Gene for improving nitrogen metabolic capacity of crops in acid soil and application thereof
By applying the transcription factor OsART1 to activate nitrogen metabolism genes in rice, the problem of coordinated regulation of crop growth and nitrogen absorption metabolism in acidic soil was solved, improving nitrogen use efficiency and yield, and achieving high-efficiency crop growth in acidic soil.
Patent Information
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- CHINA NAT RICE RES INST
- Filing Date
- 2026-04-30
- Publication Date
- 2026-06-02
AI Technical Summary
Existing technologies lack a systematic analysis of the synergistic regulation of crop growth and nitrogen absorption and metabolism in acidic soils, resulting in low nitrogen fertilizer utilization efficiency, soil acidification and nutrient imbalance, which affect crop yield and environmental sustainability.
By utilizing the transcription factor OsART1 to regulate rice root development and nitrogen metabolism, and by activating the expression of nitrogen metabolism-related genes such as nitrate reductase OsNR2, the nitrogen use efficiency and yield of crops in acidic soils can be improved.
It significantly improved the nitrogen metabolism capacity and nitrogen use efficiency of rice in acidic soil, promoted root growth, increased grain yield, and solved the problem of synergistic regulation of crop growth and nitrogen absorption in acidic soil.
Smart Images

Figure CN122128355A_ABST
Abstract
Description
Technical Field
[0001] This invention belongs to the field of genetic engineering technology, specifically relating to genes that enhance the nitrogen metabolism capacity of crops in acidic soils and their applications. Background Technology
[0002] Acidic soils account for approximately 40-50% of the world's arable land. With the increasing intensity of agricultural production, the excessive application of nitrogen fertilizer has become the norm to ensure crop yields. However, the long-term overuse of nitrogen fertilizer not only significantly reduces nitrogen use efficiency (NUE) but also exacerbates soil acidification and nutrient imbalance, threatening global food security. Aluminum (Al) in acidic soils... 3+ The ions dissolve and form toxicity under low pH conditions, significantly inhibiting the elongation and development of plant roots, thereby limiting the absorption of water and nutrients (especially nitrogen) by crops. This creates a vicious cycle of "soil acidification - root damage - insufficient nutrient absorption - intensified fertilization - further acidification", becoming an important factor restricting the development of sustainable agriculture.
[0003] Improving nitrogen use efficiency in crops under acidic soil conditions is considered a key strategy for achieving green agricultural development. Nitrogen use efficiency is regulated by two main processes: nitrogen uptake and nitrogen assimilation, both of which are significantly influenced by root architecture and environmental conditions. Plant roots are highly plastic, capable of rapidly responding to nitrogen supply and acid / aluminum stress in the soil, optimizing nutrient uptake capacity by adjusting root development. Simultaneously, nitrogen metabolism processes are dynamically reconfigured according to external stress conditions. For example, drought or saline-alkali stress can significantly inhibit the expression of nitrate reductase genes, limiting nitrogen assimilation efficiency. Existing studies have shown that under acidic stress, the expression patterns of multiple nitrogen response pathways in rice also change significantly, suggesting that plants may have molecular mechanisms for reprogramming nitrogen metabolism in response to acidic stress.
[0004] Currently, several genes related to aluminum toxicity resistance and nitrogen metabolism have been identified in rice. For example, transcription factors... OsART1 (Aluminum Resistance Transcription Factor 1) has been shown to regulate multiple aluminum detoxification genes, promoting root growth in acidic soils; while OsDREB1C , OsGRF4 , OsGATA8 Several transcription factors have been reported to regulate nitrogen uptake and metabolism. However, most of these studies focus on single stress or metabolic pathways, and a systematic analysis of the "coordinated regulation mechanism of crop growth and nitrogen uptake metabolism in acidic soils" is still lacking.
