Protein DAP1 for regulating and controlling plant growth and development as well as coding gene and application of protein DAP1

Abstract

The invention discloses a protein DAP1 for regulating and controlling plant growth and development as well as a coding gene and application thereof, and belongs to the technical field of gene engineering. The amino acid sequence of the protein DAP1 is as follows: a. An amino acid sequence as shown in SEQ ID NO: 1; or b, an amino acid sequence which is obtained by substituting, deleting and / or adding one or more amino acids to the amino acid sequence as shown in SEQ ID NO: 1 and expresses a functional protein for regulating plant growth and development. The protein DAP1 and the coding gene thereof disclosed by the invention are related to regulation and control of plant growth and development, and analysis of functions of the DAP1 gene not only contributes to analysis of molecular mechanisms of rice panicle development and plant type regulation and control, but also can provide a new gene resource for ensuring high and stable yield of rice.

Description

Technical Field

[0001] The invention belongs to the technical field of genetic engineering, and in particular relates to a protein DAP1 for regulating plant growth and development, a coding gene and an application thereof. Background Art

[0002] Rice is one of the important food crops. The yield of rice is determined by the number of effective panicles, the number of grains per panicle and the grain weight. During the growth and development of rice, extreme external environmental conditions and changing genetic factors will affect the panicle development of the plant and cause panicle degeneration, thereby reducing the rice fruiting rate, further seriously affecting the rice yield. In addition, the rice plant type will directly affect the number of effective panicles, the number of grains per panicle and the grain size, thereby affecting the rice yield. The TUTOU1 gene disclosed in the prior art encodes the SCAR / WAVE protein. The tut1 mutant exhibits a smaller plant type and panicle degeneration, and the plant yield is seriously affected. OsALMT7 encodes a functional aluminum-activated malate transporter that can transport malate to the top panicle. The OsALMT7 mutation causes the top of the rice panicle to degenerate, thereby reducing the yield. Although some genes that control the development of rice panicles and plant types have been identified by predecessors, the genetic and molecular mechanisms of panicle development and plant type regulation are still superficial. Therefore, elucidating the genetic and molecular mechanisms of rice panicle development and plant type regulation is of great strategic significance for ensuring high and stable rice yields as well as national food security and sustainable agricultural development. Summary of the invention

[0003] The technical problem to be solved by the present invention is to provide a protein DAP1 for regulating plant growth and development and its encoding gene and application, so as to solve the technical problem that the plant type and panicle development of rice cannot be regulated.

[0004] In order to achieve the above object, the technical solution adopted by the present invention is: to provide a protein DAP1 for regulating plant growth and development, the amino acid sequence of the protein is:

[0005] a. the amino acid sequence as shown in SEQ ID NO: 1; or

[0006] b. The amino acid sequence as shown in SEQ ID NO: 1 is substituted, deleted and / or added with one or more amino acids, and expresses an amino acid sequence of a functional protein that regulates plant growth and development.

[0007] Furthermore, the amino acid sequence of protein DAP1 can also be: the amino acid sequence of the tag in Table 1 is connected to the N-terminus or / and C-terminus of the amino acid sequence shown in SEQ ID NO: 1, and the amino acid sequence of the functional protein that expresses the regulation of plant growth and development is expressed.

[0008] Table 1 Amino acid sequences of tags

[0009]

[0010]

[0011] The present invention also discloses a gene DAP1 encoding the protein regulating plant growth and development, the nucleotide sequence of which is:

[0012] a. a nucleotide sequence as shown in SEQ ID NO: 2; or

[0013] b. a nucleotide sequence of positions 10-1173 from the 5′ end as shown in SEQ ID NO: 2; or

[0014] c. a nucleotide sequence that hybridizes with the nucleotide sequence shown in SEQ ID NO: 2 under stringent conditions and encodes a nucleotide sequence that is a functional protein that regulates plant growth and development; or

[0015] d. The nucleotide sequence as shown in SEQ ID NO: 2 is substituted, deleted and / or added with one or more nucleotides, and / or undergoes missense mutation of one or more base pairs, and encodes a nucleotide sequence of a functional protein that regulates plant growth and development.

