Application of VdGH7-4 protein and its short peptides in improving plant resistance and / or inducing plant defense response

Abstract

The present invention provides the use of VdGH7-4 protein and its short peptide in improving plant resistance and / or inducing plant defense response, a method for improving plant resistance and / or inducing plant defense response, and the use of VdGH7-4 protein and its short peptide in preparing pesticides. Through the above scheme, plant ROS burst, callose deposition, resistance-related gene expression and other immune responses can be efficiently induced, while significantly enhancing plant resistance, providing a new idea for improving plant resistance.

Description

Technical Field

[0001] The present disclosure belongs to the field of microbial technology, and specifically, relates to the application of VdGH7-4 protein and its short peptides in improving plant resistance and / or inducing plant defense response. Background Art

[0002] Plant immune activator proteins are a type of heat-stable protein elicitors secreted by fungi or extracted from fungi that can activate plant immune responses and improve plant resistance. In 1992, researchers first revealed that Hparin, a hypersensitive response protein produced after plants were infected with fire blight, could enhance plant resistance. Based on this research, EDEN Biosciences developed and promoted Mesesnger, a product with plant immune activation function, in 2001. In recent years, a new immune activator, VDAL, has been developed based on the activation protein of Verticillium dahliae. It is widely used in many economic crops because of its significant effects in disease resistance, stress resistance, growth promotion, yield increase and quality improvement.

[0003] When pathogenic fungi infect host plants, they secrete a series of enzymes that degrade plant cell walls (CWDEs), which help them break through the plant cell wall defense barrier and invade the host to obtain nutrients. At the same time, in this process, CWDEs may also be recognized as elicitors by the host, causing a series of immune responses, such as stomatal closure, callose deposition, reactive oxygen species (ROS) bursts, and intracytoplasmic Ca 2+ Changes in concentration, cell ion leakage, expression of genes related to the course of disease, synthesis of phytoalexins, etc. Therefore, starting from pathogenic fungal CWDEs can provide new targets for the development of new plant immune activators. Summary of the invention

[0004] In order to efficiently induce immune responses such as ROS burst, callose deposition, and resistance-related gene expression in plants, the present disclosure provides the use of VdGH7-4 protein and its short peptides in improving plant resistance and / or inducing plant defense response, a method for improving plant resistance and / or inducing plant defense response, and the use of VdGH7-4 protein and its short peptides in the preparation of pesticides.

[0005] In order to achieve the above-mentioned object, the first aspect of the present disclosure provides the use of VdGH7-4 protein and its short peptides in improving plant resistance and / or inducing plant defense response, characterized in that the short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3;

[0006] The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO.1-4.

[0007] Optionally, the improving the resistance of the plant comprises: improving the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae;

[0008] The inducing the plant's defense response includes: inducing the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant.

[0009] Optionally, the VdGH7-4 protein and its short peptides are used at a concentration of 1-10 μM, preferably 2-5 μM.

[0010] Optionally, the plant comprises at least one of tobacco and rice.

[0011] In another aspect, the present disclosure provides a method for improving plant resistance and / or inducing plant defense response, the method comprising the following steps:

[0012] Applying the VdGH7-4 protein and its short peptide to target plants, and / or introducing genes encoding the VdGH7-4 protein and its short peptide into target plants;

[0013] The short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2, and VdGH7-4-3;

[0014] The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO. 1-4;

[0015] The nucleotide sequences of the genes encoding VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NOs. 5-8.

[0016] Optionally, the gene encoding the VdGH7-4 protein and its short peptide is introduced into the target plant via a plant expression vector.

[0017] Optionally, the plant expression vector comprises pGR107.

[0018] Optionally, the improving the resistance of the plant comprises: improving the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae;

[0019] The inducing the plant's defense response includes: inducing the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant.

[0020] On the other hand, the present disclosure provides the use of VdGH7-4 protein and its short peptides in the preparation of pesticides, wherein the pesticides are used to improve plant resistance and / or induce plant defense response, and the short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3;

[0021] The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO.1-4.

[0022] Optionally, the plant comprises at least one of tobacco and rice.