[0005] Therefore, it is urgent to explore core factors that can integrate and regulate key pathways of root development and nitrogen metabolism in order to improve crop adaptability and yield performance in acidic soils, and provide a theoretical basis and breeding targets for crop genetic improvement and precision fertilization. Summary of the Invention
[0006] This invention provides genes that enhance crop nitrogen metabolism in acidic soils and their applications, wherein the transcription factor... OsART1 It can regulate crop growth and development, nitrogen absorption and assimilation, and adaptability to acidic soils, improve nitrogen use efficiency (NUE) and yield of crops in acidic soils, and promote green agricultural development and nitrogen fertilizer reduction.
[0007] This invention provides transcription factors OsART1 The application of the transcription factor in regulating nitrogen metabolism and nitrogen use efficiency in rice in acidic soils. OsART1 The encoded amino acid sequence is shown in SEQ ID No. 1.
[0008] In a preferred embodiment of the present invention, the transcription factor OsART1 Activating the expression of nitrogen metabolism-related genes enhances the nitrogen metabolism capacity and nitrogen use efficiency of rice in acidic soil.
[0009] In a preferred embodiment of the present invention, the nitrogen metabolism-related genes include nitrate reductase. OsNR2 .
[0010] This invention also provides a biomaterial for regulating nitrogen metabolism and nitrogen use efficiency in rice in acidic soil, wherein the biomaterial contains transcription factors. OsART1 or promote the transcription factor OsART1 Overexpression or repression of the transcription factor OsART1 The expression.
[0011] This invention also provides an overexpression transcription factor OsART1 The vector of the transcription factor OsART1 The encoded amino acid sequence is shown in SEQ ID No. 1.
[0012] In a preferred embodiment of the present invention, the transcription factor OsART1 The genome sequence is shown in SEQ ID No. 2.
[0013] The present invention also provides the application of the above-mentioned carrier in improving crop growth and nitrogen metabolism in acidic soils.
[0014] The present invention also provides a method for improving crop growth and nitrogen metabolism in acidic soils, comprising overexpressing transcription factors in the crop. OsART1 The transcription factor OsART1The genome sequence is shown in SEQ ID No. 2.
[0015] The present invention also provides the application of the above-mentioned biological materials or the above-mentioned carriers in crop breeding.
[0016] The present invention also provides a method for cultivating crops, comprising introducing the above-mentioned biological material or the above-mentioned vector into the genome of the target crop.
[0017] Beneficial Effects: This invention, by comparing transcriptome data of rice Zhonghua 11 (ZH11) grown in acidic and neutral soils, found that nitrogen metabolism gene expression was upregulated and nitrogen metabolism enzyme activity was enhanced in acidic soils, while aluminum detoxification genes were also upregulated simultaneously. Further analysis revealed zinc finger transcription factors. OsART1 It not only participates in regulating the aluminum toxicity response, but also integrates the regulation of key processes of nitrogen absorption and assimilation, making it a core regulatory factor connecting the adaptability of acidic soils with the coordination of nitrogen metabolism.
