ANTI-PSMA ANTIBODIES AND THEIR USE

DE602017092969T2Active Publication Date: 2025-12-03ORIMABS LTD
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
DE602017092969
Authority / Receiving Office
DE · DE
Patent Type
Patents
Current Assignee / Owner
Priority Date
2016-04-13
Filing Date
2017-04-12
Publication Date
2025-12-03
Estimated Expiration
2037-04-12

AI Technical Summary

Technical Problem

Current treatments for prostate cancer, such as surgery, radiotherapy, and androgen deprivation therapy, have limited effectiveness for late-stage cancers, and there is a lack of PSMA-targeted antibodies for precision medicine.

Method used

Development of antibody fragments, such as scFv and full-length antibodies, that specifically bind to the extracellular domain of PSMA, enabling compositions like antibody-drug conjugates, bispecific antibodies, and chimeric antigen receptors for targeted cancer treatment and imaging.

Benefits of technology

These compositions enhance the diagnosis and treatment of prostate cancer and other solid tumors by specifically targeting PSMA, improving treatment outcomes and reducing side effects through targeted toxicity delivery and immune cell activation.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader
Need to check novelty before this filing date? Find Prior Art

Description

BACKGROUND OF THE INVENTION

[0001] It has been shown that 14% males have been diagnosed with prostate cancer at in their life span; and as many as 2.8 million prostate cancers have been diagnosed in 2012 with a mortality rate of 21.4 per 100 thousand people. However, the current approaches, such as surgery, radiotherapy, chemotherapy, and androgen deprivation therapy, have limited effect for those late stage cancers. Thus far, radical surgery is still the major treatment of prostate cancer. Therefore, the emerging precision medicine, especially the ones based on tumor targeting antibodies, is expected to improve the outcome of prostate treatment.

[0002] Prostate specific membrane antigen (PSMA) has been confirmed as a specific marker for prostate epithelial cells (Horoszewicz, J.S. et al. (1987) Anticancer Res, 7(5B): 927-35; Israeli, R.S., et al. (1993) Cancer Res, 53(2): 227-30; Israeli, R.S., et al. (1994) Cancer Res, 54(7): 1807-11; Wright, G.L., Jr., et al. (1995) Urol Oncol, 1(1): 18-28; Troyer, J.K. et al. (1995) Int J Cancer, 62(5): 552-8; Sokoloff, R.L., et al. (2000) Prostate, 43(2): 150-7), which laid the foundation for development of prostate cancer targeted precision medicine. Histological study indicated that almost all prostate cancers express PSMA (Bostwick, D.G., et al. (1998) Cancer, 82(11): 2256-61; Kusumi, T., et al. (2008) Pathol Int, 58(11): 687-94; Mannweiler, S., et al. (2009) Pathol Oncol Res, 15(2): 167-72; Ananias, H.J., et al. (2009) Prostate, 69(10): 1101-8) and cancers with higher malignancy, or metastasis, or resistant to androgen deprivation therapy, usually express much higher PSMA (Ananias, H.J., et al. (2009) Prostate, 69(10): 1101-8; Wright, G.L., Jr., et al. (1995) Urol Oncol, 1(1): 18-28; Wright, G.L., Jr., et al. (1996) Urology, 48(2): 326-34; Sweat, S.D., et al. (1998) Urology, 52(4): 637-40). Although PSMA was thought to be a prostate-specific marker, later studies have indicated that intestine cells, renal proximal tubule and salivary gland also express low level PSMA (Troyer, J.K. et al. (1995) Int J Cancer, 62(5): 552-8). It is of note that the PSMA expression levels in normal tissues are 100-1000 times lower than in tumor (Sokoloff, R.L., et al. (2000) Prostate, 43(2): 150-7) and these normal tissues are usually not easily accessible to circulating antibodies (Troyer, J.K. et al. (1995) Int J Cancer, 62(5): 552-8), which further assured the safety of PSMA targeted imaging and therapy.

[0003] PSMA is a glutamate carboxypeptidase (Pinto, J.T., et al. (1996) Clin Cancer Res, 2(9): 1445-51) and its function in prostate cancer is unclear. However, it is revealed that high PSMA expression is related to high infiltration of cancer. Therefore, PSMA targeted imaging and therapies will considerably improve the diagnosis and treatment outcome of prostate cancers. In addition to prostate, PSMA is also highly expressed in neovasculature in many solid tumors while is absent in normal vessels (Sokoloff, R.L., et al. (2000) Prostate, 43(2): 150-7). Therefore, PSMA is an ideal marker not only for prostate cancer, but also for neovasculature targeted therapy for other solid tumors.