[0016] The above-mentioned DAP1 protein can be artificially synthesized, or its encoding gene can be synthesized first and then obtained by biological expression.

[0017] On the basis of the above technical solution, the present invention can also be improved as follows:

[0018] Furthermore, stringent conditions include hybridization at 65°C and membrane washing in a solution of 0.1×SSPE (or 0.1×SSC) and 0.1% SDS.

[0019] The invention also discloses a recombinant expression vector comprising the DAP1 gene.

[0020] The invention also discloses a recombinant microorganism comprising the recombinant vector.

[0021] The invention also discloses the application of gene DAP1, recombinant expression vector or recombinant microorganism in regulating plant growth and development.

[0022] On the basis of the above technical solution, the present invention can also be improved as follows:

[0023] Furthermore, by silencing or knocking out the DAP1 gene, regulation of plant growth and development can be achieved.

[0024] Furthermore, by silencing or knocking out the DAP1 gene, the plant height was reduced, the stems became shorter and thinner, the length and width of the sword leaf decreased, the ears became smaller, the number of stalks on the ears decreased, and severe ear degeneration occurred, as well as abnormal development of the inner and outer palea and defects in floral organ development.

[0025] Furthermore, the plant is a monocotyledonous plant.

[0026] Furthermore, the plant is rice.

[0027] The invention also discloses a preparation for regulating plant growth and development, which comprises a reagent for inhibiting the expression of DAP1 gene.

[0028] The beneficial effects of the present invention are:

[0029] The invention discloses a gene DAP1 related to rice panicle development and plant type. By constructing a KO-DAP1 knockout vector and transferring it into the cultivar ZH17, the transgenic T2 generation plant is compared with ZH17, and the loss of DAP1 nucleotide causes the change of DAP1 amino acid, resulting in the loss of DAP1 protein function, the transgenic plant height is reduced, the panicle development is abnormal, and severe panicle degeneration occurs. Other related agronomic traits such as the number of stalks, panicle length, stalk length and width, and sword leaf length and width of the panicle are reduced to varying degrees. In addition, some abnormal spikelets are grown on the mutant stalks, which are mainly manifested in abnormal development of inner and outer palea, different degrees of bending of inner and outer palea, and internal flower organ development defects. It shows that the gene DAP1 and its encoded protein are related to the regulation of rice panicle development and plant type, which not only helps to analyze the molecular mechanism of rice panicle development and plant type regulation, but also can provide new gene resources for ensuring high and stable yield of rice. BRIEF DESCRIPTION OF THE DRAWINGS

[0030] Figure 1 Comparison of plant types between SH55 and mutant dap1; Figure 1 (a) is a comparison of plant types of SH55 and mutant dap1 at different developmental stages. Figure 1 (b) Comparison of the first to fifth internodes between SH55 and mutant dap1. Figure 1 (c) Comparison of flag leaves of SH55 and mutant dap1;

[0031] Figure 2 The plant height statistics of SH55 and mutant dap1 at different developmental stages;

[0032] Figure 3 Statistics of internode lengths from the first to the fifth internodes of SH55 and mutant dap1;

[0033] Figure 4 Statistics of internode widths from the first to the fifth internodes of SH55 and mutant dap1;

[0034] Figure 5 Statistics of flag leaf length of SH55 and mutant dap1;

[0035] Figure 6 Statistics for the width of flag leaves of SH55 and mutant dap1;

[0036] Figure 7 Comparison of panicle traits between SH55 and mutant dap1;

[0037] Figure 8 Statistics of spike length of SH55 and mutant dap1;

[0038] Fig. 9 The number of branches and peduncles in SH55 and mutant dap1 is counted once;

[0039] Fig.10 is the mutation status of DAP1 gene;

