Chalcone synthase gene CsCHS of chaenomeles speciosa as well as encoding product and application of chalcone synthase gene

By cloning and validating the Chalcone synthase gene CsCHS from Chaenomeles speciosa, the problem of insufficient research on this gene has been solved, enabling efficient biosynthesis and molecular regulation of flavonoids, supporting the improvement of flavonoid content in papaya and the quality improvement of medicinal papaya.

CN121575010APending Publication Date: 2026-02-27ANHUI UNIVERSITY OF TRADITIONAL CHINESE MEDICINE +1
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
CN202511800507.X
Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Filing Date
2025-12-02
Publication Date
2026-02-27

AI Technical Summary

Technical Problem

There is limited research on the chalcone synthase gene (CHS) of Chaenomeles speciosa in the existing technology. The sequence characteristics, tissue expression patterns and functional verification are insufficient, which affects the regulation of flavonoid synthesis and the development of medicinal active substances.

Method used

The chalcone synthase gene CsCHS from Chaenomeles speciosa and its encoded product were cloned and verified. Specific primers and recombinant expression vectors were provided. The gene was expressed using BL21(DE3) chemocompetent cells and catalyzed the production of naringenin from 4-coumaryl-CoA and malonyl-CoA.

Benefits of technology

This study fills a research gap in the key gene CHS for flavonoid synthesis in Chaenomeles speciosa, elucidates the synthesis mechanism of flavonoid active substances, provides gene resources for the molecular regulation of increasing flavonoid content in papaya, enriches the CHS gene resources of Rosaceae plants, and supports the quality improvement and metabolic regulation of medicinal papaya.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN121575010A_ABST
    Figure CN121575010A_ABST
Patent Text Reader

Abstract

The invention belongs to the technical field of gene engineering, and particularly relates to a chaenomeles speciosa chalcone synthase gene CsCHS as well as a coding product and application thereof. The invention provides a chaenomeles speciosa chalcone synthase gene CsCHS, a protein product coded by the chaenomeles speciosa chalcone synthase gene CsCHS, and an application of the chaenomeles speciosa chalcone synthase gene CsCHS. The three kinds of chaenomeles speciosa CsCHS1, CsCHS2 and CsCHS3 genes are obtained through cloning, and protein products of the three kinds of chaenomeles speciosa CsCHS1, CsCHS2 and CsCHS3 genes are successfully expressed and purified in a pronucleus system. An in-vitro enzymatic experiment shows that the obtained CsCHS protein can be catalyzed by taking 4-coumaroyl coenzyme A and malonyl coenzyme A as substrates to generate naringenin, and the CsCHS protein is proved to have typical chalcone synthase catalytic activity.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] This invention belongs to the field of genetic engineering technology, specifically relating to a type of Chaenomeles speciosa chalcone synthase gene CsCHS, its encoded product, and its applications. Background Technology

[0002] Papaya was first recorded in the *Mingyi Bielu* (Records of Famous Physicians), and has been included in subsequent herbal texts throughout history. The *Chinese Pharmacopoeia* defines papaya as *Chaenomeles speciosa*, a plant in the Rosaceae family. Chaenomeles speciosa (Sweet) Nakai The dried, nearly mature fruit of papaya has the effects of relaxing muscles and tendons, harmonizing the stomach, and resolving dampness. Modern research shows that the main active ingredients of papaya include triterpenes, flavonoids, and phenolic acids, which have various pharmacological effects such as liver protection, anti-inflammation, analgesia, and antibacterial properties. As one of the first Chinese medicinal materials included in the "food and medicine homology" list, papaya is not only used medicinally but also widely applied in the food processing of fruit wine, fruit vinegar, and dried fruit, and has high development value.

[0003] Chalcone synthase ( Chalcone Synthase Coenzyme CHS (4-coumaryl-CoA) is a key rate-limiting enzyme in the biosynthesis of flavonoids in plant secondary metabolic pathways, belonging to the type II polyketide synthase family. This enzyme synthesizes flavonoids via 4-coumaryl-CoA (4-coumaroyl-CoA). p-coumaroyl -CoA) and three molecules of malonyl-CoA ( malonyl Using -CoA as a substrate, chalcone is generated through a condensation reaction. chalcone The latter, through isomerization and modification, can derive various flavonoids, such as flavonols, anthocyanins, and isoflavones. CHS are ubiquitous in plants and are important enzyme nodes that regulate the accumulation of flavonoids and plant stress resistance, flower color formation, and the synthesis of medicinal active substances.