[0004] Antibodies are the most efficient tool for tumor targeting in that they can specifically recognize tumor-related or tumor-specific antigens expressed on tumor cells, which opens avenues for antibody based precision medicine, including tumor targeted imaging and therapy, such as optical, PET, SPECT, or MRI imaging for early tumor detection, antibody drug conjugate, and radiotherapy, chimeric antigen receptor T cell or NK cell therapies for cancer treatment. Unfortunately, there are no PSMA antibodies currently on the market.

[0005] Kiess et al, QJ Nucl Med Mol Imaging, 2015, 59(3):241-268 discloses the use of anti-PSMA antibodies as a target for cancer imaging and therapy.

[0006] There is a still need in the art for compositions and methods targeting PSMA for the treatment of cancer. The present invention satisfies this unmet need.

[0007] The invention is defined by the claims and any other aspects, configurations, instances or embodiments set forth herein not falling within the scope of the claims are for information only. Any references in the description to methods of treatment (or diagnosis) refer to the compounds, pharmaceutical compositions and medicaments of the present invention for use in a method of treatment of the human (or animal) body by therapy (or for diagnosis).BRIEF DESCRIPTION OF THE DRAWINGS

[0008] The following detailed description of preferred embodiments of the invention will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, there are shown in the drawings embodiments which are presently preferred. It should be understood, however, that the invention is not limited to the precise arrangements and instrumentalities of the embodiments shown in the drawings. Figure 1 is a graph demonstrating that gy1 scFv specifically binds PSMA+ cells. ScFv gy1 binding on PSMA was studied on LNCap FGC cells using flow cytometry. Briefly, LNCap FGC cells were detached with versene solution, washed with PBS and incubated on ice for 1 hour with gy1-containing yeast supernatant that was diluted 3-fold with FACS buffer. Cells were washed three time with cold PBS and then incubated with 1: 200 diluted anti-V5-Alexa647 in FACS buffer on ice for 1 hour in darkness. Non-bound anti-V5-Alexa647 was removed by three time washes with cold PBS and then cells were resuspended in 300 µl FACS containing 8µl via-probe (BD biosciences). Gy1 binding on LNCap FGC cells were detected using flow cytometry where only living cells were gated and analyzed. Flow cytometry controls include: (1) unstained cells; and (2) cells stained with anti-V5-Alexa647. Solid gray line represents unstained cells; dotted black line represents anti-V5-Alexa647 stained cells; while solid black line represents cells stained with gy1 scFv and then anti-V5-Alexa647. Figure 2 depicts the results of experiments demonstrating that gy1 scFv was significant internalized upon antigen binding on LnCap cells. LnCap FGC cells were seeded in two 48 well plates. The next day, 100 µl gy1 scFv containing yeast supernatant was pre-incubated with 4 µl anti-V5-Alexa467 in 200 µl volume (100 µl supernatant plus 100 µl cell medium) at room temperature for 1 hour. Then cells were washed once with medium and incubated with the 200 µl gy1 containing medium (100 µl fresh medium plus 100 µl preincubated gy1-dye medium) at 37 °C and 4 °C respectively for 1 hour in darkness. As controls, cells were also incubated with same concentrated anti-V5-Alexa467 for the both temperatures. After two washes with cold PBS, 200 µl trypsin was added into wells to digest cell surface proteins for 30 min at RT. Then 500 µl medium was added to each well to stop trypsinization and cells were washed twice and then suspended in via-probe containing FACS buffer for flow cytometry analysis. Left panel represent 4 °C incubated cells and the right panel represent the 37 °C incubated cells. Solid gray line represents cells incubated with only plain medium; dotted black line represents cells incubated with anti-V5-Alexa647; while solid black line represents cells incubated with pre-formed gy1-anti-V5-Alexa647 complex. Figure 3 depicts the results of experiments measuring affinity for gy1 scFv. Gy1 scFv affinity was measured using capture ELISA. Briefly, anti-Flag antibody (Sigma) was