[0018] In one embodiment of the present invention, the transcription factor was demonstrated by creating gene-eliminating mutants and overexpressing transgenic lines. OsART1 By directly activating nitrogen metabolism genes such as nitrate reductase OsNR2 The expression of [a specific gene] synergistically enhances the nitrogen metabolism and nitrogen use efficiency of rice in acidic soils. Furthermore, when grown in acidic soils, compared to the wild-type (WT) Zhonghua11, the gene-eliminating mutant exhibited reduced root length and grain yield, along with significantly decreased nitrate uptake and nitrate reductase activity; compared to wild-type plants, [the expression of a specific gene] synergistically enhances the nitrogen metabolism and nitrogen use efficiency of rice in acidic soils. OsART1 Overexpression significantly increased nitrate reductase activity and nitrogen content in acidic soil, resulting in a marked increase in grain yield. This demonstrates the efficacy of the method described in this invention. OsART1 By enhancing nitrogen assimilation and promoting root growth, it has become a key regulatory factor affecting nitrogen utilization and yield formation in rice under acidic environments. Attached Figure Description
[0019] Figure 1 The figure shows the results of activating nitrogen metabolism in rice in acidic soil. Figure a: Heatmap of differentially expressed genes in rice roots in acidic and neutral soils; b: KEGG pathway analysis; c: nitrogen metabolism gene expression; d: nitrate reductase activity. Figure 2 This is a schematic diagram of the binary carrier pCAMBIA1300 of the present invention; Figure 3 For the wild-type rice of this invention and OsART1 Comparison of root length (a), nitrogen uptake (b), nitrate reductase activity (c), and yield (d) of gene mutants in acidic soil; Figure 4 The present invention provides OsART1 for direct binding to nitrate reductase. NR2 Promoters thus regulate their expression; Figure a: wild type and art1 In mutants NR2 b: Relative expression level; c: Schematic diagram of dual-luciferase reporter system vector construction; b: Validation of OsART1 with tobacco LUC. NR2 Promoter interaction, d: Dual-luciferase analysis of OsART1 and NR2 Promoter interaction; Figure 5 For the wild type and OsART1 A comparison of root length (a), nitrate reductase activity (b), nitrogen assimilation (c), and yield (d) of the overexpression material. Detailed Implementation
[0020] This invention provides transcription factors OsART1 The application of the transcription factor in regulating nitrogen metabolism and nitrogen use efficiency in rice in acidic soils. OsART1 The encoded amino acid sequence is shown in SEQ ID No. 1.
[0021] Transcription factors of this invention OsART1 To integrate the core factors that regulate key pathways of root development and nitrogen metabolism, it can be applied to crop growth and development, nitrogen absorption and assimilation, and adaptation to acidic soils, thereby improving the nitrogen use efficiency (NUE) and yield of crops in acidic soils.
[0022] More specifically, the transcription factors described in this invention OsART1 By activating the expression of nitrogen metabolism-related genes, the nitrogen metabolism capacity and nitrogen use efficiency of rice in acidic soil can be improved. These nitrogen metabolism-related genes include nitrate reductase. OsNR2 (Os02g0770800).
[0023] In this embodiment of the invention, by comparing and analyzing the transcriptome data of Zhonghua 11 (ZH11) rice grown in acidic soil (pH=4.2) and neutral soil (pH=6.5), it was found that nitrogen metabolism genes such as nitrate reductase are more abundant in acidic soil. OsNR2 Upregulation of expression enhances the activity of nitrogen metabolism enzymes, while aluminum detoxification genes such as citrate efflux proteins are also upregulated. OsFRDL4 It was also upregulated simultaneously. Further analysis revealed zinc finger transcription factors. OsART1 It not only participates in regulating the aluminum toxicity response, but also integrates the regulation of key processes of nitrogen absorption and assimilation, making it a core regulatory factor connecting the adaptability of acidic soils with the coordination of nitrogen metabolism.
[0024] In one embodiment of the present invention, gene elimination mutants and overexpression transgenic lines were created. Comparison revealed that... OsART1By directly activating nitrogen metabolism genes such as nitrate reductase OsNR2 The expression of [these elements] can synergistically enhance the nitrogen metabolism capacity and nitrogen use efficiency of rice in acidic soils.
[0025] In this invention, the transcription factor OsART1 Encoded amino acid sequence such as SEQ ID Shown in No.1: MDRDQMTNTMRDQAANLTSMNPLFYPFMADDALLGMAPPPPQQLLPSVSIQHMDWSPDTMLDNLTFIEEKIRQVKDVIRSMAGRRASSSSAATPEQQLVNADLTCLIVQLI STAGSLPSLKNSSFLSRTTPPPAAAAGAAQAVSLAAGESSSSARNNETNREDEEEQMGSPDYDELFKVWTNGGAMDECVGAAGDEQDARENPAAAAEEEKYEVLQLEEDEILAPHTH FCGICGKGFKRDANLRMHMRGHGDEYKSAAALAKPPPPPEGEEQPPQPERRYSCPHAGCKRNRMHASFQPLKTILCVKNHYKRSHCEKRHVCGRCGAKRFSVMADLKTHEKHCGRDRW LCSCGTSFSRKDKLFAHVALFQGHAPALPPPPPPPTSGRRRHKQEEPEFTWGGGGGNEFLDVKGIAGVGSGSGGGDEFFSAGSFGAMDFGFGQLDASLAMLLPSEQFAGDHQEENGDK
[0026] This invention also provides a biomaterial for regulating nitrogen metabolism and nitrogen use efficiency in rice in acidic soil, wherein the biomaterial contains transcription factors. OsART1 or promote the transcription factor OsART1 Expression, or repression of the transcription factor OsART1 The expression.
