MDM2 binding or recruiting ligand is one or more of ETFSDLWKLL, TSFAEYWNLLSP, LTFEHYWAQLTS, TNWYANLEKLLR, TAWYANFEKLLR, DWWPLAFEALLR, CNCKAPETALCARRCQQH or CNCKAPETFLCYWRCLQH, or a sequence with a homology greater than 60%.

[0019] Furthermore, in the above nucleic acid molecule, the antigen element and the E3 ligand element are connected in any form of E3 ligand element-antigen element, antigen element-E3 ligand element, E3 ligand element-antigen element-E3 ligand element or antigen element-E3 ligand element-antigen element.

[0020] Furthermore, the antigen element and the E3 ligand element are connected via a linker;

[0021] The amino acid sequence of the linker is one or more of GGGGS, (GGGGS)3, (GGGGS)6, (GGS)10 or (GSG)10.

[0022] Furthermore, the antigenic element is a natural antigenic protein, antigenic polypeptide or a truncation thereof.

[0023] Further, the antigenic element includes at least one antigenic epitope;

[0024] Furthermore, the antigenic element comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 antigenic epitopes.

[0025] Furthermore, the antigen epitope is a T cell antigen determinant cluster or a T cell antigen epitope.

[0026] The antigenic epitope is derived from an antigenic epitope peptide of a tumor, an antigenic epitope peptide of an autoimmune disease, or an antigenic epitope peptide of a pathogenic microorganism.

[0027] The tumor antigens or antigenic epitope peptides are optionally antigens caused by gene mutations, and / or tissue-specific differentiation antigens, and / or overexpressed antigens, and / or cancer-testis antigens, and / or universal antigens, and / or antigens derived from oncogenic viruses;

[0028] Furthermore, the antigen caused by the gene mutation is selected from one or more of p53, ras, β-catenin, CDK4, CDC27, and αactinin-4;

[0029] Further, the tissue-specific differentiation antigen is selected from one or more of Tyrosinase, TRP1 / gp75, TRP2, gp100, Melan-A / MART1, gangliosides, and PSMA;

[0030] Furthermore, the overexpressed antigen is selected from one or more of HER2, WT1, EphA3, EGFR, and CD20;

[0031] Further, the cancer-testis antigen is selected from one or more of MAGE, BAGE, GAGE, and NY-ESO-1;

[0032] Furthermore, the universal antigen is selected from one or more of Telomerase and Survivin;

[0033] Furthermore, the oncogenic virus-derived antigen is selected from one or more of EBV, HPV, HBV, human herpes virus, and Merkel cell polyomavirus.

[0034] In a specific embodiment, the nucleic acid molecule further comprises a signal peptide coding region.

[0035] Furthermore, the nucleic acid molecule further comprises a promoter, a 5' untranslated region, a 3' untranslated region and polyA.

[0036] The promoter is T7 or SP6 promoter.

[0037] Furthermore, the nucleic acid molecule is selected from at least one of DNA, ASO, siRNA, miRNA, mRNA, and aptamer;

[0038] Furthermore, the nucleic acid molecule is mRNA.

[0039] In another aspect, the present invention provides a nucleic acid vaccine, which comprises the above-mentioned nucleic acid molecule and optionally a pharmaceutically acceptable excipient or auxiliary component.

[0040] Furthermore, the nucleic acid vaccine is an mRNA vaccine, wherein the auxiliary component is a nanocarrier that carries the mRNA; and the auxiliary material is selected from at least one of an injection buffer medium, a freeze-dried or cryoprotectant.

[0041] Furthermore, the nanocarrier is selected from at least one of liposomes, nanoparticles, microspheres and lipid nanocarriers.

[0042] Furthermore, the nanocarrier is prepared using at least one of the following lipid materials:

[0043] DOTAP, DOTMA, DOTIM, DDA, DC-Chol, CCS, diC14-amidine, DOTPA, DOSPA, DTAB, TTAB, CTAB, DORI, DORIE and its derivatives, DPRIE, DSRIE, DMRIE, DOGS, DOSC, LPLL, DODMA, DDAB, Dlin-MC3-DMA, CKK-E12, C12-200, DSPC, DMG-PEG, DOPE, phosphatidylethanolamine, phosphatidylcholine and cholesterol.

[0044] Furthermore, in the mRNA vaccine, the mass ratio of lipid material to mRNA is (0.5-50):1, preferably (2-10):1.

[0045] Furthermore, the mRNA vaccine is formed by self-assembling the mRNA and lipid material using a microfluidic device;

[0046] or

[0047] The mRNA vaccine is formed by incubating the nanocarrier with mRNA.

[0048] In another aspect, the present invention provides a method for preparing the above-mentioned nucleic acid vaccine.

[0049] In another aspect, the present invention provides a protein; the protein is encoded by any one of the nucleic acid molecules described above.

[0050] In another aspect, the present invention provides a protein or polypeptide vaccine; wherein the above protein is used as an antigen component.

[0051] Furthermore, the protein or polypeptide vaccine further comprises a pharmaceutically acceptable adjuvant or auxiliary component; the adjuvant or auxiliary component is as defined in any of the above nucleic acid molecules;

[0052] Furthermore, the protein or polypeptide vaccine also contains an immune adjuvant.

[0053] Furthermore, the immune adjuvant is selected from one or more of Freund's incomplete adjuvant, complete Freund's adjuvant, aluminum hydroxide adjuvant, aluminum phosphate adjuvant, emulsified adjuvant, liposome adjuvant and microbial adjuvant.

[0054] In another aspect, the present invention provides a vector carrying the above-mentioned nucleic acid molecule.

[0055] Furthermore, the vector is a eukaryotic vector or a prokaryotic vector.

[0056] Furthermore, the vector comprises one or more selected from a plasmid vector, an adenovirus vector, a lentivirus vector and an adeno-associated virus vector.

[0057] In yet another aspect, the present invention provides a vector vaccine comprising an active ingredient; the active ingredient is obtained by loading the above-mentioned nucleic acid molecule into the above-mentioned vector.

[0058] On the other hand, the present invention provides a pharmaceutical composition, comprising the above-mentioned nucleic acid molecule, the above-mentioned nucleic acid vaccine, the mRNA vaccine prepared according to the above-mentioned method, the above-mentioned protein, the above-mentioned protein or polypeptide vaccine or the above-mentioned vector vaccine, and pharmaceutically acceptable excipients.

[0059] On the other hand, the present invention provides the use of the above-mentioned nucleic acid molecules, the above-mentioned nucleic acid vaccines, the mRNA vaccines prepared by the above-mentioned methods, the above-mentioned proteins, the above-mentioned protein or polypeptide vaccines or the above-mentioned vector vaccines, and the above-mentioned pharmaceutical compositions in the preparation of drugs for preventing or treating related diseases.

[0060] Furthermore, the disease is a tumor.

[0061] The beneficial effects of the present invention are:

[0062] The present invention provides a vaccine design method for enhancing antigen presentation effect, which can be applied to the sequence design and preparation of nucleic acid, protein and polypeptide vaccines.

[0063] The present invention encodes the target antigen and a ligand such as a polypeptide or protein domain with E3 ubiquitin ligase binding and recruitment function in the same nucleic acid sequence, so that after the nucleic acid molecule enters the cell, the fusion expression of the antigen protein and the E3 ubiquitin ligase ligand is achieved, thereby promoting the degradation of the antigen protein through the proteasome pathway, increasing the number and abundance of antigen peptides with antigenic epitopes, forming more peptide-MHC (p-MHC) complexes, and then being presented to the cell surface, enhancing subsequent immune responses, and exerting a highly efficient tumor immunotherapy effect.