[0023] Through the above technical scheme, the present disclosure provides VdGH7-4 protein and its short peptides for activating and inducing plant immune responses, which can efficiently induce plant ROS burst, callose deposition, resistance-related gene expression and other immune responses, while significantly enhancing plant resistance, providing a new idea for improving plant resistance.

[0024] Other features and advantages of the present disclosure will be described in detail in the following detailed description. BRIEF DESCRIPTION OF THE DRAWINGS

[0025] Figure 1 This is a schematic diagram of the truncation sites of the glycoside hydrolase VdGH7-4 protein and the lengths of the three peptide segments.

[0026] Figure 2 This is a comparison chart of the active oxygen intensity induced in tobacco leaves by VdGH7-4 and its short peptide and the control group.

[0027] Figure 3 This is a comparison chart of the active oxygen intensity induced in tobacco leaves by VdGH7-4 and its short peptide and the deionized water negative control.

[0028] Figure 4 It is the lesion area of ​​Botrytis cinerea on tobacco leaves treated with VdGH7-4 and its short peptides and the control group.

[0029] Figure 5 This is a test of the resistance of VdGH7-4 and its short peptides to the tobacco cinerea pathogen compared with the control group.

[0030] Figure 6 It is the incidence degree of rice blast on rice leaves treated with VdGH7-4 and its short peptides and the control group.

[0031] Figure 7 It is the length of rice blast spots on rice leaves treated with VdGH7-4 and its short peptides and the control group.

[0032] Figure 8It is the result of determination of expression of tobacco resistance gene induced by glycoside hydrolase VdGH7-4 and short peptide.

[0033] Fig. 9 It is the determination of the expression results of resistance genes in rice leaves induced by glycoside hydrolase VdGH7-4 and its short peptide. DETAILED DESCRIPTION

[0034] The specific implementation of the present disclosure is described in detail below in conjunction with the accompanying drawings. It should be understood that the specific implementation described herein is only used to illustrate and explain the present disclosure, and is not used to limit the present disclosure.

[0035] In a first aspect, the present disclosure provides the use of VdGH7-4 protein and its short peptides in improving plant resistance and / or inducing plant defense response, wherein the short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3;

[0036] The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO.1-4.

[0037] Optionally, the improving the resistance of the plant comprises: improving the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae;

[0038] The inducing the plant's defense response includes: inducing the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant.

[0039] Optionally, the VdGH7-4 protein and its short peptide are used at a concentration of 1-10 μM, preferably 2-5 μM, which is the total concentration of the VdGH7-4 protein and its short peptide.

[0040] Optionally, the plant comprises at least one of tobacco and rice.

[0041] In another aspect, the present disclosure provides a method for improving plant resistance and / or inducing plant defense response, the method comprising the following steps:

[0042] Applying the VdGH7-4 protein and its short peptide to target plants, and / or introducing genes encoding the VdGH7-4 protein and its short peptide into target plants;

[0043] The short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2, and VdGH7-4-3;

[0044] The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO. 1-4;

[0045] The nucleotide sequences of the genes encoding VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NOs. 5-8.

[0046] Optionally, the gene encoding the VdGH7-4 protein and its short peptide is introduced into the target plant via a plant expression vector.

[0047] Optionally, the plant expression vector comprises pGR107.

[0048] Optionally, the improving the resistance of the plant comprises: improving the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae;

[0049] The inducing the plant's defense response includes: inducing the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant.

[0050] On the other hand, the present disclosure provides the use of VdGH7-4 protein and its short peptides in the preparation of pesticides, wherein the pesticides are used to improve plant resistance and / or induce plant defense response, and the short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3;

[0051] The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO.1-4.

[0052] Optionally, the plant comprises at least one of tobacco and rice.

[0053] The present disclosure is further illustrated below by way of examples, but the present disclosure is not limited thereby.