[0040] Fig.11 Comparison of genotypes between ZH17 and knockout transgenic plants;

[0041] Fig.12 Comparison of plant type, internodes and flag leaves between ZH17 and knockout transgenic plants;

[0042] Fig.13 The plant height statistics of ZH17 and knockout transgenic plants at different developmental stages;

[0043] Fig.14 Statistics of internode lengths from the first to the fifth internodes of ZH17 and knockout transgenic plants;

[0044] Fig.15 Statistics of internode widths from the first to the fifth internodes of ZH17 and knockout transgenic plants;

[0045] Fig.16 Statistics of flag leaf length of ZH17 and knockout transgenic plants;

[0046] Fig.17 Statistics of sword leaf width of ZH17 and knockout transgenic plants;

[0047] Fig.18 Comparison of ear traits between ZH17 and knockout transgenic plants;

[0048] Fig.19 Statistics of ear length of ZH17 and knockout transgenic plants;

[0049] Fig. 20 This is a statistics of the number of branches and stalks in ZH17 and knockout transgenic plants. DETAILED DESCRIPTION

[0050] The specific embodiments of the present invention are described below to facilitate the understanding of the present invention by those skilled in the art. If the specific conditions are not specified in the examples, the methods are carried out according to conventional conditions or conditions recommended by the manufacturer. If the manufacturers are not specified in the reagents or instruments used, they are all conventional products that can be purchased commercially. However, it should be clear that the present invention is not limited to the scope of the specific embodiments. For those skilled in the art, as long as various changes are within the spirit and scope of the present invention defined and determined by the attached claims, these changes are obvious, and all inventions and creations using the concept of the present invention are protected.

[0051] The present invention can utilize existing plant expression vectors to construct a recombinant expression vector containing the DAP1 gene. When utilizing the DAP1 gene to construct a plant expression vector, any enhanced promoter or constitutive promoter can be added before its transcription initiation nucleotide, such as the cauliflower mosaic virus (CAMV) 35S promoter, the ubiquitin gene Ubiquitin promoter (pUbi), etc., which can be used alone or in combination with other plant promoters. In addition, when utilizing the gene of the present invention to construct a plant expression vector, an enhancer can also be used, including a translation enhancer or a transcription enhancer. These enhancer regions can be the ATG start codon or the adjacent region start codon, etc., but must be the same as the reading frame of the coding sequence to ensure the correct translation of the entire sequence. The plant expression vector carrying the DAP1 gene encoding the protein related to rice panicle development and plant type regulation of the present invention can be transformed into plant cells or tissues by conventional biological methods such as Ti plasmids, Ri plasmids, plant virus vectors, direct DNA transformation, microinjection, electroconductivity, Agrobacterium-mediated, gene guns, etc. The transformed plant host can be either a monocotyledonous plant such as rice or a dicotyledonous plant such as Arabidopsis thaliana.

[0052] When identifying and screening transgenic plants or cells, the plant expression vectors used can be processed to improve screening efficiency, such as adding antibiotic resistance markers (kanamycin, etc.) or chemical resistance marker genes (herbicide resistance genes), genes that express enzymes or luminescent compounds that produce color changes in plants (GUS genes, luciferase genes, etc.), etc.

[0053] The DAP1 protein disclosed in the present invention consists of 387 amino acid residues, and its amino acid sequence is as follows:

[0054] MRNHCPHAWHQQQHRGRMWAASPAFRRRLFLLRSLSPSPCAALPGNAACSSPSPSTSI

[0055] RVNAMSASGPVYEADAEAVVRRITPPLDRARHKGQAGKIAVIGGCREYTGAPYFAAISALK

[0056] VGADLSHVFCTRDAATVIKSYSPELIVHPILEESYSVSDGERESVSSRILTEVAKWMERFDCI

[0057] VVGPGLGRDSFLLDCVSNIMRHARQANIPTVVDGDGLFLITNNLSLVEGNLLAILTPNVYEY

[0058] KRLVQKVLNCEVNEENASEQLTALCQKIGGITIMRKGKADIISDGKTVTQVSTFGSPRRCGG

[0059] QGDILSGSVAVFASWARHFLLTNEYPTEKSVNPMMLGCIAGSLLLRKAASHAFEKNKRSTV

[0060] TTDIIEFLGKSLEDICPAGH*(SEQ ID NO:1)。

[0061] The full-length cDNA sequence of the DAP1 gene consists of 1389 nucleotides, and its nucleotide sequence is as follows:

[0062] GTAGAAAAAATGCGAAACCACTGCCCTCACGCGTGGCATCAGCAGCAGCACCGCG

[0063] GCCGCATGTGGGCCGCCTCACCGGCCTTCCGCAGGCGCCTCTTCCTCCTCCGTTCCCTTT

[0064] CCCCCTCCCCCTGCGCCGCCCTCCCCGGCAACGCCGCCTGCTCCTCCCCCTCGCCGTCG

[0065] ACCTCCATTCGGGTCAACGCGATGTCGGCATCGGGCCCCGTGTACGAGGCGGACGCTGA

[0066] GGCGGTGGTCCGCCGGATCACCCCGCCGCTCGACCGCGCGCGCCACAAGGGCCAGGCA

[0067] GGGAAAATTGCTGTAATTGGTGGATGTCGTGAGTACACTGGTGCTCCCTATTTTGCAGCG

[0068] ATTTCTGCCTTGAAAGTTGGTGCAGATCTCTCTCACATGTTTTCTGCACAAGAGATGCTGCA

[0069] ACGGTAATAAAGAGTTATAGCCCTGAGCTGATTGTACATCCAATACTAGAGGAATCTTAC

[0070] AGTGTAAGCGATGGTGAGAGAGAATCTGTTTCTTCTAGAATTCTCACAGAAGTAGCAAA

[0071] GTGGATGGAGCGCTTTGATTGCATCGTTGTTGGTCCTGGCCTTGGAAGGGACTCATTTCT

[0072] TCTGGACTGTGTAAGTAATATCATGAGACATGCACGGCAGGCAAATATTCCAACAGTCGT

[0073] TGACGGGGATGGCCTTTTCCTTATAACCAATAACCTTAGTCTTTGTTGAGGGTAACTTGCT

[0074] TGCCATCCTAACACCAAATGTATACGAGTACAAACGTCTTGTCCAGAAGGTTCTTAACTG

[0075] TGAAGTAAATGAGGAAAACGCTTCTGAACAACTTACTGCACTATGCCAAAAAATCGGTG

[0076] GCATAACCATCATGCGGAAAGGAAAAGCAGATATAATCAGTGATGGCAAAACTGTAACA

[0077] CAAGTAAGTACCTTTGGTTCCCCCAAGGAGATGTGGTGGTCAAGGTGACATTCTTTCAGG

[0078] AAGTGTTGCAGTATTTGCATCATGGGCCACGTCACTTTCTCCTGACGAATGAGTACCCTAC

[0079] AGAGAAGAGCGTGAATCCGATGATGCTTGGGTGCATTGCTGGCTCTCTACTACTTAGGA

[0080] AAGCTGCATCACATGCTTTTGAGAAGAACAAGAGATCAACTGTCACCACTGACATCATT

[0081] GAGTTCCTGGGCAAAAGCTTGGAAGATATATGCCCTGCTGGTCATTAGTTTAGATCTTTA

[0082] CCATCATTGGTGGTACGGCGCCTTAGCACCTGTAATAATGGTAATCCATATGTTCGGATAC

[0083] CAGTCTCTCCCTGCTTAATGTACATGTTTCTTGACTGAAAAGATGGTGTTACAATGCTTG

[0084] GTTTTGTTTAGCCTCCGTTTTGC.TCAGAAGAATTCTACAGAATGAATAATGAATTGCCCCATAAATGGGGCTTTGATTTTGG (SEQ ID NO: 2).