[0064] The protein or polypeptide or nucleic acid molecule of the present invention encodes a protein or polypeptide whose antigen presentation process in cells depends on the ubiquitin-proteasome protein degradation pathway, selects different E3 ligase ligand sequences for modification and construction, screens E3 ubiquitin ligase ligands, and efficiently recruits E3 ligases, thereby achieving ubiquitination labeling and protein degradation of the protein or polypeptide of the present invention, thereby improving the antigen presentation of the vaccine immunogen. Therefore, the protein or polypeptide or nucleic acid vaccine provided by the present invention has an efficient antigen presentation effect, has strong immunogenicity, and has good prospects for clinical application. BRIEF DESCRIPTION OF THE DRAWINGS

[0065] Figure 1 The particle size and PDI results of mRNA-LNP in Example 3;

[0066] Figure 2 Potential result diagram of mRNA-LNP of Example 3;

[0067] Figure 3 Transmission electron microscopy image of OVA-P53B mRNA lipid nanoparticles of Example 3;

[0068] Figure 4 The results of the detection of the activation of lymph node T cells by mRNA lipid nanoparticles in Example 4 are shown in FIG. Figure 4 A is the data diagram of early activated cell T cell detection. Figure 4 B is a graph showing the data of late activated T cell detection;

[0069] Figure 5 The results of the detection of the activation of spleen T cells by mRNA lipid nanoparticles in Example 4 are shown in FIG. Figure 5 A is the data diagram of early activated cell T cell detection. Figure 5 B is a graph showing the data of late activated T cell detection;

[0070] Figure 6 Schematic diagram of the immunization scheme of Example 4;

[0071] Figure 7 E. Tumor growth curve of G7-OVA tumor-bearing mice;

[0072] Figure 8 Representative photos of tumors in each treatment group;

[0073] Fig. 9 E. Body weight-time curve of G7-OVA tumor-bearing mice;

[0074] Fig.10 This is a graph showing the results of antigen presentation detection mediated by each mRNA lipid nanoparticle in Example 5 in mice;

[0075] Fig.11The figure is a graph showing the specific CTL detection results of each mRNA lipid nanoparticle in Example 5 mediated in mice; wherein, Fig.11 A is a graph showing the results of specific CTL detection mediated by mRNA lipid nanoparticles in the lymph nodes of mice; Fig.11 B is the result of specific CTL detection mediated by mRNA lipid nanoparticles in the spleen of mice; Fig.11 C is a graph showing the results of specific CTL detection mediated by mRNA lipid nanoparticles in tumor tissues of mice;

[0076] Fig.12 The results of the mRNA lipid nanoparticles in Example 6 inducing CTL production in mice;

[0077] Fig.13 ALT, AST, TP, CRE, LDH, and UREA detection data in mouse serum of Example 7. DETAILED DESCRIPTION

[0078] The embodiments of the present invention are described in detail below. The embodiments described below are exemplary and are only used to explain the present invention, and should not be understood as limiting the present invention.

[0079] In this document, the terms “include” or “comprising” are open expressions, that is, including the contents specified in the present invention but not excluding other contents.

[0080] As used herein, the terms "optionally", "optional" or "optionally" generally mean that the subsequently described event or circumstance may but need not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.

[0081] Herein, the term "(XXXX)n" means n XXXX are linked, and X represents an amino acid. For example, "(GGGGS)3" means GGGGSGGGGSGGGGS.

[0082] Herein, the term "fragment" refers to a target protein or polypeptide, and a target protein or polypeptide having an N-terminal (N-terminus) or C-terminal (C-terminus) truncation, and / or internal deletion.

[0083] As used herein, the terms "identity", "homology" or "similarity" are used to describe an amino acid sequence or a nucleic acid sequence relative to a reference sequence, and the percentage of identical amino acids or nucleotides between two amino acid sequences or nucleic acid sequences is determined by conventional methods, for example, see Ausubel et al., eds. (1995), Current Protocols in Molecular Biology, Chapter 19 (Greene Publishing and Wiley-Interscience, New York); and the ALIGN program (Dayhoff (1978), Atlas of Protein Sequence and Structure 5: Suppl. 3 (National Biomedical Research There are many algorithms for aligning sequences and determining sequence identity, including the homology alignment algorithm of Needleman et al. (1970) J. Mol. Biol. 48:443; the local homology algorithm of Smith et al. (1981) Adv. Appl. Math. 2:482; the similarity search method of Pearson et al. (1988) Proc. Natl. Acad. Sci. 85:2444; the Smith-Waterman algorithm (Meth. Mol. Biol. 48:443); the local homology algorithm of Smith et al. (1981) Adv. Appl. Math. 2:482; the similarity search method of Pearson et al. (1988) Proc. Natl. Acad. Sci. 85:24 ... .70:173-187 (1997); and BLASTP, BLASTN, and BLASTX algorithms (see Altschul et al. (1990) J. Mol. Biol. 215:403-410). Computer programs that utilize these algorithms are also available, and include, but are not limited to: ALIGN or Megalign (DNASTAR) software, or WU-BLAST-2 (Altschul et al., Meth. Enzym., 266:460-480 (1996)); or GAP, BESTFIT, BLAST Altschul et al., supra, FASTA, and TFASTA, available in the Genetics Computing Group (GCG) package, Version 8, Madison, Wisconsin, USA; and CLUSTAL in the PC / Gene program provided by Intelligenetics, Mountain View, California.

[0084] In this article, the term "vector" generally refers to a nucleic acid molecule that can be inserted into a suitable host and replicates itself, and the inserted nucleic acid molecule is transferred into and / or between host cells. The vector may include a vector that is mainly used to insert DNA or RNA into a cell, a vector that is mainly used to replicate DNA or RNA, and a vector that is mainly used for the expression of transcription and / or translation of DNA or RNA. The vector also includes a vector with a variety of the above functions. The vector can be a polynucleotide that can be transcribed and translated into a polypeptide when introduced into a suitable host cell. Typically, the vector can produce a desired expression product by cultivating a suitable host cell that contains the vector.

[0085] As used herein, the term "pharmaceutical composition" generally refers to a unit dosage form and can be prepared by any of the methods well known in the pharmaceutical art. All methods include the step of combining the active ingredient with a carrier that constitutes one or more accessory ingredients. Generally, the composition is prepared by uniformly and thoroughly combining the active compound with a liquid carrier, a finely divided solid carrier, or both.

[0086] In this article, the term "pharmaceutically acceptable excipient" may include any solvent, solid excipient, diluent or other liquid excipient, etc., suitable for a specific target dosage form. Except for any conventional excipients incompatible with the compound of the present invention, such as any adverse biological effect produced or any other component of the pharmaceutically acceptable composition that interacts in a harmful manner, their use is also within the scope of the present invention.

[0087] In this article, the term "administration" refers to the introduction of a predetermined amount of material into a patient by a suitable method. The nucleic acid molecules, nucleic acid vaccines, vectors, vector vaccines, polypeptides, antibodies or antigen binding fragments, recombinant proteins, multispecific antibodies, protein or polypeptide vaccines, conjugates or pharmaceutical compositions of the present invention can be administered by any common route as long as it can reach the desired tissue. Various modes of administration are expected, including peritoneal, intravenous, intramuscular, subcutaneous injection, etc., but the present invention is not limited to these exemplified modes of administration. Preferably, the composition of the present invention is administered by intravenous or subcutaneous injection.

[0088] In this article, "E3 ubiquitin enzyme ligase" participates in various physiological processes in cells by regulating the ubiquitination process of regulatory proteins. All E3s have the ability to connect target proteins and specific E2s. There are two main categories of known E3 ubiquitin ligases: the HECT domain family and the RING domain family, as well as the U-box protein family. The HECT domain mainly functions by forming a thioester bond with ubiquitin that is necessary for catalysis, and the RING domain provides a residence site for E2 and the substrate, allowing E2 to catalyze the transfer of ubiquitin to the substrate.

[0089] As used herein, the term "binding or recruiting ligand of an E3 ubiquitin enzyme ligase" is equivalent to "E3 ligand", "E3 ligand element", and "E3 ligase ligand", and refers to a natural or artificial polypeptide, protein, or a truncation or extension thereof, or a compound that is capable of binding to or recruiting an E3 ubiquitin enzyme ligase.

[0090] Since most peptides presented by MHC-I molecules are derived from the degradation of antigenic proteins, the strategy of increasing the proteasome degradation of antigens in vivo has been shown to improve the MHC-I presentation of antigens. The present invention pioneered the use of E3 ubiquitinase ligase recruitment ligands to connect with antigenic elements to form fusion proteins, which may cause self-ubiquitination through the ubiquitin-proteasome system (UPS) in vivo to trigger its own ubiquitin degradation, thereby increasing the number of ubiquitination degradation of antigenic proteins to improve the abundance of effectively available antigens, thereby enhancing the direct presentation of MHC-I of target proteins or target antigenic determinants, and further enhancing vaccine-induced immune responses.