[0004] Studies have shown that CHS is one of the earliest key structural genes to be cloned and functionally identified in the flavonoid biosynthesis pathway, and it has been used in soybean ( Glycine max Arabidopsis thaliana ( ) Arabidopsis thaliana ),Grape( Vitis vinifer a) and apples ( Malus domestica It has been identified and its functions studied in various plants, including *Chaenomeles speciosa*. Chaenomeles speciosa In *Chaenomeles speciosa*, flavonoids such as quercetin, kaempferol, and rutin are among the main active components, significantly influencing their pharmacological effects and quality formation. However, current research reports on the CHS gene in *Chaenomeles speciosa* are limited, and its sequence characteristics, tissue expression patterns, and functional validation remain insufficient. Therefore, it is necessary to systematically clone and analyze the expression of the CHS gene to clarify its role in the flavonoid synthesis pathway, providing a foundation for subsequent metabolic regulation and application development. Summary of the Invention

[0005] The purpose of this invention is to provide a type of Chaenomeles speciosa chalcone synthase gene CsCHS, its encoded product, and its applications, filling the gap in research on the key gene CHS for flavonoid synthesis in Chaenomeles speciosa, preliminarily elucidating the synthesis mechanism of flavonoid active substances in Chaenomeles speciosa, and providing gene resources for the molecular regulation of increasing the flavonoid content in papaya.

[0006] To achieve the above objectives, the present invention provides the following technical solution: This invention provides a type of Chaenomeles speciosa chalcone synthase gene CsCHS, the nucleotide sequence of which is shown in SEQ ID NO.1, SEQ ID NO.2 and SEQ ID NO.3.

[0007] The present invention provides a class of products encoded by the Chalcone synthase gene CsCHS of Chaenomeles speciosa as described above, the amino acid sequences of which are shown in SEQ ID NO.4, SEQ ID NO.5 and SEQ ID NO.6.

[0008] Preferably, the product comprises a polypeptide or a protein.

[0009] The present invention also provides specific primers for cloning the Chalcone synthase gene CsCHS of Chaenomeles speciosa as described above. When the nucleotide sequence of the Chalcone synthase gene CsCHS of Chaenomeles speciosa is as shown in SEQ ID NO.1, the specific primers are as shown in SEQ ID NO.7 and SEQ ID NO.8. When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.2, the specific primers are as shown in SEQ ID NO.9 and SEQ ID NO.10; When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.3, the specific primers are as shown in SEQ ID NO.11 and SEQ ID NO.12.

[0010] The present invention also provides a recombinant expression vector containing the above-mentioned Chaenomeles speciosa chalcone synthase gene CsCHS.

[0011] Preferably, the recombinant expression vector uses the recombinant plasmid of the Chalcone synthase gene CsCHS from Chaenomeles speciosa as a template, and performs PCR amplification with BamHI as the restriction site of upstream and downstream primers. The PCR product is then ligated with pET-28a that has undergone the same restriction enzyme digestion. When the nucleotide sequence of the Chalcone synthase gene CsCHS of Chaenomeles speciosa is as shown in SEQ ID NO.1, the specific primer sequences for the BamHI restriction site are as shown in SEQ ID NO.13 and SEQ ID NO.14. When the nucleotide sequence of the Chalcone synthase gene CsCHS of Chaenomeles speciosa is as shown in SEQ ID NO.2, the specific primer sequences for the BamHI restriction site are as shown in SEQ ID NO.15 and SEQ ID NO.16. When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.3, the specific primer sequences for the BamHI restriction site are as shown in SEQ ID NO.17 and SEQ ID NO.18.

[0012] The present invention also provides a host cell containing the above-mentioned Chaenomeles speciosa chalcone synthase gene CsCHS recombinant expression vector.

[0013] Preferably, the host cell is a BL21(DE3) chemocompetent cell.

[0014] The present invention also provides the application of a class of products encoded by the above-mentioned Chaenomeles speciosa chalcone synthase gene CsCHS or the above-mentioned Chaenomeles speciosa chalcone synthase gene CsCHS in catalyzing the production of naringenin using 4-coumaroyl-CoA and malonyl-CoA as substrates.

[0015] The present invention also provides the application of a class of products encoded by the above-mentioned Chaenomeles speciosa chalcone synthase gene CsCHS or the above-mentioned Chaenomeles speciosa chalcone synthase gene CsCHS in the preparation of flavonoid compounds.