[0085] The indica rice variety SH55 used below can be obtained from China Agricultural University; the knockout vector pYLCRISPR / Cas9Pubi-H (Xie X, Ma X, Zhu Q, Zeng D, Li G, Liu YA Convenient Software Toolkit for CRISPR-Based Genome Editing. Molecular Plant, 2017, 10(9): 1246-1249.) can be obtained from China Agricultural University. The primers and sequence information used are shown in Table 1.

[0086] Table 1 Primer sequence list

[0087]

[0088]

[0089] Example 1 Discovery and cloning of the rice panicle development and plant architecture regulatory gene DAP1

[0090] (1) In order to identify genes regulating rice panicle development and plant shape, this experiment used the indica rice variety SH55 as the genetic material and used ethyl methanesulfonate (EMS) to induce mutations in it. A mutant dap1 with abnormal panicle development and reduced plant shape was screened out from the M2 mutation population. Figure 1 As shown in Figure 2, the dap1 mutant has reduced plant height, reduced stem length and width, and reduced sword leaf length and width. In addition, the dap1 mutant is almost incapable of fruiting ( Figure 7 ), mainly manifested by severe degeneration of spikelets, reduced number of peduncles and reduced ear length; in some cases, dap1 mutants have abnormal spikelets on the ears, which are mainly manifested by abnormal development of the inner and outer palea, varying degrees of bending of the inner and outer palea, and defects in the development of internal floral organs.

[0091] Figure 2 Statistical analysis of plant height of wild type and dap1 mutant at 40, 65, 90, 110 and 130 days after sowing. Figure 3 and Figure 4 It can be seen that the length and width of each internode of the dap1 mutant are significantly lower than those of the wild type. Figure 5 and Figure 6 It can be seen that the length and width of the flag leaf of the dap1 mutant are significantly lower than those of the wild type.

[0092] Figure 8 Comparison of the ear length between the wild type and the dap1 mutant. It can be seen that the ear length of the dap1 mutant is significantly shorter than that of the wild type. Fig. 9 This is a comparison of the number of primary branches between the wild type and the dap1 mutant. It can be seen that the number of primary branches of the dap1 mutant is significantly less than that of the wild type.

[0093] (2) In order to isolate the DAP1 gene, the F2 population constructed by hybridization between the japonica rice variety ZH17 and the dap1 mutant was used. Based on the genotype analysis of rice whole genome markers, the target gene LOC_Os11g17610 was located by map-based cloning. The candidate gene LOC_Os11g17610 was obtained by map-based cloning. Sequence analysis revealed that the last base of the 8th exon of LOC_Os11g17610 was substituted from G to A ( Fig.10 ), which encodes an ATP-dependent (S)-NAD(P)H hydrate dehydratase. By comparing the cDNA sequences of SH55 and dap1 mutants, it was found that the base substitution changed the splicing mode of mRNA, causing the 3' splicing site of the 8th exon of the mutant gene to move forward by 59bp, resulting in a frameshift mutation and premature translation termination. Therefore, LOC_Os11g17610 was preliminarily determined to be a candidate gene.