[0054] The VdGH7-4 protein and its short peptides involved in the embodiments of the present disclosure, the amino acid sequence of the VdGH7-4 protein is shown in SEQ ID NO.4, the amino acid sequence of the first short peptide VdGH7-4-1 is shown in SEQ ID NO.1 (positions 1-141 in SEQ ID NO.4), the amino acid sequence of the second short peptide VdGH7-4-2 is shown in SEQ ID NO.2 (positions 142-272 in SEQ ID NO.4), and the amino acid sequence of the third short peptide VdGH7-4-3 is shown in SEQ ID NO.3 (positions 273-431 in SEQ ID NO.4).

[0055] The preparation method of VdGH7-4 protein includes: constructing a recombinant expression vector, using Escherichia coli for prokaryotic expression, adding a 6×His tag to the expression vector, and purifying using a nickel affinity chromatography material Ni-IDA Resin pre-packed column to obtain the target protein.

[0056] SEQ ID NO.1 (VdGH7-4-1):

[0057] MQQIGTLVPEVPPALTWSNCTAESCTPVTDALTLDANWRWTHETTSAHTCFLDGDWTDVCWNLNSGTACAERCAVEGADYASTHGITTAGGSASLRYVTHSAFGRNVENRVFLLAPDGRYRMFELLGREVRVDVEVGTLGC;

[0058] SEQ ID NO.2 (VdGH7-4-2):

[0059] GLKGALYFVKMEADGGRGRGKNAAGARYGTGYCDAECSQSIKFVDGRANLEGWAPGYTELELGRGAVGACCAEMGVWQSNSASYVVSAHPCINPDFHTCQDSRCPRGFSDDIFPHGCDTDGCGASPYRLG;

[0060] SEQ ID NO.3 (VdGH7-4-3):

[0061] NTQFYGQGKTLDSGAKFTVITRFHEDHVSQSFIQAGEPIETPPSQASGVQGNAISDDFCDSQASAFGERNRYAEVGGWSSTKRALAGQWVMVMSITHDAYANMLWLDSLYPVDAAGRPGALRGPCPANRGYPAQTLVENPQAKVTFSDIRYGPIGTTG;

[0062] SEQ ID NO.4 (VdGH7-4):

[0063] MQQIGTLVPEVPPALTWSNCTAESCTPVTDALTLDANWRWTHETTSAHTCFLDGDWTDVCWNLNSGTACAERCAVEGADYASTHGITTAGGSASLRYVTHSAFGRNVENRVFLLAPDGRYRMFELLGREVRVDVEVGTLGCGLKGALYFVKMEADGGRGRGKNAAGARYGTGYCDAECSQSIKFVDGRANLEGWAPGYTELELGRGAVGACCAEMGVWQSNSASYVVSAHPCINPDFHTCQDSRCPRGFSDDIFPHGCDTDGCGASPYRLGNTQFYGQGKTLDSGAKFTVITRFHEDHVSQSFIQAGEPIETPPSQASGVQGNAISDDFCDSQASAFGERNRYAEVGGWSSTKRALAGQWVMVMSITHDAYANMLWLDSLYPVDAAGRPGALRGPCPANRGYPAQTLVENPQAKVTFSDIRYGPIGTTG;

[0064] SEQ ID NO.5 (encoding VdGH7-4-1):

[0065] ATGCAACAAATCGGCACTCTTGTCCCTGAAGTCCCCCCCGCTCTCACCTGGTCCAACTGCACCGCCGAATCGTGCACGCCCGTCACCGACGCGCTGACCCTCGACGCCAACTGGCGCTGGACACACGAGACAACCTCGGCGCACACGTGCTTCCTCGACGGCGACTGGACAGACGTCTGCTGGAACCTCAATAGCGGAACGGCGTGCGCCGAGCGCTGCGCTGTCGAAGGCGCCGACTACGCGTCGACGCACGGCATCACGACCGCCGGCGGTAGC;

[0066] SEQ ID NO.6 (encoding VdGH7-4-2):