[0016] The beneficial effects of this invention are: This invention is the first to systematically clone and functionally validate the CHS gene of *Chaenomeles speciosa*, filling a gap in research on the key gene CHS for flavonoid synthesis in this plant. This invention also provides preliminary elucidation of the synthetic mechanism of flavonoid bioactive substances in *Chaenomeles speciosa*, offering genetic resources for the molecular regulation of increasing flavonoid content in papaya.

[0017] The CHS gene of *Chaenomeles speciosa* described in this invention can be used for quality improvement, metabolic regulation, and efficient biosynthesis of flavonoids in *Chaenomeles speciosa* and related species. This not only enriches the CHS gene resources of Rosaceae plants but also provides a theoretical basis for functional gene research on medicinal papaya. Attached Figure Description

[0018] To more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the drawings used in the embodiments will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For those skilled in the art, other drawings can be obtained based on these drawings without creative effort.

[0019] Figure 1 Chalcone synthase for Chaenomeles speciosa CsCHSAgarose gel electrophoresis image (where M represents the marker, lane 1 represents the CsCHS1 gene, lane 2 represents the CsCHS2 gene, and lane 3 represents the CsCHS3 gene). Figure 2 The protein functional domains of Chalcone synthase CsCHS1, CsCHS2 and CsCHS3 from Chaenomeles speciosa are shown in the diagram (where A and C are CsCHS1, CsCHS2 and CsCHS3, respectively). Figure 3 A represents the predicted secondary structure analysis results of Chaenomeles speciosa chalcone synthase CsCHS1 protein; B represents the predicted secondary structure analysis results of Chaenomeles speciosa chalcone synthase CsCHS2 protein; C represents the predicted secondary structure analysis results of Chaenomeles speciosa chalcone synthase CsCHS3 protein. Figure 4 A represents the predicted transmembrane domain of Chaenomeles speciosa chalcone synthase CsCHS1 protein; B represents the predicted transmembrane domain of Chaenomeles speciosa chalcone synthase CsCHS2 protein; C represents the predicted transmembrane domain of Chaenomeles speciosa chalcone synthase CsCHS3 protein. Figure 5 A is a predicted tertiary structure diagram of the Chalcone synthase CsCHS1 protein from Chalcone synthase ... Figure 6 A shows the SDS-polyacrylamide gel electrophoresis results of Chaetoceros chinensis chaetoceros synthase CsCHS1 protein; B shows the SDS-polyacrylamide gel electrophoresis results of Chaetoceros chinensis chaetoceros synthase CsCHS2 protein; C shows the SDS-polyacrylamide gel electrophoresis results of Chaetoceros chinensis chaetoceros synthase CsCHS3 protein (where M represents Protein). Marker, lane 1 is the pET-28a empty vector, lane 2 are uninduced CsCHS1, CsCHS2, and CsCHS3 samples, lane 3 is the whole CsCHS1, CsCHS2, and CsCHS3 samples, lane 4 is the crude enzyme supernatant of CsCHS1, CsCHS2, and CsCHS3 samples, lane 5 is the CsCHS1, CsCHS2, and CsCHS3 purified with 100mM imidazole, lane 6 is the CsCHS1, CsCHS2, and CsCHS3 purified with 300mM imidazole, and lane 7 is the CsCHS1, CsCHS2, and CsCHS3 purified with 500mM imidazole. Figure 7 This is the liquid chromatogram of naringenin reference standard; Figure 8A is a liquid chromatogram of the products of 4-coumaroyl-CoA and malonyl-CoA catalyzed by Chalcone synthase CsCHS1 from *Chalcone quince*; B is a liquid chromatogram of the products of 4-coumaroyl-CoA and malonyl-CoA catalyzed by Chalcone synthase CsCHS2 from *Chalcone quince*; C is a liquid chromatogram of the products of 4-coumaroyl-CoA and malonyl-CoA catalyzed by Chalcone synthase CsCHS3 from *Chalcone quince*. Figure 9 The liquid chromatograms of the products of 4-coumaroyl-CoA and malonyl-CoA catalyzed by pET-28a without a carrier are shown. Detailed Implementation

[0020] This invention provides a class of Chaenomeles speciosa chalcone synthase genes CsCHS, the nucleotide sequences of which are shown in (CsCHS1) SEQ ID NO.1, (CsCHS2) SEQ ID NO.2 or (CsCHS3) SEQ ID NO.3, and the amino acid sequences of the encoded proteins are shown in (CsCHS1-AA) SEQ ID NO.4, (CsCHS2-AA) SEQ ID NO.5 and (CsCHS3-AA) SEQ ID NO.6.