[0091] The sequence design of mRNA drugs is crucial to their ultimate efficacy. Although the coding region of mRNA is not as highly plastic as the non-coding region, due to the good adaptability of mRNA molecules, the coding region can be slightly functionally modified during the design and synthesis process to enhance the efficacy. Since the mRNA vaccine involves a very important step in the immune process: antigen presentation of degraded peptides. Most peptides presented by MHC-I molecules are derived from the degradation of antigenic proteins, and the ubiquitin-proteasome degradation mechanism can achieve targeted degradation of target proteins. Based on this, the present invention specifically increases the proteasome degradation of target antigenic proteins, thereby enriching the number of candidates for MHC-I presented peptides. Specifically, the polypeptide E3 ligase ligand is fused and encoded into the mRNA molecule, and the rapid and efficient ubiquitination of the target antigenic protein is induced by recruiting the E3 ligase, and then the degradation of the target antigenic protein is promoted through the proteasome pathway to increase the abundance of the pMHC complex, thereby enhancing the antigen presentation of mRNA drugs, triggering an efficient immune response, and achieving a strong tumor immunotherapy effect.

[0092] The present invention designs and verifies the following technical solutions for preparing vaccines:

[0093] A nucleic acid molecule, whose open reading frame comprises at least one antigenic element, and at least one E3 ligand element, wherein the E3 ligand element is a binding or recruiting ligand of an E3 ubiquitinase ligase.

[0094] Its open reading frame encodes the following structural elements:

[0095] Antigenic element-(linker)-ligand recruitment element of E3 ubiquitin enzyme ligase.

[0096] The recruitment ligand element of the E3 ubiquitin enzyme ligase of the present invention is not directly or through the linker element connected to the ligand bound by the target protein in the cell, but is connected to the antigen element. Experiments have shown that the above structure of the present invention can effectively increase the amount of antigen protein degradation, thereby improving the abundance of effectively available antigens, thereby enhancing the direct presentation of the target protein by MHC-I, and further enhancing the immune response induced by the vaccine.

[0097] The open reading frame of the nucleic acid molecule of the present invention at least comprises the following structures: E3 ligand-antigenic element, antigenic element-E3 ligand, E3 ligand-antigenic element-E3 ligand or antigenic element-E3 ligand-antigenic element.

[0098] When there is a linker element between the elements, it has the following structure: E3 ligand-linker-antigen element, antigen element-linker-antigen element-linker-antigen element-linker-E3 ligand, E3 ligand-linker-antigen element-linker-E3 ligand or antigen element-linker-E3 ligand-linker-antigen element.

[0099] Wherein, the linker element comprises GGGGS, (GGGGS)3, (GGGGS)6, (GGS) 10 or (GSG) 10 One or more in a sequence.

[0100] According to an embodiment of the present invention, the amino acid sequence of the linker is at least one of GGGGS, (GGGGS)3, (GGGGS)6, (GGS)10 or (GSG)10.

[0101] The amino acid sequence of GGGGS is: GGGGS (Seq ID No. 1);

[0102] The amino acid sequence of (GGGGS)3 is: GGGGSGGGGSGGGGS (Seq ID No. 2);

[0103] The amino acid sequence of (GGGGS)6 is: GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (Seq ID No. 3);

[0104] The amino acid sequence of (GGS)10 is: GGSGGSGGSGGSGGSGGSGGSGGSGGSGGS (Seq ID No. 4);

[0105] The amino acid sequence of (GSG)10 is: GSGGSGGSGGSGGSGGSGGSGGSGGSGGSG (Seq ID No. 5).

[0106] The vaccine design strategy for enhancing antigen presentation effect of the present invention can be applied to the structural sequence design and preparation of nucleic acid, protein and polypeptide vaccines.

[0107] The E3 ubiquitin enzyme ligase recruitment ligand element refers to any polypeptide, protein and nucleic acid encoding sequence thereof that can bind to the E3 ubiquitin ligase.

[0108] The binding or recruiting ligand of the E3 ubiquitin ligase can bind to one or more E3 ubiquitin ligases. Common E3 ubiquitin ligase molecules include VHL, MDM2, CRBN, and IAPs. Common ligands of E3 ubiquitin ligase molecules include VHL ligand (VHLL), with an amino acid sequence of ALAPYIP; and the binding element of Keap1, with an amino acid sequence of LDPETGEYI.

[0109] Further classification and sequence information are listed in the following table:

[0110] Table 1

[0111]

[0112] In a specific embodiment, the amino acid sequences of Keap1, β-TrCP, VHL, and MDM2 in Table 1 above may also use sequences with a homology greater than 60%;

[0113] In other specific embodiments, the amino acid sequences of Keap1, β-TrCP, VHL, and MDM2 in Table 1 above may also use sequences with a homology greater than 70%;

[0114] In other specific embodiments, the amino acid sequences of Keap1, β-TrCP, VHL, and MDM2 in Table 1 above may also use sequences with a homology greater than 80%;

[0115] In other specific embodiments, the amino acid sequences of Keap1, β-TrCP, VHL, and MDM2 in Table 1 above may also use sequences with a homology greater than 90%;

[0116] In other specific embodiments, the amino acid sequences of Keap1, β-TrCP, VHL, and MDM2 in Table 1 above may also use sequences with a homology greater than 95%;

[0117] In a specific implementation, the N-terminus of the open reading frame is also connected to a coding sequence of a signal peptide, which generally uses a class I MHC transport signal sequence, or can also use a signal peptide of the antigen source protein itself or other signal peptides commonly used in the art.

[0118] Wherein, the antigenic element is at least one known or unknown antigenic epitope.

[0119] The antigenic epitope may be an antigenic epitope from any source, such as an antigenic epitope derived from a tumor, an antigenic epitope derived from an autoimmune disease, or an antigenic epitope derived from an infectious disease.

[0120] The antigenic element is an antigenic polypeptide or protein currently known or unknown in the art that contains at least one antigenic epitope.

[0121] One embodiment of the present invention is to directly use an antigen protein as an antigen element. The number of antigen proteins can be one.

[0122] Another embodiment is to use a polypeptide molecule obtained by re-fusion of one or more antigenic epitope peptides as an antigenic element.

[0123] The antigenic epitope may be an antigenic epitope from any source, such as an antigenic epitope derived from a tumor, an antigenic epitope derived from an autoimmune disease, or an antigenic epitope derived from an infectious disease.

[0124] The antigen or antigen epitope peptide is derived from a tumor antigen, a viral pathogen antigen or any combination thereof.

[0125] The tumor antigen is any tumor-specific antigen, tumor-associated antigen or tumor neoantigen.

[0126] The tumors include, but are not limited to, breast cancer, ovarian cancer, breast cancer, testicular cancer, pancreatic cancer, liver cancer, colon cancer, colorectal cancer, thyroid cancer, lung cancer, prostate cancer, kidney cancer, melanoma, squamous cell carcinoma, digestive tract adenocarcinoma, chronic myeloid leukemia, acute lymphocytic leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, promyelocytic leukemia, multiple myeloma, B-cell lymphoma, bladder cancer, head and neck cancer, esophageal cancer, brain cancer, pharyngeal cancer, tongue cancer, synovial cell cancer, neuroblastoma, uterine cancer, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, chordoma, angiosarcoma, endothelial cell carcinoma, sarcoma, lymphangiosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, basal cell carcinoma, epidermoid carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, uterine cancer, cervical cancer, small cell lung cancer, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, brain or intrathecal tumor, glioma, or retinoblastoma.