[0067] GGGCTCAAGGGGGCGCTGTACTTTGTCAAGATGGAGGCGGACGGCGGGCGCGGGCGCGGCAAGAACGCCGCTGGTGCGCGGTACGGCACCGGATACTGCGACGCCGAGTGCAGCCAGAGCATCAAGTTTGTTGATGGCCGGGCTAACCTAGAGGGGTGGGCGCCGGGGTACACGGAGCTCGAGCTCGGACGCGGCGCCGTTGGGGCCTGCTGTGCCGAGATGGGCGTTTGGCAGAGCAATTCGGCGTCGTATGTCGTCTCGGCGCATCCTTGCATTAACCCCGACTTTCACACGTGCCAGGATAGCCGGTGCCCACGCGGGTTCTCGGACGACATTTTCCCCCATGGCTGCGATACCGACGGCTGCGGCGCGAGCCCGTACCGGCTGGGC;

[0068] SEQ ID NO.7 (encoding VdGH7-4-3):

[0069] AATACACAGTTTTATGGGCAGGGCAAGACGCTCGACAGCGGGGCCAAGTTTACTGTCATTACGCGGTTCCACGAGGACCACGTCTCGCAATCCTTCATCCAGGCCGGCGAGCCCATCGAAACGCCGCCCAGCCAGGCGTCCGGCGTGCAGGGCAACGCCATCTCGGACGACTTTTGCGACAGCCAGGCGTCGGCGTTTGGGGAGCGTAACCGATACGCCGAGGTCGGCGGGTGGTCGTCGACGAAACGGGCGCTCGCGGGCCAGTGGGTCATGGTCATGTCCATCACGCACGACGCCTACGCCAACATGCTCTGGCTCGACTCGCTGTACCCGGTCGACGCCGCCGGTCGGCCCGGTGCGCTGAGGGGGCCGTGTCCGGCGAACAGGGGATATCCGGCGCAGACGTTGGTGGAGAACCCGCAGGCCAAGGTGACGTTTTCGGACATCCGGTACGGGCCGATCGGGACGACGGGG;

[0070] SEQ ID NO.8 (encoding VdGH7-4):

[0071]

[0072] Example 1

[0073] This example is used to prove that glycoside hydrolase VdGH7-4 and its short peptide can induce ROS outbreak in tobacco and rice leaves. The specific process is as follows:

[0074] Glycoside hydrolase VdGH7-4 was truncated in sequence according to the length of amino acid sequence to produce short peptides VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3. The full-length protein and short peptides were used to treat tobacco leaf discs at a concentration of 100 ng / mL, and the ROS burst caused by them was determined using a reactive oxygen species (ROS) content detection kit within 80 minutes. At the same time, 4-week-old rice leaves were selected, and 100 ng / mL of glycoside hydrolase VdGH7-4 and its short peptide protein were sprayed on the leaves with a small sprayer to ensure uniform spraying, so that the solution fell freely on the rice leaves, and deionized water was used as a negative control for 2 hours; then the leaves were rinsed with deionized water, placed in 1×DAB dye solution, and incubated in a shaker at 25℃ in the dark for 16 hours; the leaves were rinsed with deionized water to remove the residual dye solution, and the leaves were completely decolorized with 95% ethanol and observed under a stereo microscope.

[0075] The results showed that the truncation sites of glycoside hydrolase VdGH7-4 protein and the lengths of the three peptide segments were Figure 1 As shown, the amino acid sequence of the glycoside hydrolase VdGH7-4 protein is shown in SEQ ID NO.4; the amino acid sequence of the first peptide segment VdGH7-4-1 is shown in SEQ ID NO.1 (positions 1-141 in SEQ ID NO.4), the amino acid sequence of the second peptide segment VdGH7-4-2 is shown in SEQ ID NO.2 (positions 142-272 in SEQ ID NO.4), and the amino acid sequence of the third peptide segment VdGH7-4-3 is shown in SEQ ID NO.3 (positions 273-431 in SEQ ID NO.4); using GFP as a negative control and Flg22 as a positive control, VdGH7-4 and its short peptides can induce the production of reactive oxygen species in tobacco leaves within 60 minutes, and the induction intensity is higher than that of the positive control Flg22. Figure 2 As shown; compared with the deionized water control, the rice leaves sprayed with VdGH7-4 and its short peptides were obviously stained with DAB dye, indicating that a large amount of reactive oxygen accumulated, such as Figure 3 shown.