[0021] CsCHS1-AA:MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPAVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADFQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLFGFGPGLTVETVVLHSVGA(SEQ ID NO.4); CsCHS2-AA:MVTVEEVRKAQRAEGPATIMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPEVEKPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEWGVLFGFGPGLTVETVVLHSVGLTA(SEQ ID NO.5); CsCHS3-AA:MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPTVCEYMAPS LDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCS EITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLRTTGEGLEWGVLFGFGPGLTVETVVLHSVAA (SEQ ID NO.6).

[0022] To further illustrate the present invention, the technical solutions provided by the present invention will be described in detail below with reference to the accompanying drawings and embodiments, but these should not be construed as limiting the scope of protection of the present invention.

[0023] Unless otherwise specified, the production processes, experimental methods, or testing methods involved in the embodiments of this invention are all conventional methods in the prior art, and their names and / or abbreviations are all conventional names in the field, which are very clear and distinct in the relevant application areas. Those skilled in the art can understand the conventional process steps based on the names and apply the corresponding equipment, and implement them according to conventional conditions or the conditions recommended by the manufacturer.

[0024] The various instruments, equipment, raw materials or reagents used in the embodiments of this invention are not subject to any special restrictions on their source. They are all conventional products that can be purchased through regular commercial channels and can be prepared according to conventional methods known to those skilled in the art.

[0025] Example 1: Cloning of the Chalcone Synth Gene CsCHS from Chaenomeles speciosa RNA was extracted from papaya fruit according to the instructions of the RNA extraction kit (RNAprep Pure Plant Kit). The integrity of total RNA was detected by 1% agarose gel electrophoresis. The papaya fruit was sourced from a papaya planting base in Xintian Town, Xuancheng City, Anhui Province.

[0026] Using total RNA extracted from papaya fruit as a template, cDNA of papaya was obtained by reverse transcription using the All-in-One First-Strand Synthesis MasterMix reverse transcription kit.

[0027] PCR amplification was performed using forward primers CsCHS1-F and CsCHS1-R, forward primers CsCHS2-F and CsCHS2-R, and forward primers CsCHS3-F and CsCHS3-R, respectively. The CsCHS clone primer sequences are shown in Table 1.

[0028] Table 1. CsCHS cloning primer sequences

[0029] The amplification system is as follows: 1 μL of TransStart® FastPfu Fly DNA Polymerase, 25 μL of 2×TransStart® FastPfu Fly Reaction Mix, 1 μL each of 0.2 μM primer F and 0.2 μM primer R, 1 μL of template cDNA, and the remainder is made up with sterile double-distilled water.

[0030] Reaction conditions: 98℃ pre-denaturation for 1 min, 98℃ denaturation for 10 s, 55℃ annealing for 5 s, 72℃ extension for 20 s, 35 cycles followed by 72℃ extension for 5 min, and storage at 4℃. Cloned products of the papain chalcone synthase CsCHS1, CsCHS2, and CsCHS3 genes were obtained.

[0031] The amplification products were detected by 1% agarose gel electrophoresis, as shown in the electrophoretic results. Figure 1 As shown. Figure 1 In the diagram, M represents the Marker, lane 1 represents the CsCHS1 gene, lane 2 represents the CsCHS2 gene, and lane 3 represents the CsCHS3 gene. The target gene CsCHS fragment is approximately 1200 bp in size, which is in line with expectations.

[0032] The gel was extracted and the target conditions were determined using the EasyPure Quick Gel Extraction Kit. The amplified product was ligated into the cloning vector pEASY-Blunt Zero. 50 μL of *E. coli* Trans1-T1 was thawed on ice, the cloning product was added, and the mixture was gently mixed. The mixture was then incubated on ice for 30 minutes. The tubes were then heat-shocked at 42°C for 30 seconds, and then quickly transferred to ice for 2 minutes. 500 mL of sterile LB medium was added to each centrifuge tube, mixed, and incubated at 37°C, 200 rpm for 1 hour to allow bacterial recovery. 100 μL of transformed competent cells were added to LB solid medium containing ampicillin. The cells were evenly spread, plated upside down, and incubated overnight at 37°C. Bacteria were picked and subjected to PCR verification using 2×EasyTaq® PCR SuperMix enzyme. Positive clones were sent to Sangon Biotech (Shanghai) Co., Ltd. for sequencing.