[0127] The one or more antigenic epitopes are one, two or more epitopes of one or more tumor-associated antigens, wherein the tumor-associated antigen is selected from kallikrein 4, papillomavirus binding factor (PBF), preferentially expressed melanoma antigen (PRAME), Wilm's tumor-1 (WT1), hydroxysteroid dehydrogenase-like 1 (HSDL1), mesothelin, cancer testis antigen (NY-ESO-1), carcinoembryonic antigen (CEA), p53, human epidermal growth factor receptor 2 / neural receptor tyrosine kinase (Her2 / Neu), cancer-associated epithelial cell adhesion molecule (EpCAM), ovarian and uterine cancer antigen progenitor (CA125), folate receptor α, sperm protein 17, tumor-associated differentially expressed gene-12 (TADG-12), mucin-16 (MUC-16), L1 cell adhesion molecule (L1CAM), mannan-MUC-1, human endogenous retrovirus K (HERV-K-MEL), Kita-kyushu lung cancer antigen-1 (KK-LC-1), human cancer / testis antigen (KM-HN-1), cancer testis antigen (LAGE-1), melanoma antigen-A1 (MAGE-A1), sperm surface zona pellucida binding protein (Sp17), synovial sarcoma,X breakpoint 4 (SSX-4), transient axonal glycoprotein-1 (TAG-1), transient axonal glycoprotein-2 (TAG-2), activation homolog (ENAH), mammaglobulin-A, NY-BR-1, breast cancer antigen, (BAGE-1), B melanoma antigen, melanoma antigen-A1 (MAGE-A1), melanoma antigen-A2 (MAGE-A2), mucin k, synovial sarcoma, X breakpoint 2 (SSX-2), paclitaxel resistance-associated gene-3 (TRAG-3), avian cytomegalovirus oncogene (c-myc), cyclin B1, mucin 1 (MUC1), p62, survivin, lymphocyte common antigen (CD45), Dekovic WNT signaling inhibitor 1 (DKK1), telomerase, Kirsten rat sarcoma viral oncogene homolog (K-ras), G250, intestinal carboxylesterase, alpha-fetoprotein, macrophage colony-stimulating factor (M-CSF), prostate-specific membrane antigen (PSMA), caspase 5 (CASP-5), cytochrome C oxidase assembly factor 1 homolog (COA-1), O-linked β-N-acetylglucosamine transferase (OGT), osteosarcoma amplification 9, endoplasmic reticulum lectin (OS-9), transforming growth factor β receptor 2 (TGF-βRII), murine leukemia glycoprotein 70 (gp70), calcitonin-related polypeptide alpha (CALCA), program Sex cell death 1 ligand 1 (CD274), mouse double minute 2 homolog (mdm-2), alpha-actinin-4, elongation factor 2, maloenzyme 1 (ME1), nuclear transcription factor Y subunit C (NFYC), G antigen 1,3 (GAGE-1,3), melanoma antigen-A6 (MAGE-A6), cancer testis antigen XAGE-1b, six transmembrane epithelial antigen of prostate 1 (STEAP1), PAP, prostate-specific antigen (PSA), fibroblast growth factor 5 (FGF5), heat shock protein hsp70-2, melanoma antigen-A9 (MAGE-A9), Arg-specific ADP-ribosyltransferase family C (ARTC1) , B-Raf proto-oncogene (B-RAF), serine / threonine kinase, β-catenin, cell division cycle 27 homolog (Cdc27), cyclin-dependent kinase 4 (CDK4), cyclin-dependent kinase 12 (CDK12), cyclin-dependent kinase inhibitor 2A (CDKN2A), casein kinase 1α1 (CSNK1A1), fibronectin 1 (FN1), specific growth inhibitor 7 (GAS7), glycoprotein non-metastatic melanoma protein B (GPNMB), HAUS-like Augmin complex subunit 3 (HAUS3), LDLR-fucosylated, T cell recognition melanoma antigen 2 (MART2),Myostatin (MSTN), melanoma associated antigen (mutated) 1 (MUM-1-2-3), Poly (A) polymerase gamma (neo-PAP), myosin class I, protein phosphatase 1 regulatory subunit 3B (PPP1R3B), peroxiredoxin-5 (PRDX5), receptor type tyrosine protein phosphatase kappa (PTPRK), transforming protein N-Ras (N-ras), retinoblastoma-associated factor 600 (RBAF600), sirtuin-2 (SIRT2), SNRPD1, triosephosphate isomerase, ocular albinism type 1 protein (OA1), member of the RAS oncogene family (RAB38), tyrosinase-related protein 1-2 (TRP-1-2), melanoma antigen gp75 (g p75), tyrosinase, melanin-A (MART-1), glycoprotein 100 melanoma antigen (GP100), N-acetylglucosaminyl transfer V gene (GnTVf), lymphocyte antigen 6 complex locus K (LY6K), melanoma antigen-A10 (MAGE-A10), melanoma antigen-A12 (MAGE-A12), melanoma antigen-C2 (MAGE-C2), melanoma antigen NA88-A, paclitaxel resistance-associated protein 3 (TRAG-3), PDZ binding kinase (pbk), caspase 8 (CASP-8), sarcoma antigen 1 (SAGE), break cluster region-Abelson oncogene (BCR-ABL), leukemia fusion protein, dek-can, elongation factor Tu GTP binding domain 2 (EFTUD2), ETS variant gene 6 / acute myeloid leukemia fusion protein (ETV6-AML1), FMS-like tyrosine kinase-3 internal tandem duplication (FLT3-ITD), cyclin A1, fibronectin type III domain 3B (FDNC3B), promyelocytic leukemia / retinoic acid receptor alpha fusion protein (pml-RARα), melanoma antigen-C1 (MAGE-C1), membrane protein alternative splicing isoform (D393-CD20), melanoma antigen-A4 (MAGE-A4) or melanoma antigen-A3 (MAGE-A3).

[0128] The infectious diseases mentioned are bacterial infection, viral infection, and some other pathogenic microorganisms, such as diseases caused by infections of rickettsia, chlamydia, mycoplasma, etc.

[0129] The viral pathogen is selected from, including but not limited to: one or more of dengue virus, Ebola virus, EBV, hepatitis A virus, hepatitis B virus, hepatitis C virus, hepatitis D virus, HIV, HSV1, HSV2, cytomegalovirus (CMV), influenza A virus, Marburg virus, human respiratory syncytial virus (RSV), SARS coronavirus (SARS-CoV), West Nile virus, human papillomavirus (HPV), human rhinovirus (HRV), Epstein-Barr virus (EBV), human rabies virus (HRV) and Zika virus.

[0130] The bacterial pathogen is selected from, but is not limited to: Acinetobacter baumanii, Burkholderia cepacia, Bacterioides fragilis, Chlamydia trachomatis, Citrobacter freundii, Campylobacter jejuni, Escherichia coli, Enterobacter aerogenes, Enterobacter cloacae, Haemophilus infb, Helicobacter pylori, Klebsiella oxytoca, K. pneumonia (MDR / CRE), Legionella pneumophila, Neisseria meningitidis, meningitides), Neisseria gonorrhoeae, Pseudomonas aeruginosa, Salmonella typhi, Paratyphi, Typhimurium, Serratia marcescens, Shigella flexneri, Stenotrophomonas maltophilia, Yersinia pseudotuberculosis, Bacillus subtilis, Clostridium neoformans, C. difficile, C. perfringens, Corynebacterium spp., Enterococcus faecalis, Enterococcus faecium faecium), vancomycin-resistant enterococci (VRE), Listeria monocytogenes, Mycobacterium avium, Mycobacterium tuberculosis, Mycobacterium leprae,leprae), Nocardia farcinica, Propionibacterium acnes, Staphylococcus aureus, methicillin-sensitive Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), Staphylococcus epidermidis, Streptococcus pyogenes, Group A Streptococcus, Group B Streptococcus (Streptococcus agalactiae), and Group C Streptococcus.

[0131] The fungal pathogen is selected from, including but not limited to: Aspergillus spp., Blastomyces, Candida albicans, glabrata, guilliermondii, krusei, parapsilosis, tropicalis, Cryptococcus, Fusarium spp., Mucor spp., Saccharomyces and Pneumocystis jirovecii (carinii) One or more.

[0132] In some embodiments, the tumor antigen or antigenic epitope peptide is optionally an antigen caused by gene mutation, and / or tissue-specific differentiation antigen, and / or overexpressed antigen, and / or cancer-testis antigen, and / or universal antigen, and / or oncogenic virus-derived antigen;

[0133] Among the tumor antigens, the antigen caused by the gene mutation is selected from one or more of p53, ras, β-catenin, CDK4, CDC27, and αactinin-4;

[0134] Among them, the tissue-specific differentiation antigen in the tumor antigen is selected from one or more of Tyrosinase, TRP1 / gp75, TRP2, gp100, Melan-A / MART1, gangliosides, and PSMA;

[0135] Wherein, the overexpressed antigen in the tumor antigen is selected from one or more of HER2, WT1, EphA3, EGFR, and CD20;

[0136] Wherein, the cancer-testis antigen in the tumor antigen is selected from one or more of MAGE, BAGE, GAGE, and NY-ESO-1;

[0137] Wherein, the universal antigen in the tumor antigen is selected from one or more of Telomerase and Survivin;

[0138] Among them, the oncogenic virus-derived antigens in the tumor antigens can be selected from one or more of EBV and HPV.