[0076] The above results indicate that glycoside hydrolase VdGH7-4 and its short peptide can strongly induce ROS bursts in tobacco and rice leaves.

[0077] Example 2

[0078] This example is used to prove that VdGH7-4 and its truncated peptide segments VdGH7-4-1 / 2 / 3 can induce tobacco resistance to Botrytis cinerea. The specific process is as follows:

[0079] About 20 µL of 100 ng / mL glycoside hydrolase VdGH7-4 and VdGH7-4-1 / 2 / 3 proteins were injected into 4-week-old tobacco leaves from the back of the leaves using a 1 mL syringe without a needle. 20 µL of 100 ng / mL GFP was used as a negative control. 18 h after injection, a needle was used to puncture the injection area and 5 μL of 5×10 6 spores / mL of Botrytis cinerea suspension was dropped just above the needle eye and cultured at 25℃ 80% humidity. Three days after inoculation, the diameter of the lesions of each treatment was observed and measured, and its relative change with respect to the control group was calculated.

[0080] The results are as follows Figure 4-5 As shown in the figure, the lesion area of ​​Botrytis cinerea on the leaves of the experimental groups (VdGH7-4, VdGH7-4-1 / 2 / 3) was 170 mm 2 , 140 mm 2 , 120 mm 2 , 210mm 2 ) was significantly smaller than the lesion area on the leaves of the control group (injected with GFP) (≈780 mm 2 ).

[0081] The above results indicate that VdGH7-4 and VdGH7-4-1 / 2 / 3 peptide proteins can significantly induce tobacco resistance to Botrytis cinerea.

[0082] Example 3

[0083] This example is used to prove that glycoside hydrolases VdGH7-4 and VdGH7-4-1 / 2 / 3 can induce resistance of rice to rice blast fungus. The specific process is as follows:

[0084] The rice blast fungus was inoculated in oat culture medium and cultured at 26°C for 7 days to produce a large number of spores. The spores on the surface of the rice blast fungus were scraped with 0.01% Tween 20 and the spore concentration was adjusted to 1×10 using a hemocytometer. 5 / mL for standby; 4-week-old rice young leaves were selected, the second leaf was taken, and it was scratched with a gun tip at 10 cm from the leaf tip. 10 μL of VdGH7-4 and its short peptides with a concentration of 100 ng / mL were applied to the wound, deionized water was used as a negative control, and the wound was fixed with transparent tape to form a small chamber. After 2 h of treatment, the surface protein of the leaves was removed, 10 μL of rice blast fungus spores were applied, 0.01% Tween 20 was used as a negative control, and the wound was fixed with transparent tape to form a small chamber; after inoculation, the leaves were quickly moisturized, cultured in the dark at 28℃ for 24 h, and then the photoperiod of 16 h light / 8 h dark was restored; 7 days after the rice blast fungus was inoculated, photos were taken and the length of the lesions was measured.

[0085] Results: Compared with the control, the incidence of rice blast was significantly reduced after the rice leaves were treated with VdGH7-4 and its short peptides. Figure 6 , 7 As shown, statistics show that the lesion area was significantly reduced.

[0086] The above results indicate that VdGH7-4 and its short peptides can significantly induce rice resistance to rice blast fungus.

[0087] Example 4

[0088] This example is used to prove that transient transformation of VdGH7-4 and its short peptides causes the expression of resistance-related genes in tobacco leaves. The specific process is as follows:

[0089] Select 4-week-old tobacco, adjust the concentration of VdGH7-4 and VdGH7-4-1 / 2 / 3 to OD600 0.5-0.8, and inject 200 µL of Agrobacterium solution from the back of the leaf with a 1 mL syringe (without the needle). Agrobacterium with the same concentration and transient expression of empty vector pGR107-GFP was used as a negative control. 48 hours after injection, the leaves in the injection area were collected, total RNA was extracted, and the transcription level of resistance-related genes was detected by quantitative PCR.