[0033] After sequencing, the PCR products of papaya CsCHS1, CsCHS2, and CsCHS3 have the nucleotide sequences shown in SEQ ID NO.1, SEQ ID NO.2, and SEQ ID NO.3 in the sequence listing, respectively.

[0034] The open reading frame (ORF) of the CsCHS1 gene is 1170 bp in length, and its nucleotide sequence is shown in SEQ ID NO.1 in the sequence listing. The sequence shown in SEQ ID NO.1 encodes 396 amino acids, as shown in SEQ ID NO.4. The gene represented by the nucleotides is named CsCHS1, and the encoded protein is named CsCHS1-AA.

[0035] The open reading frame (ORF) of the CsCHS2 gene is 1176 bp in length, and its nucleotide sequence is shown in SEQ ID NO.2 in the sequence listing. The sequence shown in SEQ ID NO.2 encodes 398 amino acids, as shown in SEQ ID NO.5. The gene shown in the nucleotide sequence is named CsCHS2, and the encoded protein is named CsCHS2-AA.

[0036] The open reading frame (ORF) of the CsCHS3 gene is 1170 bp in length, and its nucleotide sequence is shown in SEQ ID NO.3 in the sequence listing. The sequence shown in SEQ ID NO.3 encodes 396 amino acids, as shown in SEQ ID NO.6. The gene shown in the nucleotide sequence is named CsCHS3, and the protein it encodes is named CsCHS3-AA.

[0037] The CsCHS1, CsCHS2, and CsCHS3 gene sequences were analyzed using the BLAST program in the NCBI database for nucleotide homology searches in the Nonredundant GenBank+EMBL+DDBJ+PDB and Nonredundant GenBank CDStranslation+PDB+Swissprot+Superdate+PIR databases. The genes showed high homology at the amino acid level with CHS sequences from other species. Figure 2 As shown in (A), 2(B), and 2(C), the secondary structures of CsCHS1, CsCHS2, and CsCHS3 proteins consist of α-helices, β-extended chains, and random coils, as... Figure 3 As shown in (A), 3(B), and 3(C), CsCHS1, CsCHS2, and CsCHS3 lack transmembrane structures and are extramembrane proteins, such as... Figure 4 As shown in (A), 4(B), and 4(C), the tertiary structure of proteins is predicted using the Swiss Model, as follows. Figure 5 As shown in (A), 5(B), and 5(C), using the 1i86.1.A protein model, the similarity of the CsCHS1 protein sequence is 86.34%, with a score of 0.88; using the 4yjy.1.A protein model, the similarity of the CsCHS1 protein sequence is 82.05%, with a score of 0.88; and using the 4yjy.1.A protein model, the similarity of the CsCHS1 protein sequence is 81.96%, with a score of 0.88.

[0038] Example 2: Preparation of pET-28a-CsCHS recombinant expression vector The CsCHS gene was analyzed, and primers containing the homologous arm of the BamHI restriction site in the pET-28a plasmid were designed.

[0039] Using the recombinant plasmid as a template, PCR amplification was performed using homologous recombination primers (as shown in Table 2) and TransStart® FastPfuFly DNA Polymerase. The resulting digestion products were ligated with pET 28a digested with BamHI to obtain recombinant expression vectors, named pET-28a-CsCHS1, pET-28a-CsCHS2, and pET-28a-CsCHS3, respectively. The recombinant plasmids were introduced into BL21(DE3) competent cells to obtain recombinant bacteria BL21(DE3)-pET-28a-CsCHS1, BL21(DE3)-pET-28a-CsCHS2, and BL21(DE3)-pET-28a-CsCHS3. The empty vector pET-28a was introduced into BL21(DE3) competent cells to obtain the blank control bacteria BL21(DE3)-pET-28a.