[0139] It should be noted that, for the nucleic acid molecules mentioned herein, those skilled in the art will understand that they actually include any one or two of the complementary double strands. For convenience, in this article, although only one strand is provided in most cases, the other strand complementary thereto is actually disclosed. In addition, the nucleic acid sequence in this application includes a DNA form or an RNA form, and disclosing one of them means that the other is also disclosed.

[0140] When the above-mentioned nucleic acid molecules are connected to the vector, the nucleic acid molecules can be directly or indirectly connected to the control elements on the vector, as long as these control elements can control the translation and expression of the nucleic acid molecules. Of course, these control elements can come directly from the vector itself, or they can be exogenous, that is, they are not from the vector itself. Of course, the nucleic acid molecules can be operably connected to the control elements. Herein, "operably connected" means connecting the exogenous gene to the vector so that the control elements in the vector, such as transcription control sequences and translation control sequences, can play their expected functions of regulating the transcription and translation of the exogenous gene. Commonly used vectors can be, for example, plasmids, viral vectors, bacteriophages, etc. After the vectors according to some specific embodiments of the present invention are introduced into suitable recipient cells, the expression of the aforementioned proteins, antibodies or conjugates can be effectively achieved under the mediation of the regulatory system, thereby achieving a large amount of in vitro acquisition of proteins, antibodies or conjugates.

[0141] Meanwhile, the present invention designs a series of nucleic acid molecules containing the above open reading frames. In addition to the coding region encoding the antigen element-(linker)-E3 ubiquitin enzyme ligase recruitment ligand element structure, these open reading frames may or may not contain a signal peptide sequence coding region.

[0142] The above nucleic acid molecule may also contain a 5' untranslated region, an open reading frame, and a 3' untranslated region connected in sequence. It may also contain a promoter. The DNA template of the promoter, the 5' untranslated region, the open reading frame, and the 3' untranslated region connected in sequence can be transcribed to obtain mRNA. The transcription process can be performed by existing in vitro transcription methods and related kits. Furthermore, the above nucleic acid molecule may also contain a polyA fragment.

[0143] In one embodiment, the promoter is a T7 or SP6 promoter.

[0144] In one embodiment, the nucleotide sequence of the 5' untranslated region is as follows (Seq ID No. 18):

[0145] AGGCAAAAATCAAAATCAATCATCATCACAACATCAACAATCAATCATCAACACATCATCAAGACAGCCACC.

[0146] In one embodiment, the nucleotide sequence of the 3' untranslated region is as follows (Seq ID No. 19):

[0147] TGATGAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACTGGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGCTG CGTCGAGAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACTGGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGC.

[0148] In one embodiment, the nucleotide sequence of polyA is as follows (Seq ID No. 20):

[0149] AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGTCTTCAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA.

[0150] The above nucleic acids, proteins or polypeptides can be used as active ingredients to prepare drugs or vaccines for preventing and / or treating diseases. Generally speaking, those skilled in the art can use the above proteins as antigenic active ingredients to prepare protein or polypeptide vaccines. The vaccine uses the above proteins as antigenic components and pharmaceutically acceptable excipients or auxiliary components.

[0151] When preparing vaccines, immune adjuvants are often added to enhance the body's immune response to the vaccine. The immune adjuvants include incomplete Freund's adjuvant, complete Freund's adjuvant, aluminum hydroxide adjuvant, aluminum phosphate adjuvant, emulsion adjuvant, liposome adjuvant, microbial adjuvant, etc.

[0152] Naturally, based on the proteins described in the present invention, antibodies against the above proteins can be easily obtained in the art. The above antibodies are polyclonal antibodies or monoclonal antibodies; preferably monoclonal antibodies. The above antibodies also form conjugates with coupling moieties. Furthermore, the coupling moieties are selected from one or more of radionuclides, drugs, toxins, cytokines, enzymes, fluorescein, carrier proteins or biotin. Antibodies that can specifically bind to the aforementioned proteins can be used for the preparation of drugs on the one hand, and can be used for related immunoassays of the aforementioned proteins on the other hand.

[0153] In addition, the present invention also includes the coding gene of the above protein. The coding gene of the above protein can be used to express and prepare the above protein or antibody on the one hand; on the other hand, it can also be operably loaded in an expression vector, and then prepared into a vector vaccine or vector medicine. Expression can be selected from common vectors such as plasmid vectors, adenovirus vectors, lentivirus vectors or adeno-associated virus vectors. When an adenovirus vector is used, a replication-deficient adenovirus vector is generally used.

[0154] For example, when the nucleic acid molecule is DNA, the mRNA obtained by transcription thereof can be prepared into an mRNA vaccine together with pharmaceutically acceptable excipients or auxiliary components. The auxiliary component can be a nanocarrier that carries the mRNA. The nanocarrier commonly used is a lipid nanocarrier. For example, a lipid nanocarrier prepared from at least one of the following raw materials is used: DOTAP, DOTMA, DOTIM, DDA, DC-Chol, CCS, diC14-amidine, DOTPA, DOSPA, DTAB, TTAB, CTAB, DORI, DORIE and its derivatives, DPRIE, DSRIE, DMRIE, DOGS, DOSC, LPLL, DODMA, DDAB, Dlin-MC3-DMA, CKK-E12, C12-200, DSPC, DMG-PEG, DOPE, phosphatidylethanolamine (PE), phosphatidylcholine (PC), cholesterol (Chol).

[0155] Preferably, the lipid material used to prepare the nanocarrier is an amphiphilic lipid material or a cationic lipid material, because such lipid materials have a positive charge on the surface under acidic conditions, and can wrap the mRNA molecule into the inside through electrostatic adsorption with the phosphate group of the nucleic acid to form an mRNA-lipid complex. The mRNA-lipid complex can be adsorbed by the cell membrane with a negative charge on the surface, and then through membrane fusion or cell endocytosis, the mRNA is delivered into the cell for further expression, thereby exerting the immune effect of the vaccine.

[0156] Generally speaking, the preparation of the above-mentioned mRNA vaccine can use microfluidic equipment to allow mRNA and lipid materials to self-assemble to form an mRNA-lipid complex, or after the nanocarrier is prepared, it can be incubated with mRNA to form an mRNA-lipid complex.

[0157] The present invention is further described in detail below through the description of embodiments.

[0158] Example 1 Construction of mRNA transcription vector template containing E3 ubiquitin ligase ligand antigen element

[0159] The mRNA transcription template DNA in this embodiment is connected in sequence by the promoter, the 5' untranslated region, the signal peptide sequence, the antigen coding region sequence, the linker sequence, the E3 ubiquitin ligase recruitment ligand sequence, the 3' untranslated region, and Poly (A), and connected to the corresponding position of the plasmid, and the sequence is verified by sequencing to obtain the mRNA transcription template DNA. Among them, the signal peptide sequence and the antigen coding region sequence, the linker sequence, and the E3 ubiquitin ligase recruitment ligand sequence can be provided as two sequences respectively, or they can be provided in the same sequence.

[0160] The promoter is T7 or SP6 promoter.

[0161] Chicken ovalbumin (OVA) was used as a model antigen, and three E3 ubiquitin ligases PMI, VHL, and Keap1 recruiting ligands P53B, PMI, VHLL, and keap1B were selected to construct and prepare mRNAs encoding the full-length OVA protein, namely OVA-mRNA (control), OVA-P53B mRNA, OVA-PMI mRNA, OVA-VHLL mRNA, and OVA-keap1B mRNA. At the same time, a positive control OVA-H2Db mRNA was constructed. The antigen coding region was connected to the corresponding position of the plasmid vector and sequenced for verification. The results are shown in Table 2.

[0162] Table 2: mRNA sequence information containing E3 ubiquitin ligase ligand antigenic elements

[0163] mRNA ID Amino acid sequence corresponding to the E3 ubiquitin ligase ligand coding sequence OVA mRNA / OVA-H2Db mRNA / OVA-P53B mRNA ETFSDLWKLL OVA-PMI mRNA TSFAEYWNLLSP OVA-VHLL mRNA ALAPYIP OVA-keap1B mRNA PETGEYL LD

[0164] Example 2 In vitro transcription of mRNA containing E3 ubiquitin ligase ligand antigen element

[0165] The mRNA transcription template DNA of Example 1 was inserted into the pUC57 vector to prepare plasmid DNA, and the plasmid DNA was digested with reference to the "Molecular Cloning Experiment Guide (Fourth Edition)", commercially available restriction endonucleases and DNA purification kit product instructions, and processed into a linearized plasmid DNA template, and then the linearized plasmid DNA template was purified. The concentration and purity of the plasmid DNA and the linearized DNA template were detected by spectrophotometry and gel electrophoresis, and whether the linearization was complete was confirmed by electrophoresis verification.