[0027] The transcription factor described in this invention is obtained by amplification. In one embodiment, the amplification is performed using cDNA obtained by reverse transcription of rice root RNA as a template, and the transcription factor with restriction enzyme sites at both ends is obtained by using the upstream primer shown in SEQ ID No. 4 and the downstream primer shown in SEQ ID No. 5.
[0028] SEQ ID No.4: 5'-ATGGATCGCGACCAGATGACG-3'; SEQ ID No. 5: 5'-TCACTTGTCACCATTCTCCTCC-3'.
[0029] In one embodiment of the present invention, the PCR amplification system, in 50 μL units, comprises: 25 μL of 2×PCR buffer for KOD FX, 10 μL of 2 mM dNTPs, 1.5 μL of 10 pmol 5' primer, 1.5 μL of 10 pmol 3' primer, 2 μL of cDNA, 1 μL of KOD FX enzyme, and the remainder ddH2O. The PCR amplification reaction program used is as follows: 94℃ pre-denaturation for 2 minutes; 98℃ denaturation for 10 seconds, 57℃ annealing for 30 seconds, 68℃ extension for 2 minutes, 35 cycles; 68℃ final extension for 5 minutes. Using the aforementioned PCR amplification system and program, the present invention can be obtained. OsART1 The CDS sequence is shown in SEQ ID No. 3.
[0030] The regulation described in this invention includes two aspects, one of which is overexpression of the... OsART1 Then, a system containing the transcription factor is constructed. OsART1 or promote the transcription factor OsART1 Overexpression vectors can improve the growth of rice and nitrogen uptake and utilization in acidic soils; on the other hand, to inhibit the expression vectors... OsART1 After the expression, or knock out the above. OsART1 Then, construct a structure that can suppress the above. OsART1Expressed siRNA, shRNA, and other lentiviral expression vectors, or sgRNA and gene editing vectors containing annealed sgRNA, such as CRISPR-Cas9 vectors, can significantly reduce rice growth and nitrogen uptake and utilization in acidic soils.
[0031] This invention also provides an overexpression transcription factor OsART1 The vector of the transcription factor OsART1 The encoded amino acid sequence is shown in SEQ ID No. 1.
[0032] In one embodiment of the present invention, the overexpression vector uses pCAMBIA1300 as the backbone vector, and the CDS sequence shown in SEQ ID No. 3 is inserted into the corresponding restriction sites KpnI and SalI of the backbone vector. Of course, other vectors containing the cauliflower mosaic virus constitutive promoter CaMV35S can also be used as the backbone vector.
[0033] The present invention also provides the application of the above-mentioned carrier in improving crop growth and nitrogen metabolism in acidic soils.
[0034] In one embodiment of the present invention, the overexpression vector is transferred into the target rice using a genetic transformation method, resulting in a difference between the overexpression vector and the wild-type plant. OsART1 Root growth was significantly promoted in the overexpression lines. Furthermore, real-time quantitative PCR (RT-qPCR) analysis showed that, compared to wild-type plants, OsART1 Overexpression significantly increased nitrate reductase (NR) activity and nitrogen content in acidic soils. In acidic field environments, OsART1 The overexpression-treated plants had a 30.6% higher grain yield than the wild-type plants. This indicates that... OsART1 By enhancing nitrogen assimilation and promoting root growth, it has become a key regulatory factor affecting nitrogen utilization and yield formation in rice under acidic environments.