[0040] Table 2 CsCHS homologous recombination primers

[0041] Example 3: Induction and purification of CsCHS protein Recombinant bacteria BL21(DE3)-pET-28a-CsCHS1, BL21(DE3)-pET-28a-CsCHS2, and BL21(DE3)-pET-28a-CsCHS3 were inoculated into LB liquid medium containing 50 μg / ml kanamycin antibiotic and cultured at 37°C with shaking at 200 rpm. They were then inoculated at a 1:100 ratio into fresh LB medium containing 50 μg / ml kanamycin antibiotic and cultured at 37°C with shaking for approximately 5 h until OD (dose retardation) was reached. 600 =0.6, then add isopropyl β-D-galactoside (IPTG, final concentration 0.5mM), and induce culture at 16℃ with shaking for 20 h. Centrifuge at 5000 rpm for 10 min at 4℃ to remove the supernatant and obtain bacterial cells. Resuspend the bacterial cells in 5 mL His Buffer A (20 mmol·L⁻¹ Na₃PO₄¹⁻H₂O, 500 mmol·L⁻¹ NaCl, 20 mmol·L⁻¹ imidazole), centrifuge under the same conditions to remove the supernatant, resuspend the bacterial cells in 3 mL His Buffer A, and sonicate on ice for 10 min (intermittent sonication with 5 s on and 5 s off). Centrifuge at 4℃ to obtain the crude protein extract of the CsCHS gene. BL21(DE3)-pET-28a was used as a negative control.

[0042] 500 μL of Ni NTA Resin was mixed into a 2 mL centrifuge tube, resuspended in 1 mL of Buffer A, and centrifuged at 500×g for 5 min at 4°C. The supernatant was discarded, and the process was repeated three times. 1 mL of the crude protein extract of the CsCHS gene was added and placed in an ice box. The mixture was then shaken at 120 rpm for 1 h on a shaker. Afterward, the mixture was centrifuged at 500×g for 5 min at 4°C, the supernatant was discarded, and eluted successively with 200 μL of 100 mM, 200 μL of 300 mM, and 200 μL of 500 mM imidazole. The mixture was centrifuged at 500×g for 5 min at 4°C to obtain the purified protein extract of the CsCHS gene.

[0043] The bacterial culture, crude protein extract, and purified protein extract of the CsCHS gene were subjected to 12.5% ​​SDS-PAGE with polyacrylamide gel electrophoresis, and the results are as follows: Figure 6As shown in (A), 6(B), and 6(C), where M represents Protein Marker, lane 1 contains the pET-28a empty vector, lanes 2 contain uninduced CsCHS1, CsCHS2, and CsCHS3 samples, lanes 3 contain whole CsCHS1, CsCHS2, and CsCHS3 samples, lanes 4 contain crude enzymes from the supernatant of CsCHS1, CsCHS2, and CsCHS3 samples, lanes 5 contain CsCHS1, CsCHS2, and CsCHS3 purified with 100 mM imidazole, lanes 6 contain CsCHS1, CsCHS2, and CsCHS3 purified with 300 mM imidazole, and lane 7 contains CsCHS1, CsCHS2, and CsCHS3 purified with 500 mM imidazole. Figure 6 As can be seen in (A), compared with the pET-28a empty vector, the crude extract and purified protein extract containing CsCHS protein showed a clear target protein band at 45 kDa, which is consistent with the expected molecular weight of CsCHS protein.

[0044] Example 4: In vitro functional verification of CsCHS protein In vitro enzymatic experiments were conducted using p-4-coumaroyl-CoA and malonyl-CoA as substrates. The reaction system consisted of 50 μL of 1 mM p-4-coumaroyl-CoA, 50 μL of 3 mM malonyl-CoA, 100 μL of purified protein extract from the CsCHS gene, 10 μL of 100 mM magnesium chloride solution, and 300 μL of 0.1 M Kpi buffer (potassium phosphate buffer, pH 7.5), for a total volume of 500 μL. The reaction conditions were as follows: reaction in a 30°C water bath for 60 min, followed by extraction twice with 500 μL of ethyl acetate. The extracts were combined, dried under nitrogen, and dissolved in 300 μL of water. The mixture was centrifuged at 12000 rpm for 5 min, and the supernatant was filtered through a 0.22 μm microporous membrane.

[0045] The analytical platform used was an Agilent 1260 (Agilent Technologies, USA), and the analytical column was an Agilent 5 HCC18(2) 150×4.6 mm column. CsCHS protein-catalyzed analysis was performed on 4-coumaroyl-CoA, malonyl-CoA, and the standard naringenin. The chromatographic conditions were as follows: mobile phase: A phase - 0.1% formic acid water, B phase - acetonitrile; elution with 20%~25% B for 0-5 min, 25%~40% B for 5-15 min, 40%~50% B for 15-20 min, 50%~20% B for 20-22 min, and isocratic elution with 20% B for 22-30 min; detection wavelength: 288 nm; column temperature: 30℃; flow rate: 1.0 mL / min; injection volume: 10 μL. Chromatographic analysis was performed on the products of naringenin, CsCHS protein-catalyzed 4-coumaryl-CoA and malonyl-CoA according to the above conditions.