coated on ELISA plate at 4 °C overnight in PBS. Plates were washed and blocked with PBSTM and incubated with triplicate 3-fold serially diluted gy1 scFv. Plate was then washed and incubated with biotinylated PSMA and the binding was detected with streptavidin-HRP, and analyzed by colorimetric development using TMB and then stop buffer. Absorbance at OD450 was measured and the affinity was calculated using GraphPad Prism software. Figure 4, comprising Figure 4A through Figure 4C, depicts the results of experiments of gy1 scFv expression in E.coli. The gy1 scFv was expressed in E. coli BL21 using vector pET302 induced with 0.05 mM IPTG for 4 h at 30 °C. E.coli cells were lysed using sonicator and gy1 protein was purified using HisTrp HP column. Figure 4A: SDS-PAGE shows soluble gy1 expression in induced E.coli. Lane 1: Marker; Lane 2: uninduced whole cell lysis; Lane 3 - 5: induced cell lysis, whole cell (3), supernatant (4) and precipitation (5). Figure 4B: SDS-PAGE shows purified gy1 protein. Lane 1: Marker; Lane 2: uninduced supernatant of cell lysis; Lane 3: induced supernatant of cell lysis; and Lane 4: purified gy1 scFv. Figure 4C: Western blot analysis confirms the purified gy1 recombinant protein by anti-His6 Ab. Lane 1: uninduced supernatant of cell lysis; Lane 2: induced supernatant of cell lysis; and Lane 3: purified gy1 scFv. Figure 5 depicts the results of experiments demonstrating that E.coli expressed gy1 scFv binds specifically on PSMA+ cells. Binding of E.coli expressed gy1 scFv to PMSA positive and negative cells were studied using flow cytometry. Prostate cancer cells, LNCaP, C4-2, PC3-PSMA+ and PC3-PSMA- cells were detached with Versene solution and incubated with 100 nM gy1 or control scFv NCP1 at 4°C for 30min, followed by washing and incubation with FITC-conjugated mouse anti-6His IgG (AbD Serotec; Bio-Rad) for 30 min at 4°C in darkness. Cells were then washed and analyzed by flow cytometry. In parallel, PSMA protein expression was detected by a PE conjugated commerial anti-PSMA monoclonal antibody. Figure 6 depicts the results of experiments reassuring the affinity of E.coli expressed gy1 scFv by cell ELISA. Affinity of E.coli expressed gy1 scFv was measured on PSMA positive cell line C4-2. Briefly, C4-2 cultured in 96-well plate were fixed with 4% paraformaldehyde, blocked with 3% H 2 O 2 and 6% bovine serum albumin sequentially. Cells were then incubated with three-fold serially diluted gy1 and the control scFv NCP1, from 8100 nM down to 0.005 nM, for 1h at 37 °C. Cell binding was detected with HRP-conjugated mouse anti-6His and colorimetric signals were developed by TMB and stopped by STOP buffer. The absorbance at 450 nm was used to calculate gy1 affinity using GraphPad Prism 5.0 software. Figure 7 depicts the results of experiments demonstrating that gy1 scFv is capable of being internalized upon antigen binding. Gy1 internalization upon antigen binding was studied on prostate cancer cells, i.e., LnCap, C4-2, PC3-PSMA+, and PC3-PSMA-. Cells grown on coverslips at 50% confluence were incubated with 200 nM gy1 or NCP1 for 2 hours at 37°C. Cells were washed, fixed with 4% paraformaldehyde and internalized gy1 was detected by FITC-conjugated mouse anti-6His IgG. Nuclei was stained with DAPI. Internalization was observed under confocal imaging system. Figure 8, comprising Figure 8A and Figure 8B, depicts the results of experiments visualizing intracellular trafficking of gy1. Figure 8A: C4-2 cells were incubated with gy1 scFv for 4 h and then detected with anti-6His IgG and FITC-conjugated secondary antibody. Different cellular organelle markers (RFP-labeled, red) for endosome, lysosome, ER and Golgi apparatus and DAPI (blue) were used to co-stain the organelles and nucleus. Figure 8B:Co-localization of gy1 and markers for Golgi apparatus and ER were further studied for different period of incubation times of 1 hour, 2 hours, 4 hours and 6 hours. Figure 9 depicts results of validation experiments using PC3-PSMA+ / PC3-PSMA-mouse model. PSMA positive and negative xenograft nude mouse models were established using luciferase-expressing PC3-PSMA+ and PC3-PSMA- cells. The xenograft tumor models were developed by injecting 5×10 6< firefly luciferase-expressing PC3-PSMA+ or