[0094] Example 2 Obtaining and identifying DAP1 transgenic rice

[0095] 1. Construction of KO-DAP1 knockout vector

[0096] The target sequence was designed using the targetDesign function (http: / / skl.scau.edu.cn / targetdesign / ) on the CRISPR-GE website (http: / / skl.scau.edu.cn / ), and the DAP1 genome sequence was input. The target sequences given on the website were screened for sequences with high specificity, low off-target rate, and GC content of 50%–70% as targets. The knockout target sequence of the DAP1 gene was 5'-TGTACGAGGCGGACGCTGAG-3', located at positions 215-234 of SEQ ID NO: 2. Subsequently, the prime Design (http: / / skl.scau.edu.cn / primerdesign / ) function was used to design amplification primers. Construction of a knockout vector containing a single target required two rounds of PCR amplification. The first round of PCR was performed using the pYLgRNA-OsU6a plasmid as a template, and the universal primers UF (SEQ ID NO: 3) and 17610-OsU6aT1 (SEQ ID NO: 6) as primer pairs to amplify the target fragment 1. At the same time, pYLgRNA-OsU6a plasmid was used as a template, and 17610-gRT1 (SEQ ID NO: 5) and universal primer gR-R (SEQ ID NO: 4) were used as primer pairs to amplify the target fragment 2. The second round of PCR used the two fragments obtained in the first round of amplification (fragment 1 and fragment 2 = 1:1) mixed together as a template, and amplified using universal primers U-GAL (SEQ ID NO: 7) and Pgs-GAR (SEQ ID NO: 8) to obtain fragment 3, which connected fragments 1 and 2 together. The knockout vector pYLCRISPR / Cas9Pubi-H was digested with restriction endonuclease Bsa I to obtain the digested vector. Subsequently, the gel-recovered fragment 3 was homologously recombined with the digested vector, and the ligation product was transferred into Escherichia coli DH5a (Qingke Biotechnology Co., Ltd., catalog number TSC-C01), and the positive single clones were screened and sequenced. The recombinant vector with correct sequencing was the KO-DAP1 knockout vector. The designed primer sequences are shown in Table 1.

[0097] 2. Obtaining DAP1 transgenic rice

[0098] The KO-DAP1 knockout vector was transformed into mature embryo callus of ZH17 by Agrobacterium infection, and then the callus was transferred to NB basic medium (with 200 mg / L cephalosporin, 200 mg / L timentin and 50 mg / L hygromycin added), screened for 3 rounds, and each round was cultured in the dark in a 28°C incubator for 25 days to differentiate transgenic plants. The components of NB basic medium include 4.1g NB powder, 0.3g hydrolyzed casein, 0.5g glutamine, 2.878g proline (indica rice), 30g sucrose, 2mL 2,4-D (1mg / mL), and the volume was adjusted to 1L with ddH2O, and then the pH was adjusted to 5.85-6.0 with KOH, and 4.5g plant gel (indica rice) was added, and finally sterilized at 121°C for 20min.

[0099] Specific primers 17610-F (SEQ ID NO: 9) and 17610-R (SEQ ID NO: 10) were designed near the target site, and the genomic fragment containing the target site was amplified and sequenced. The sequencing results were compared with the sequence of the transformed receptor material ZH17 to confirm whether it was a positive transgenic plant and determine the knockout type. The two transgenic positive plants were named KO-dap1-1 and KO-dap1-2.

[0100] Fig.11 The genotypes of ZH17, KO-dap1-1 and KO-dap1-2 were determined by the following method: a 515 bp genomic sequence including the target site was amplified using primers 17610-F and 17610-R, and the amplified result was sent for testing and compared with the sequence of ZH17. According to the comparison results, in the knockout transgenic plant KO-dap1-1, the nucleotide sequence "5'-GCCCCGTGTACGAGGCGGACGCTGAG GCGGTGGTCCGCCGGATCACCCCGCCGCTCGACCGCGC-3'" between the 209th and 272nd positions of SEQ ID NO: 2 in the DAP1 gene was deleted; in the knockout transgenic plant KO-dap1-2, the nucleotide sequence "5'-CGGGCCCCGTGTACGAGG-3'" between the 206th and 223rd positions of SEQ ID NO: 2 in the DAP1 gene was deleted. The above changes in nucleotide sequences lead to changes in the DAP1 amino acid sequence, resulting in loss of DAP1 protein function and affecting plant phenotype.