[0090] Results: Compared with the control, the transcription levels of disease resistance-related genes in tobacco leaves injected with pGR107-VdGH7-4 and VdGH7-4-1 / 2 / 3 were significantly increased. Figure 8 shown.

[0091] The above results indicate that glycoside hydrolase VdGH7-4 and short peptide VdGH7-4-1 / 2 / 3 can significantly induce the expression of tobacco resistance genes.

[0092] Example 5

[0093] This example is used to prove that spraying glycoside hydrolase VdGH7-4 and its short peptide can cause the expression of resistance-related genes in rice leaves. The specific process is as follows:

[0094] Four-week-old rice was selected and 100 ng / mL of VdGH7-4 and VdGH7-4-1 / 2 / 3 were sprayed on the leaves using a small sprayer. The spraying was uniform and the solution fell freely on the rice leaves. Deionized water was used as a negative control. After 2 h of action, rice leaves of the same length were collected, total RNA was extracted, and the transcription levels of rice resistance-related genes were detected by quantitative PCR.

[0095] Results: Compared with the control, the transcription levels of disease resistance-related genes in the sprayed areas of rice leaves of VdGH7-4 and VdGH7-4-1 / 2 / 3 were significantly increased, such as Fig. 9 shown.

[0096] The above results indicate that glycoside hydrolase VdGH7-4 and its short peptides VdGH7-4-1 / 2 / 3 can significantly induce the expression of resistance genes in rice leaves.

[0097] The preferred embodiments of the present disclosure are described in detail above; however, the present disclosure is not limited to the specific details in the above embodiments. Within the technical concept of the present disclosure, a variety of simple modifications can be made to the technical solution of the present disclosure, and these simple modifications all fall within the protection scope of the present disclosure.

[0098] It should also be noted that the various specific technical features described in the above specific embodiments can be combined in any suitable manner without contradiction. In order to avoid unnecessary repetition, the present disclosure will not further describe various possible combinations.

[0099] In addition, various embodiments of the present disclosure may be arbitrarily combined, and as long as they do not violate the concept of the present disclosure, they should also be regarded as the contents disclosed by the present disclosure.

Claims

1. Use of VdGH7-4 protein and its short peptide in improving plant resistance and / or inducing plant defense response, characterized in that: The short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3; The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO. 1-4; The improving of plant resistance is to improve the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae; The inducing plant defense response is to induce the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant; The plant is at least one selected from tobacco and rice.

2. The use according to claim 1, wherein: The VdGH7-4 protein and its short peptide are used at a concentration of 1-10 μM.

3. The use according to claim 2, wherein: The VdGH7-4 protein and its short peptide are used at a concentration of 2-5 μM.

4. A method for improving plant resistance and / or inducing plant defense response, characterized in that: The method comprises the following steps: Applying the VdGH7-4 protein and its short peptide to the target plant, and / or introducing the gene encoding the VdGH7-4 protein and its short peptide into the target plant; The short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2, and VdGH7-4-3; The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO. 1-4; The nucleotide sequences of the genes encoding VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NOs. 5-8; The improving of plant resistance is to improve the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae; The inducing plant defense response is to induce the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant; The plant is at least one selected from tobacco and rice.

5. The method according to claim 4, wherein: The gene encoding the VdGH7-4 protein and its short peptide is introduced into the target plant through a plant expression vector.

6. The method according to claim 5, wherein: The plant expression vector includes pGR107.

7. Application of VdGH7-4 protein and its short peptide in the preparation of pesticides, characterized in that: The pesticide is used to improve plant resistance and / or induce plant defense response, and the short peptides of the VdGH7-4 protein include VdGH7-4-1, VdGH7-4-2 and VdGH7-4-3; The amino acid sequences of the VdGH7-4-1, VdGH7-4-2, VdGH7-4-3 and VdGH7-4 proteins are shown in SEQ ID NO. 1-4; The improving of plant resistance is to improve the resistance of the plant to at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae; The inducing plant defense response is to induce the reduction of the harm of at least one pathogen selected from Staphylococcus cinerea and Magnaporthe oryzae to the plant; The plant is at least one selected from tobacco and rice.

Images