PC3-PSMA- cells in 0.1 mL PBS subcutaneously in the right hip of each mouse. Two weeks after inoculation, tumor tissue was isolated and H&E and immunohistochemistry staining were performed to check the tissue morphology and PSMA expression level. Figure 10 depicts the results of experiments demonstrating that IRDye800cw labeling does not compromise PSMA binding of gy1. The binding affinity of infrared dye IRDye800cw labeled gy1 scFv was evaluated on PC3-PSMA +< cells using unlabeled gy1 as a positive control. The result indicated that dye labeling did not compromise PSMA binding of gy1. Figure 11 depicts the results of experiments evaluating the dynamic biodistribution of gy1 scFv in prostate tumor models. Dynamic distribution of gy1 scFv in PC3-PSMA +< / PC3-PSMA -< xenograft nude mice was studied using Xenogen IVIS Kinetic imaging system at an excitation wavelength of 745 nm post tail-vein injection of 0.2 µmol / kg IRDye800cw-labeled gy1 scFv. Bioluminescence imaging (BLI) was acquired to identify the prostate tumor tissues (Left). The distribution of IRDye800cw-labeled gy1 was monitored at indicated time points in the same mouse of each group. Representative result was shown. Figure 12 depicts the in vivo PSMA targeting of gy1 scFv. At 6 hours post injection, gy1 scFv shows the best tumor localization signals. Shown here are two groups of mice with PSMA positive or negative tumors. Figure 13, comprising Figure 13A and Figure 13B, depicts the results of experiments evaluating gy1 scFv biodistribution in mouse organs 12 hours post intravenous injection. Figure 13A: Twelve hours post injection, mice were sacrificed and tissue and organs were harvested. Biodistribution of IRDye800cw-labeled gy1 in different mouse organs were analyzed using Xenogen IVIS Kinetic imaging system. 1, brain; 2, lung; 3, heart; 4, liver; 5, spleen; 6, kidney; 7, small intestine; 8, bone; 9, PC3-PSMA +< or PC3-PSMA -< tumor tissue; 10, muscle. Figure 13B: Fluorescence quantification of different organs were studied using the IRDye800cw signal intensity in tumor and different organs measured by IVIS software. Bar, mean values; Error bar, SD; n =5; **P < 0.01. Figure 14, comprising Figure 14A and Figure 14B, depicts the results of experiments measuring PSMAb expression and affinity. Figure 14A: SDS-GAGE of purified PSMAb. Lane 1: CHO cell supernatant before antibody purification; Lane 2: denatured purified PSMAb; and Lane 3: non-denatured purified PSMAb. Figure 14B: Affinity measurement of PSMAb. PSMAb affinity was measured on PSMA positive cell line C4-2. Briefly, C4-2 cultured in 96-well plate were fixed with 4% paraformaldehyde, blocked with 3% H 2 O 2 and 6% bovine serum albumin sequentially. Cells were then incubated with three-fold serially diluted PSMAb, from 100 nM down to 0.19 pM, for 1h at 37 °C. Cell binding was detected with HRP-conjugated mouse anti-human IgG Fc Ab and Colorimetric signals were developed by TMB and stopped by STOP buffer. The absorbance at 450 nm was used to calculate affinity using GraphPad Prism 5.0 software. Figure 15 depicts the results of experiments demonstrating that PSMAb binds specifically on PSMA+ cell lines. Binding of PSMAb on PSMA positive and negative cells were studied using flow cytometry. upper row: negative control IgG (gray); PSMAb (black); lower row: negative control IgG (gray); positive control antibody LNI-17 (black). Figure 16 depicts the results of experiments demonstrating that PSMAb binding on PC3-PSMA+ cells is blocked by recombinant PSMA protein. PSMAb at concentration of 2 nM was preincubated respectively with 0, 2, 6 and 10 nM recombinant PSMA, or 10 nM control protein BSA at RT for 2 hours and the then incubated with PC3-PSMA+ cells. Blocking effect on PSMAb binding on PC3-PSMA+ cells were studied by flow cytometry. Negative control: gray solid line; PSMAb 2 nM : black solid line; PSMAb 2 nM blocked by 10 nM BSA: gray broken line; PSMAb 2 nM blocked by 2 nM PSMA: black dot line; PSMAb 2 nM blocked by 6 nM PSMA: black broken line; PSMAb 2 nM blocked by 10 nM PSMA: gray dot line. Figure 17, comprising Figure 17A through Figure 17D, depicts the results of experiments examining PSMA specific internalization of PSMAb. PSMAb internalization was studied on prostate cancer