[0101] Fig.12 Comparison of plant type, internodes and flag leaves between ZH17 and knockout transgenic plants at different developmental stages. Fig.13The plant height of ZH17 and knockout transgenic plants at 40 days, 65 days, 90 days, 110 days and 130 days after sowing was statistically analyzed. After 40 days of sowing, the plant height of knockout transgenic plants was significantly lower than that of ZH17. Fig.14 and Fig.15 It can be seen that the internode length and width of the knockout transgenic plants KO-dap1-1 and KO-dap1-2 were significantly lower than those of ZH17. Fig.16 and Fig.17 It can be seen that the length and width of the flag leaf of the knockout transgenic plants KO-dap1-1 and KO-dap1-2 were significantly lower than those of ZH17.

[0102] 3. PCR identification and phenotypic identification of transgenic rice

[0103] The sequence containing the target site was amplified using specific primers and sequenced. The sequencing results were compared with the transformed receptor material ZH17 to determine the mutation type of the positive transgenic plants.

[0104] In the T2 generation transgenic positive lines (KO-dap1-1 and KO-dap1-2), the plant structure and panicle development of the transgenic plants were investigated and compared with the transgenic recipient material ZH17. Fig.12 and Fig.18 ), after knocking out the DAP1 gene in ZH17, the transgenic plants showed phenotypes similar to the mutant dap1, mainly manifested in reduced plant height, shorter and thinner stems, reduced sword leaf length and width, smaller panicles, fewer panicle branches and severe panicle degeneration. In addition, there were some abnormal spikelets in the knockout materials, mainly manifested in abnormal development of the inner and outer palea and defects in floral organ development.

[0105] Fig.19 The ear length of ZH17 and knockout transgenic plants was compared. The ear length of knockout transgenic plants was significantly smaller than that of ZH17. Fig. 20 The number of branches per plant was compared between ZH17 and knockout transgenic plants. The number of branches per plant in knockout transgenic plants was significantly less than that in ZH17.

Claims

1. A protein DAP1 that regulates plant growth and development, characterized in that: The amino acid sequence of this protein is: a. the amino acid sequence as shown in SEQ ID NO: 1; or b. The amino acid sequence as shown in SEQ ID NO: 1 is substituted, deleted and / or added with one or more amino acids, and expresses an amino acid sequence of a functional protein that regulates plant growth and development.

2. A gene DAP1 encoding the protein regulating plant growth and development according to claim 1, characterized in that: The nucleotide sequence of the gene is: a. a nucleotide sequence as shown in SEQ ID NO: 2; or b. a nucleotide sequence of positions 10-1173 from the 5′ end as shown in SEQ ID NO: 2; or c. a nucleotide sequence that hybridizes with the nucleotide sequence shown in SEQ ID NO: 2 under stringent conditions and encodes a nucleotide sequence that is a functional protein that regulates plant growth and development; or d. The nucleotide sequence as shown in SEQ ID NO: 2 is substituted, deleted and / or added with one or more nucleotides, and / or undergoes missense mutation of one or more base pairs, and encodes a nucleotide sequence of a functional protein that regulates plant growth and development.

3. A recombinant expression vector, characterized in that: Comprising the gene according to claim 2.

4. A recombinant microorganism, characterized in that Comprising the recombinant vector according to claim 3.

5. Use of the gene DAP1 according to claim 2, the recombinant expression vector according to claim 3 or the recombinant microorganism according to claim 4 in regulating plant growth and development.

6. The use according to claim 5, characterized in that: By silencing or knocking out the DAP1 gene, plant growth and development can be regulated.

7. The use according to claim 6, characterized in that: By silencing or knocking out the DAP1 gene, the plant height is reduced, the stems become shorter and thinner, the length and width of the sword leaf are reduced, the ears become smaller, the number of stalks on the ears is reduced, and severe ear degeneration occurs, as well as abnormal development of the inner and outer palea and defects in floral organ development.

8. The use according to claim 5, characterized in that: The plant is a monocotyledonous plant.

9. The use according to claim 8, characterized in that: The plant is rice.

10. A preparation for regulating plant growth and development, characterized in that: Included are agents that inhibit the expression of the DAP1 gene.

Images