[0035] The present invention also provides a method for improving crop growth and nitrogen metabolism in acidic soils, comprising overexpressing transcription factors in the crop. OsART1 The transcription factor OsART1 The genome sequence is shown in SEQ ID No. 2.
[0036] The present invention does not specifically limit the overexpression method. The overexpression vector can be transferred into the target rice using conventional rice genetic transformation systems in the field. For example, in one embodiment of the present invention, the genetic transformation is completed using Agrobacterium-mediated transformation.
[0037] The present invention also provides the application of the above-mentioned biological materials or the above-mentioned carriers in crop breeding.
[0038] In one embodiment of the present invention, the Cas9 method is used to target the transcription factor. OsART1 Gene knockout is performed to inhibit the transcription factor. OsART1 The expression.
[0039] The present invention also provides a method for cultivating crops, comprising introducing the above-mentioned biological material or the above-mentioned vector into the genome of the target crop.
[0040] In this invention, when the overexpressed transcription factor is transferred into the target rice... OsART1 After being placed in a vector, transcription factors can be significantly enhanced. OsART1 Expression in rice, and improvement of rice growth performance and nitrogen uptake and utilization in acidic soil; when the transcription factor is inhibited OsART1 The expression or knockout of the transcription factor OsART1 Afterwards, it can significantly reduce the growth performance of rice and its nitrogen absorption and utilization capacity in acidic soil, thereby constructing a rice model that can be applied to scientific research or other purposes.
[0041] To further illustrate the present invention, the following detailed description, in conjunction with embodiments, of the gene for improving crop nitrogen metabolism in acidic soil and its application, should not be construed as limiting the scope of protection of the present invention.
[0042] Example 1 1. Transcription factors OsART1 Cloning After surface disinfection, ZH11 rice seeds were germinated in ultrapure water at 30℃ for 2 days, then cultured under light for one week. Plants were then collected for RNA extraction, reverse transcription to synthesize cDNA, which was used as a template for gene cloning. Based on currently available... OsART1 Sequencing sequence (gene number Os12g0170400) was used to design upstream (SEQ ID No. 4) and downstream primers (SEQ ID No. 5).
[0043] Using rice root cDNA as a template, PCR amplification was performed using the primers described above to obtain the ART1 gene, which contains restriction enzyme sites at both ends. The preferred PCR amplification reaction program is as follows: 94℃ pre-denaturation for 2 minutes; 98℃ denaturation for 10 seconds, 57℃ annealing for 30 seconds, 68℃ extension for 2 minutes, 35 cycles; 68℃ final extension for 5 minutes.
[0044] The PCR amplification reaction system was as follows: 2×PCR buffer for KOD FX 25 μL, 2mM dNTPs 10 μL, 10pmol 5' primer 1.5 μL, 10pmol 3' primer 1.5 μL, cDNA 2 μL, KOD FX enzyme 1 μL, and ddH2O 9 μL.
[0045] The PCR amplification products were sequenced to obtain... OsART1 The CDS sequence (SEQ ID NO.3).
[0046] 2. Transcriptome analysis: Surface-sterilized seeds were soaked overnight in deionized water at 30℃. After germination culture for 5 days, they were transplanted into acidic or neutral soils for 24 hours of stress treatment. Total RNA was extracted from root tissues, and the samples were sent to Jiangsu Genewiz Biotechnology Co., Ltd., China, for library construction and transcriptome sequencing. The results are as follows: Figure 1 As shown, several previously reported key genes for aluminum detoxification were significantly upregulated, including OsFRDL4 , OsSTAR1 and OsSTAR2 This indicates that aluminum toxicity is one of the core stress factors in acidic soil environments. KEGG pathway enrichment analysis showed that nitrogen metabolism pathways are among the most significantly affected pathways in acidic soils. Consistent with this, under acidic soil conditions, key genes for nitrogen assimilation in rice showed synergistic upregulation, including nitrate reductase genes. OsNR1.1 , OsNR2 and nitrite reductase gene OsNiR ,in OsNR2 The upregulation was the highest, and the quantitative results were consistent with the transcriptome data. Notably, nitrate reductase (NR) activity in plants was simultaneously increased under acidic conditions. Given that several key aluminum detoxification genes are targets of the transcription factor OsART1, it is speculated that OsART1 may be involved in the regulation of nitrogen metabolism in acidic soils.