[0166] RNA polymerase, NTP and cap analogs were used to synthesize and prepare mRNA. In vitro transcription of precursor mRNA was performed according to the operating instructions of the kit (Novozyme TR101-02). The details are as follows:

[0167] Add the relevant reactants to a 1.5mL centrifuge tube according to the dosage and order in Table 3, pipette and pipette 3 times or tap the bottom of the tube with your fingers to mix, and centrifuge briefly to collect the reaction solution at the bottom of the tube. After incubating in a 37℃ water bath for 4h, add 1μL DNase and incubate at 37℃ for 15min; then add 179μL of nuclease-free water, and then add 200μL of phenol / chloroform / isoamyl alcohol (25:24:1) solution to extract mRNA. After mixing, centrifuge at 15000rpm for 10min, and then take the aqueous phase. Then add 200μL of 5M ammonium acetate solution and place at 4℃ overnight to precipitate mRNA. Then take out and centrifuge at 4℃ and 15000rpm for 10min, and carefully remove the supernatant. Add 1mL 70% ethanol to wash the precipitate, centrifuge at 4℃ and 15000rpm for 10min, carefully remove the supernatant, and air-dry the precipitate. Then add 20 μL of nuclease-free water to reconstitute the mRNA solution.

[0168] The purity of mRNA was detected by agarose gel electrophoresis or nucleic acid fragment analyzer.

[0169] Table 3: mRNA transcription reaction solution recipe

[0170]

[0171] Example 3 Preparation of mRNA lipid nanoparticles (mRNA-LNP)

[0172] As shown in Table 4, mRNA lipid nanoparticles can be prepared by selecting a suitable formulation according to the needs of mRNA, target organs, etc. The specific method is as follows:

[0173] The lipid material in the prescription is dissolved in an ethanol solution and then mixed with the corresponding mRNA solution to allow it to self-assemble into mRNA-lipid nanoparticles, and then the ethanol is removed by a tangential flow system and sterilized and filtered to obtain the mRNA-lipid nanoparticles. The specific method is as follows:

[0174] (1) Solution preparation: cationic lipids (MC3, DTAB, DC-Chol, CTAB, DOTMA, DDA, DOTAP), auxiliary lipids (DSPC or DOPE), cholesterol (Chol), and DMG-PEG2000 were dissolved in anhydrous ethanol to obtain a lipid solution with a concentration of 10 mg / mL of ionizable lipids. The molar ratio of cationic lipids, auxiliary lipids, cholesterol (Chol), and DMG-PEG2000 was 50:10:38.5:1.5. mRNA was diluted to an appropriate concentration with PBS buffer (prepared with RNase-free water) for later use.

[0175] (2) LNP preparation: The lipid solution obtained in step (1) was mixed with mRNA solutions of different concentrations to obtain samples with different mass ratios of cationic lipid to mRNA as shown in Table 4. The mixing was performed in a microfluidic device (Mianna (Shanghai) Instrument Technology Co., Ltd.), and the mixing process parameters were: the volume ratio of lipid solution to mRNA solution was 1:3, and the total flow rate was 9 mL / min.

[0176] (3) Ultrafiltration: The LNP preparation prepared by microfluidics was diluted 25 times with PBS buffer and ultrafiltered to the initial volume using an ultrafiltration cup to obtain the final LNP preparation. During the ultrafiltration process, ethanol was removed to obtain mRNA lipid nanoparticles. Ultrafiltration process parameters: filter membrane 100 kDa, air pressure 0.2 MPa, rotation speed 100-200 rpm.

[0177] By using the above method, lipid nanoparticles encapsulating 6 mRNAs including OVA-mRNA, OVA-H2Db mRNA, OVA-P53B mRNA, OVA-PMI mRNA, OVA-VHLL mRNA and OVA-keap1B mRNA obtained in Example 1 and blank lipid nanoparticles without mRNA were prepared according to the lipid prescription and mass ratio of prescription 1 in Table 4. The particle size and potential of the prepared 7 mRNA lipid nanoparticles and the mRNA encapsulation efficiency were detected. The specific detection method is as follows:

[0178] A certain volume of mRNA lipid nanoparticle colloidal solution was measured and diluted with purified water to an mRNA concentration of 0.01 mg / ml. The particle size and potential of the mRNA lipid nanoparticles were measured in a laser particle size analyzer (n=3, i.e., each prescription was measured 3 times). The test results showed that the particle size of the 7 prepared mRNA lipid nanoparticles was about 100 nm ( Figure 1 -mRNA-LNP particle size and PDI result diagram), PDI is about 0.2, and potential is about 25mV ( Figure 2 -mRNA-LNP potential result diagram), the uniformity is good.

[0179] Encapsulation efficiency detection: using Quant-iT TM RiboGreen TM The kit was used to detect the encapsulation efficiency. The test results are shown in Table 5, indicating that the prepared mRNA-LNP has good nanoformulation properties, the encapsulation efficiency is greater than 95%, and the mRNA has good protection.

[0180] The prepared OVA-P53B mRNA lipid nanoparticles were observed under a transmission electron microscope (TEM) and photographed. Figure 3 As shown, the TEM results of OVA-P53B mRNA lipid nanoparticles showed that they had a spherical structure with a round appearance, and the particle size was basically consistent with the results measured by a particle size analyzer.

[0181] Other OVA-PMI mRNA, OVA-VHLL mRNA, and OVA-keap1B mRNA lipid nanoparticles had similar effects as described above when observing LNP morphology under transmission electron microscopy (TEM);

[0182] Table 4 Prescription of mRNA lipid nanoparticles

[0183]

[0184]

[0185] Table 5 mRNA-LNP encapsulation efficiency test results

[0186] mRNA-LNP Encapsulation rate (%) OVA mRNA-LNP 95.87 OVA-H2Db mRNA-LNP 98.02 OVA-P53B mRNA-LNP 97.65 OVA-PMI mRNA-LNP 96.61 OVA-VHLL mRNA-LNP 95.11 OVA-keap1B mRNA-LNP 97.27

[0187] Example 4 In vivo activation of T cells by mRNA lipid nanoparticles containing E3 ubiquitin ligase ligand antigen elements

[0188] The lipid nanoparticles loaded with OVA-mRNA and OVA-P53B mRNA prepared in Example 3 were administered to mice, and the mRNA content in the lipid nanoparticle sample was 0.1 mg / mL; the specific operation was as follows:

[0189] After 1 week of adaptive feeding, C57BL / 6 mice were divided into control group, OVA group and OVA-P53 group, with 4 mice in each group. The mice were immunized intravenously, and the control group was given 100μL of normal saline, and the OVA group and OVA-P53 group were given 100μL of the corresponding mRNA lipid nanoparticle samples. After 36h of administration, all mice were killed and dissected, and spleen and lymph node tissues were collected, processed, and filtered to obtain a single cell suspension. After centrifugation at 400g, red blood cell lysis buffer was added and lysed at room temperature for a second centrifugation, and the supernatant was discarded. T cell protein antibodies (including anti-CD45, anti-CD3ε, anti-CD4, anti-CD8, anti-CD25, anti-CD69) were added respectively, and the cells were stained and centrifuged at room temperature, and the supernatant was discarded. The cells were resuspended and detected by flow cytometry.

[0190] The results are as follows Figure 4 and Figure 5 As shown:

[0191] Figure 4 The results of lymph node immune cell detection, including: Figure 4 A is early activated CD8 + and CD4 + T cell detection data chart, Figure 4 B is the late activated CD8 + and CD4 + T cell detection data diagram; As can be seen from the figure, in the lymph node site, the lipid nanoparticles of the present embodiment connected to the OVA-P53B mRNA of the E3 ubiquitin ligase recruiting ligand P53B can better activate CD8 + T cells and CD4 + T cells;

[0192] Figure 5 The results of spleen immune cell detection, among which, Figure 5 A is early activated CD8 + and CD4 + T cell detection data chart, Figure 4 B is the late activated CD8 + and CD4 + T cell detection data diagram; As can be seen from the figure, in the spleen, the lipid nanoparticles of OVA-P53B mRNA connected to the E3 ubiquitin ligase recruiting ligand P53B in this embodiment can better activate CD8 + T cells and CD4 + T cells.