[0046] The liquid chromatogram of the standard naringenin control group is shown below. Figure 7 As shown, the retention time of naringenin was 2.821 min; Figure 8 As shown in (AC), the retention times of the products of 4-coumaroyl-CoA and malonyl-CoA catalyzed by the CsCHS1, CsCHS2, and CsCHS3 genes were 14.336 min, 14.348 min, and 14.328 min, respectively, which were basically consistent with the retention time of the characteristic peak of naringenin, which was 14.453 min. Figure 9 The liquid chromatograms of the products of 4-coumaroyl-CoA and malonyl-CoA catalyzed by the pET-28a empty carrier show that the pET-28a empty carrier catalyzed sample did not have a characteristic peak consistent with the retention time of naringenin around the retention time of 14.453 min.

[0047] Based on the above results, it can be inferred that pET-28a-CsCHS1, pET-28a-CsCHS2, and pET-28a-CsCHS3 can convert p-4-coumaryl-CoA and malonyl-CoA into naringenin. Therefore, it can be concluded that CsCHS1, CsCHS2, and CsCHS3 have the activity of converting 4-coumaryl-CoA and malonyl-CoA into naringenin.

[0048] Although the above embodiments have provided a detailed description of the present invention, they are only some embodiments of the present invention, and not all embodiments. People can obtain other embodiments based on these embodiments without creative effort, and these embodiments all fall within the protection scope of the present invention.

Claims

1. A type of Chaenomeles speciosa chalcone synthase gene CsCHS, characterized in that, The nucleotide sequence of the gene CsCHS is shown in SEQ ID NO.1, SEQ ID NO.2 and SEQ ID NO.

3.

2. A product encoded by the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 1, characterized in that, The amino acid sequences of the product are shown in SEQ ID NO.4, SEQ ID NO.5 and SEQ ID NO.

6.

3. The product encoded by the Chaenomeles speciosa chalcone synthase gene CsCHS according to claim 2, characterized in that, The product includes polypeptides or proteins.

4. The specific primers for cloning the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 1, characterized in that, When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.1, the specific primers are as shown in SEQ ID NO.7 and SEQ ID NO.8; When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.2, the specific primers are as shown in SEQ ID NO.9 and SEQ ID NO.10; When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.3, the specific primers are as shown in SEQ ID NO.11 and SEQ ID NO.

12.

5. A recombinant expression vector containing the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 1.

6. The recombinant expression vector according to claim 5, characterized in that, The recombinant expression vector uses the recombinant plasmid of the Chalcone Synthase gene CsCHS from Chaenomeles japonica as a template, and performs PCR amplification with BamHI as the restriction site of upstream and downstream primers. The PCR product is then ligated with pET-28a that has been digested with the same restriction enzyme. When the nucleotide sequence of the Chalcone synthase gene CsCHS of Chaenomeles speciosa is as shown in SEQ ID NO.1, the specific primer sequences for the BamHI restriction site are as shown in SEQ ID NO.13 and SEQ ID NO.

14. When the nucleotide sequence of the Chalcone synthase gene CsCHS of Chaenomeles speciosa is as shown in SEQ ID NO.2, the specific primer sequences for the BamHI restriction site are as shown in SEQ ID NO.15 and SEQ ID NO.

16. When the nucleotide sequence of the Chalcone synthase gene CsCHS from Chaenomeles speciosa is as shown in SEQ ID NO.3, the specific primer sequences for the BamHI restriction site are as shown in SEQ ID NO.17 and SEQ ID NO.

18.

7. Host cells containing the recombinant expression vector of the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 5.

8. The host cell for the recombinant expression vector of the Chaenomeles speciosa chalcone synthase gene CsCHS according to claim 7, characterized in that, The host cell is a BL21(DE3) chemocompetent cell.

9. The use of a product encoded by the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 1 or the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 2 in the catalytic production of naringenin using 4-coumaroyl-CoA and malonyl-CoA as substrates.

10. The use of a product encoded by the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 1 or the Chaenomeles speciosa chalcone synthase gene CsCHS as described in claim 2 in the preparation of flavonoids.