[0047] Example 2 1. Transient expression of tobacco: Will NR2The full-length promoter sequence of the gene was inserted into the modified reporter vector pGreen0800 II-LUC using a homologous recombination cloning kit (Novizan, Nanjing, China) (published in the article Ye, JY, Tian, WH, Zhang, DR et al. BRAHMA represses STOP1-NRT1.1 module to control plant rhizosphere alkalization and acid stress adaptation. Nat Commun 17, 3084 (2026). https: / / doi.org / 10.1038 / s41467-026-69905-z). The full-length protein-coding sequence of OsART1 (SEQ ID No. 3) was obtained by PCR amplification and ligated into the pCAMBIA1300 vector. The 35S:ART1 effector vector or the empty vector pCAMBIA1300 was then ligated into the proNR2:LUC reporter vector (which... NR2 The vectors obtained after the promoter was inserted into pGreen0800 II-LUC were co-transformed into tobacco leaves, with the empty vector pCAMBIA1300 serving as a negative control.
[0048] Following the manufacturer's instructions, the activities of firefly luciferase and renal luciferase were determined using a dual-luciferase assay kit (Beyotime Biotechnology, China). Renal luciferase (REN) was used as an internal control to correct for transformation efficiency. The relative expression level of LUC was quantified by calculating the activity ratio of firefly luciferase (LUC) to renal luciferase (REN), ultimately selecting two luciferases... OsART1 Overexpression (OE2 and OE5) lines.
[0049] Some infected leaves were treated with 1 mM luciferin (product number: A600577; Sangon Biotech, Shanghai, China) for 5 min under dark conditions, and then fluorescence signal was detected; fluorescence imaging was completed using a cold CCD imaging system (model: LB985; Bertohl GmbH, Germany).
[0050] Table 1 Primers
[0051] 2. Construction of rice overexpression lines The CDS sequence with restriction enzyme sites at both ends, amplified in Example 1, was ligated into the pMD19T vector, and then digested with KpnI and SalI. OsART1 The gene was cut from the pMD19T vector and ligated into the binary vector pCAMBIA1300 containing the CaMV35S promoter. The plasmid map of the constructed vector is shown below. Figure 2 As shown, it is named pOEART1.
[0052] The overexpression vector pOEART1 was transformed into the genome of ZH11 using Agrobacterium-mediated transformation, resulting in two overexpression lines, OE2 and OE5. RT-PCR analysis showed that, compared to wild-type ZH11, the overexpression lines exhibited significantly higher expression levels. OsART1 The expression levels of all of them were significantly upregulated.
[0053] Example 3 1. Construction of OsART1 gene knockout materials Purchased from Baige Biotechnology Co., Ltd. OsART1 The CRISPR / Cas9 knockout material (catalog number RS110291H08) was used to target the gene shown in SEQ ID No. 6: CATGGCGCCGAAGCTTCCCGCGG, resulting in knockout mutants with 23bp deletion and single-base deletion.
[0054] Experimental Example 1 The two selected in Example 2 OsART1 The overexpression (OE2 and OE5) lines and the knockout mutants obtained in Example 3 were subjected to the following tests: 1. Nitrate reductase (NR) activity assay: Nitrate reductase (NR) activity was determined using the Solarbio nitrate reductase (NR) activity assay kit (catalog number BC0085). Fresh plant tissues were collected and homogenized with a suitable extraction buffer. After centrifugation, the supernatant was used for enzyme activity assay. Nitrate reductase (NR) activity was calculated by measuring the amount of nitrite produced at a wavelength of 540 nm.