[0193] It shows that the mRNA lipid nanoparticles added with the E3 ubiquitin ligase recruiting ligand P53B in this example can mediate T cell activation in mice, and the effect is significantly better than the mRNA lipid nanoparticles without the E3 ubiquitin ligase ligand antigen element.

[0194] Example 5 In vivo anti-E.G7-OVA tumor effect of mRNA lipid nanoparticles containing E3 ubiquitin ligase ligand antigen element

[0195] The lipid nanoparticles loaded with OVA mRNA, OVA-H2Db mRNA, OVA-P53B mRNA, OVA-PMI mRNA, OVA-VHLL mRNA and OVA-keap1B mRNA prepared in Example 3 were administered to mice, and the mRNA content in the lipid nanoparticle sample was 0.1 mg / mL; specifically:

[0196] 1. Investigate the effect of the mRNA lipid nanoparticles of the present invention on tumor volume: 5-6 week old male C57BL / 6 mice were selected and randomly divided into groups, 6 mice in each group, to investigate the anti-tumor effect of OVA mRNA lipid nanoparticles containing E3 ubiquitin ligase ligand antigen elements after immunization of E.G7-OVA tumor mice.

[0197] Specific methods:

[0198] After C57BL / 6 mice were adaptively fed for 1 week, the density of EG7-OVA tumor cell suspension was adjusted to 7×10 6 cells / mL, 100 μL was injected subcutaneously into the upper right armpit of C57BL / 6 mice. Figure 6 -Schematic diagram of the immunization scheme) Mice were intravenously immunized with mRNA-LNP at a dose of 10 μg mRNA per mouse (the control group was given the same volume of normal saline).

[0199] On the first day of administration, the tumor diameter of the tumor-bearing mice was measured with an electronic vernier caliper, and then recorded every other day. The tumor volume was calculated according to the experimental design, and the growth volume-time curve of the tumor in the tumor-bearing mice was drawn as shown in the figure. Figure 7 ( Figure 5 E. Tumor growth curve of G7-OVA tumor-bearing mice).

[0200] The above experimental results show that compared with the control group and the positive control OVA-H2Db group, the OVA mRNA vaccine containing the E3 ubiquitin ligase ligand antigen element of the present invention significantly improves the inhibitory effect on tumor growth. Among them, OVA-P53B has the best tumor inhibition effect.

[0201] 2. Investigating the inhibition rate of mRNA lipid nanoparticles of the present invention on mouse tumors: After the immunization experiment, all mice were killed and dissected, and tumor tissues were collected, photographed, weighed, and the tumor inhibition rate was calculated. The results are as follows: Figure 8 ( Figure 8 Representative photos of tumors in each treatment group are shown.

[0202] The above experimental results show that the tumor inhibition rate of OVA-H2Db is 38.8%, which has a certain degree of tumor inhibition effect. The tumor inhibition rates of OVA-PMI, OVA-Keap1B and OVA-VHLL increased to 51.1%, 66.8% and 70.5%, respectively, showing good tumor inhibition effects. The tumor inhibition rate of OVA-P53B reached 84.8%, which has a better anti-tumor effect.

[0203] 3. Investigate the effect of the mRNA lipid nanoparticles of the present invention on the body weight of mice to preliminarily evaluate the safety of administration: On the day of the first administration, the body weight of the tumor-bearing mice was weighed using an electronic balance, and then recorded every other day, and the body weight-time curve of the tumor-bearing mice was plotted to evaluate the toxicity. The body weight-time curve of the tumor-bearing mice was plotted as follows: Fig. 9 (E. Body weight-time curve of G7-OVA tumor-bearing mice).

[0204] The experimental results showed that during the entire treatment process, each group showed a trend of weight gain, and no obvious weight loss occurred, indicating that each preparation had no obvious toxic side effects and had good safety for in vivo administration.

[0205] 4. Investigate the antigen presentation and specific CTL production effects of the mRNA lipid nanoparticles of the present invention in mice. Specific operation: After the above-mentioned immune experiment is completed, all mice are killed and dissected, and lymph nodes, spleens and tumor tissues are collected, processed, and filtered to obtain a single cell suspension. After centrifugation, an appropriate amount of red blood cell lysis solution is added to lyse at room temperature, centrifuged twice, and the supernatant is discarded. Protein antibodies (including anti-CD45, anti-CD11c, anti-CD3ε, anti-CD4, anti-CD8, anti-H-2Kb bound to SIINFEKL, H2Kb OVAtetramer) of each immune cell such as DC, macrophage, and effector T cell are added respectively, stained at room temperature, centrifuged, and the supernatant is discarded. Add resuspended cells and perform flow cytometry detection.

[0206] The results are as follows Fig.10 and Fig.11 As shown: Fig.10 This is a graph showing the results of antigen presentation testing mediated by mRNA lipid nanoparticles in mice; Fig.11 The figure shows the results of specific CTL detection mediated by mRNA lipid nanoparticles in mice; Fig.11A is a graph showing the results of specific CTL detection mediated by mRNA lipid nanoparticles in the lymph nodes of mice; Fig.11 B is the result of specific CTL detection mediated by mRNA lipid nanoparticles in the spleen of mice; Fig.11 C is a graph showing the results of specific CTL detection mediated by mRNA lipid nanoparticles in tumor tissues of mice.

[0207] from Fig.10 and Fig.11 It can be seen that compared with OVA-mRNA without the addition of E3 ubiquitin ligase ligand antigen element, the mRNA lipid nanoparticles added with E3 ubiquitin ligase ligand antigen element OVA-P53B mRNA, OVA-PMI mRNA, OVA-VHLL mRNA and OVA-keap1B mRNA in this example can mediate stronger antigen presentation and produce more specific CTLs in mice, among which OVA-P53B has the best effect.

[0208] Example 6 P53 on the in vivo anti-EBV tumor effect of EBV LMP2A@mRNA lipid nanoparticles

[0209] The amino acid sequence of EBV virus LMP2A antigen is as follows (Seq ID No.21):

[0210] MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVC LPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQGIYVLVMLVLLILAYRRRWRRLTVCGGIM FLACVLVLIVDAVLQLSPLLGAVTVVSMTLLLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGG SILQTNFKSLSSTEFIPNLFCMLLLIVAGILFILAILTEWGSGNRTYGPVFMCLGLLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV.

[0211] The mRNA containing the above LMPA2 antigen sequence was prepared by the methods of Examples 1 and 2, and the lipid nanoparticles containing LMP2A-mRNA, LMP2A-P53B mRNA and LUC mRNA with a mass ratio of cationic lipid to mRNA of 15:1 were prepared by the method of Example 3, wherein the content of mRNA was 0.1 mg / mL. The in vivo anti-tumor effect of LMP2A-P53B mRNA lipid nanoparticles containing the E3 ubiquitin ligase ligand antigen element P53B was investigated according to the method disclosed in Example 5.

[0212] The anti-tumor effect of LMP2A-P53B mRNA lipid nanoparticles containing E3 ubiquitin ligase ligand antigen elements on the production of specific T cells in vivo was investigated by the ELISpot method.

[0213] The specific method is:

[0214] After the immunization experiment, all mice were killed and dissected, and the spleens were collected, processed, and filtered to obtain a single-cell suspension. After centrifugation, red blood cell lysis buffer was added for lysis at room temperature. After a second centrifugation, the supernatant was discarded to obtain a spleen lymphocyte suspension for detection.

[0215] The results are as follows Fig.12 As shown: mRNA lipid nanoparticles containing LMP2A antigen can mediate the production of specific CTLs in mice, among which LMP2A-P53B-mRNA lipid nanoparticles with added E3 ubiquitin ligase ligand antigen element sequence have a more significant effect.

[0216] The results showed that, compared with the control group, the model mRNA group (LUC mRNA) and the group containing only LMP2A antigen (LMP2A mRNA), the LMP2A-P53B mRNA lipid nanoparticles containing the E3 ubiquitin ligase ligand antigen element P53B in this example can induce the production of more CTLs, have a stronger inhibitory effect on tumor growth, and have a higher tumor inhibition rate.