[0055] 2. Determination of nitrogen-15 isotope absorbance: After rice seedlings were cultured in acidic soil (pH=4.2) for two weeks, 0.05 g K was applied per kilogram of soil. 15 NO3 was used to treat seedlings for 2 days. To obtain pure root samples, soil adhering to the root surface was first removed; then, the roots were rinsed with sterile deionized water until no visible soil residue remained. The roots were then placed in a 50 mL centrifuge tube containing 35 mL of 0.1 mM CaSO4 solution and washed using a reciprocating shaker at 120 rpm for 3 min. Afterward, the roots were quickly rinsed twice with deionized water, each rinse lasting 5 seconds. Finally, the root samples were collected, dried at 80℃ for 3 days, and the NO3 content was determined using an isotope ratio mass spectrometer (model: Isoprime 100; Elymonter GmbH, Hanau, Germany). 15 N content.
[0056] 3. Determination of total nitrogen content: Plant samples were first blanched at 105 °C for 30 min, and then dried at 80 °C for 4 days. The dried samples were ground into a fine powder, and the total nitrogen content was determined by the Kjeldahl method.
[0057] The results are as follows Figure 3 As shown, when grown in acidic soil (pH=4.2), the root length and grain yield of the knockout mutants (ART1-cr1, ART1-cr2) were reduced by 47.81% and 24.3%, respectively, compared to the wild-type (WT) Zhonghua11. Furthermore, OsART1 The nitrate uptake rate and nitrate reductase activity of the gene-deleted plants were significantly lower than those of the wild type.
[0058] The results are as follows Figure 4 and Figure 5 As shown, compared to wild-type plants, OsART1 Root growth was significantly promoted in overexpression lines (OE2 and OE5). Furthermore, real-time quantitative PCR (RT-qPCR) analysis showed that, compared to wild-type plants, OsART1 Overexpression significantly increased nitrate reductase (NR) activity and nitrogen content in acidic soils. In acidic field environments, OsART1 The overexpressing plants had a 30.6% higher grain yield than the wild-type plants. This confirms that... OsART1 By enhancing nitrogen assimilation and promoting root growth, it has become a key regulatory factor affecting nitrogen utilization and yield formation in rice under acidic environments.
[0059] Although the above embodiments have provided a detailed description of the present invention, they are only some embodiments of the present invention, and not all embodiments. People can obtain other embodiments based on these embodiments without creative effort, and these embodiments all fall within the protection scope of the present invention.
Claims
1. Transcription factors OsART1 Its application in regulating rice growth and nitrogen metabolism in acidic soils is characterized by, The transcription factor OsART1 The encoded amino acid sequence is shown in SEQ ID No.
1.
2. The application according to claim 1, characterized in that, The transcription factor OsART1 Activating the expression of nitrogen metabolism-related genes enhances the nitrogen metabolism capacity and nitrogen use efficiency of rice in acidic soil.
3. The application according to claim 2, characterized in that, The nitrogen metabolism-related genes include nitrate reductase. OsNR2 .
4. A biomaterial for regulating nitrogen metabolism and nitrogen use efficiency in rice grown in acidic soil, characterized in that, The biomaterial contains transcription factors. OsART1 or promote the transcription factor OsART1 Overexpression or repression of the transcription factor OsART1 The expression.
5. An overexpressed transcription factor OsART1 The carrier, characterized in that, The transcription factor OsART1 The encoded amino acid sequence is shown in SEQ ID No.
1.
6. The carrier according to claim 5, characterized in that, The transcription factor OsART1 The genome sequence is shown in SEQ ID No.
2.
7. The use of the carrier according to claim 5 or 6 in improving crop growth and nitrogen metabolism in acidic soils.
8. A method for improving crop growth and nitrogen metabolism in acidic soils, characterized in that, Including overexpression of transcription factors in the crop OsART1 The transcription factor OsART1 The genome sequence is shown in SEQ ID No.
2.
9. The application of the biomaterial of claim 4 or the carrier of claim 5 or 6 in crop breeding.
10. A method for cultivating a crop, characterized in that, This includes introducing the biomaterial of claim 4 or the vector of claim 5 or 6 into the genome of the target crop.