[0217] Example 7 Safety Evaluation of mRNA Lipid Nanoparticles Containing E3 Ubiquitin Ligase Ligand Antigen Element

[0218] This example investigates the safety of the mRNA lipid nanoparticles prepared in Example 3 in mice.

[0219] The specific operations are as follows:

[0220] After C57BL / 6 mice were adaptively raised for 1 week, the experimental design ( Figure 6- Schematic diagram of immunization scheme) Mice were intravenously immunized with a dose of 10 μg mRNA per mouse. Seven days after the end of the administration, blood samples were collected from the mice and mouse plasma was prepared. ALT, AST, TP, CRE, LDH, and UREA in the mouse serum were detected using a blood biochemical analyzer.

[0221] The results are as follows Fig.13 As shown: Compared with the Control, the ALT, AST, TP, CRE, LDH, and UREA data in the mouse serum after immunization with each mRNA lipid nanoparticle did not change significantly;

[0222] It was shown that after administration of each mRNA lipid nanoparticle, there was no significant change in the liver and kidney function-related indicators of mice. The mRNA lipid nanoparticles added with the E3 ubiquitin ligase ligand antigen element in this example all had good safety.

[0223] It should be noted that the specific features, structures, materials or characteristics described in this specification may be combined in any one or more embodiments in a suitable manner. In addition, those skilled in the art may combine and combine the different embodiments and features of the different embodiments described in this specification without contradicting each other.

Claims

1. A nucleic acid molecule comprising at least one open reading frame, characterized in that The open reading frame comprises at least one antigenic element and at least one E3 ligand element; wherein the E3 ligand element is a binding or recruiting ligand of an E3 ubiquitin enzyme ligase; and the E3 ligand binds to one or more E3 ubiquitin enzyme ligases; The antigen element includes at least one antigen epitope; the antigen epitope is a T cell antigen determinant cluster or a T cell antigen epitope; the antigen epitope is derived from an antigen epitope peptide of a tumor, an antigen epitope peptide of an autoimmune disease, or an antigen epitope peptide of a pathogenic microorganism; the tumor antigen or antigen epitope peptide is selected from an antigen caused by a gene mutation, and / or a tissue-specific differentiation antigen, and / or an overexpressed antigen, and / or a cancer-testis antigen, and / or a universal antigen, and / or an antigen derived from a carcinogenic virus; The E3 ubiquitin enzyme ligase is selected from VHL (Von Hippel-Lindau), MDM2, CRBN, IAPs, RNF, β-TrCP, DCAF, and Keap1; the amino acid sequence corresponding to the binding or recruitment ligand of Keap1 is LDPETGEYL; the amino acid sequence corresponding to the binding or recruitment ligand of β-TrCP is DRHDSGLDSM; the amino acid sequence corresponding to the binding or recruitment ligand of VHL is at least one of LAP(OH)YI or ALAPYIP; the amino acid sequence corresponding to the binding or recruitment ligand of MDM2 is at least one of ETFSDLWKLL, TSFAEYWNLLSP, LTFEHYWAQLTS, TNWYANLEKLLR, TAWYANFEKLLR, DWWPLAFEALLR, CNCKAPETALCARRCQQH or CNCKAPETFLCYWRCLQH.

2. The nucleic acid molecule according to claim 1, characterized in that The antigen element and the E3 ligand element are connected in any form of E3 ligand element-antigen element, antigen element-E3 ligand element, E3 ligand element-antigen element-E3 ligand element or antigen element-E3 ligand element-antigen element; wherein the antigen element and the E3 ligand element are connected via a linker.

3. The nucleic acid molecule according to claim 2, characterized in that The amino acid sequence of the linker is at least one of GGGGS, (GGGGS)3, (GGGGS)6, (GGS)10 or (GSG)10.

4. The nucleic acid molecule according to claim 1, characterized in that The antigen caused by the gene mutation is selected from one or more of p53, ras, β-catenin, CDK4, CDC27, and αactinin-4; The tissue-specific differentiation antigen is selected from one or more of Tyrosinase, TRP1 / gp75, TRP2, gp100, Melan-A / MART1, gangliosides, and PSMA; The overexpressed antigen is selected from one or more of HER2, WT1, EphA3, EGFR, and CD20; The cancer-testis antigen is selected from one or more of MAGE, BAGE, GAGE, and NY-ESO-1; The universal antigen is selected from one or more of Telomerase and Survivin; The oncogenic virus-derived antigen is selected from one or more of EBV, HPV, HBV, HCV, human herpes virus, and Merkel cell polyomavirus.

5. The nucleic acid molecule according to claim 1, characterized in that The nucleic acid molecule comprises a signal peptide coding region.

6. The nucleic acid molecule according to claim 1, characterized in that The nucleic acid molecule comprises a promoter, a 5' untranslated region, a 3' untranslated region and polyA.

7. The nucleic acid molecule according to any one of claims 1 to 4, characterized in that The nucleic acid is selected from at least one of DNA, ASO, siRNA, miRNA, mRNA, and aptamer.

8. A nucleic acid vaccine, characterized in that: Include: The nucleic acid molecule according to any one of claims 1 to 4, and optionally a pharmaceutically acceptable excipient or auxiliary component; wherein the nucleic acid vaccine is an mRNA vaccine; the auxiliary component is a nanocarrier that carries the mRNA; and / or The auxiliary material comprises at least one selected from injection buffer medium, lyophilized or cryoprotectant.

9. The nucleic acid vaccine according to claim 8, characterized in that: The nanocarrier comprises at least one selected from liposomes, nanoparticles, microspheres and lipid nanocarriers.

10. The nucleic acid vaccine according to claim 9, characterized in that: The nanocarrier is prepared by using at least one of the following lipid materials: DOTAP, DOTMA, DOTIM, DDA, DC-Chol, CCS, diC14-amidine, DOTPA, DOSPA, DTAB, TTAB, CTAB, DORI, DORIE and its derivatives, DPRIE, DSRIE, DMRIE, DOGS, DOSC, LPLL, DODMA, DDAB, Dlin-MC3-DMA, CKK-E12, C12-200, DSPC, DMG-PEG, DOPE, phosphatidylethanolamine, phosphatidylcholine and cholesterol.

11. The nucleic acid vaccine according to claim 8, characterized in that: The mRNA vaccine is formed by self-assembly of the mRNA and lipid material using a microfluidic device; or The mRNA vaccine is formed by incubating the nanocarrier with mRNA.

12. A protein, characterized in that The protein is encoded by the nucleic acid molecule according to any one of claims 1 to 4.

13. A protein or polypeptide vaccine, characterized in that: Comprising: the protein of claim 12 as an antigen component; and Contains an immune adjuvant.

14. The protein or polypeptide vaccine according to claim 13, characterized in that: The immune adjuvant includes one or more selected from Freund's incomplete adjuvant, complete Freund's adjuvant, aluminum hydroxide adjuvant, aluminum phosphate adjuvant, emulsified adjuvant, liposome adjuvant and microbial adjuvant.

15. A carrier, characterized in that Carrying the nucleic acid molecule according to any one of claims 1 to 4; wherein the vector is a eukaryotic vector or a prokaryotic vector.

16. The carrier according to claim 15, characterized in that: The vector comprises one or more selected from plasmid vectors, adenovirus vectors, lentivirus vectors and adeno-associated virus vectors.

17. A vector vaccine, characterized in that The invention comprises an active ingredient; the active ingredient is obtained by loading the nucleic acid molecule according to any one of claims 1 to 6 into the vector according to any one of claims 15 to 16.

18. A pharmaceutical composition, characterized in that include: The nucleic acid molecule according to any one of claims 1 to 4, the nucleic acid vaccine according to any one of claims 8 to 11, the protein according to claim 12, the protein or polypeptide vaccine according to any one of claims 13 to 14, or the vector vaccine according to claim 17; further comprising a pharmaceutically acceptable excipient.

19. Use of the nucleic acid molecule according to any one of claims 1 to 4, the nucleic acid vaccine according to any one of claims 8 to 11, the protein according to claim 12, the protein or polypeptide vaccine according to any one of claims 13 to 14 or the vector vaccine according to claim 17, or the pharmaceutical composition according to claim 18 in the preparation of drugs for preventing or treating EBV-related tumor diseases.

Images