cells, i.e., C4-2 (Figure 17A), PC-3 (Figure 17B), LnCap (Figure 17C), and DU-145 (Figure 17D) cells. Cells grown on coverslips at 50% confluence were incubated with 200 nM PSMAb or a control human IgG1 for 2 hours at 37°C. Cells were washed, fixed with 4% paraformaldehyde and internalized PSMAb was detected by FITC conjugated anti-human IgG Fc antibody. Nuclei were stained with DAPI. Internalization was observed under confocal imaging system. Figure 18, comprising Figure 18A through Figure 18C, depicts the results of experiments investigating in vivo PSMA targeting by PSMAb. The efficiency of tumor targeting and the potential for intraoperative optical imaging of PSMAb was studied using IRDye800CW labeled PSMAb. 50 µg labeled PSMAb / mouse was tail-vein injected into PC3-PSMA+ (Figure 18A) or PC3-PSMA- (Figure 18B) xenograft model and the biodistribution of PSMAb at 4 hours, 24 hours, 30 hours, 48 hours, 54 hours, 102 hours, 126 hours and 174 hours was monitored using Xenogen IVIS Kinetic imaging system. Images of 4 mice in each group 48 hours post-injection were shown in Figure 18C. In vivo optical imaging showed that PSMAb diffused rapidly throughout the whole body and can be detected in tumor tissues from 24 hours post-injection, and was then gradually cleared from body while specifically retained at PSMA+ tumor, but not PSMA- tumor Figure 19 is a schematic depicting SMCC-DM1. Figure 20 is a set of schematic drawings depicting MC-VC-PAB-MMAE and MC-VC-PAB-MMAE. Figure 21 depicts the results of experiments demonstrating that PSMAb-ADC remains efficient binding on PSMA+ cells. PSMA specific binding of PSMAb conjugate with DM1, MMAE or MMAF was studied on PC-3 (upper) and C4-2 cells (lower) using flow cytometry. Figure 22, comprising Figure 22A and Figure 22B, depicts the results of experiments demonstrating that PSMAb-ADC is efficiently taken up by PSMA+ cells. PSMA specific internalization of PSMAb conjugate with DM1 was studied on PC-3 (Figure 22A) and C4-2 cells (Figure 22B). Cells grown on coverslips at 50% confluence were incubated with 200 nM PSMAb-ADC or a control human IgG1-ADC for 2 h at 37°C. Cells were washed, fixed with 4% paraformaldehyde and internalized PSMAb was detected by FITC conjugated anti-human IgG Fc antibody. Nuclei were stained with DAPI. Internalization was observed under confocal imaging system. Figure 23, comprising Figure 23A through Figure 23C, depicts the results of experiments evaluating PSMA specific cytotoxicity of PSMAb ADC. Cytotoxicity of PSMAb based ADCs were evaluated on PSMA- cell line PC-3 and PSMA+ cell line C4-2. Briefly, C4-2 and PC-3 cells were seeded in 96 well plates in DMEM medium with 10% FBS, 2000 cells / 200 mL / well. The next day, cell density was around 20-30% and medium was changed to fresh medium containing PSMAb-DM1, PSMAb-MMAE or PSMAb-MMAF at the concentrations of 333.33 nM, 133.33 nM, 66.67 nM, 33.33 nM, 6.67 nM, 3.33 nM, 0.67 nM, 0.33 nM, 0.067 nM, 0.0067 nM, 0.00067 nM and 0.000067 nM with triplications of each concentration. Medium was changed daily with the same drug concentrations for each well. After 4 day incubation, cell viability was evaluated using alamarBlue kit following manufacture's protocol. IC50 calculated for PSMAb-DM1 (Figure 23A) , PSMAb-MMAE (Figure 23B) and PSMAb-MMAF (Figure 23C) on C4-2 cells was 0.12 nM, 0.59 nM and 0.92 nM respectively. Figure 24, comprising Figure 24A through Figure 24R, depicts the results of experiments demonstrating that PSMAb ADC induces apoptosis specifically on PSMA positive cells. PC-3 and C4-2 cells were seeded in 6 well plates at the density of 2×10 5< / 2 ml medium / well and cultured overnight. The next day, medium was changed and cells were incubated with PSMAb-ADC at the concentrations of 50 µg / ml, 20 µg / ml, 10 µg / ml, 5 µg / ml, 1 µg / ml, 0.5 µg / ml, 0.01 µg / ml, and 0.001 µg / ml in 2 ml medium. Human IgG and PSMAb at the concentration of 50 mg / ml were used as controls. After 48 hour incubation, cells were trypsinized and washed twice with PBS, and stained with Annexin-V / PI and apoptosis was detected using flow cytometry. Signals with Annexin- V(+) / PI (-) indicates early apoptosis and double positive staining, i.e., Annexin- V(+) / PI (+), indicates late apoptosis. Total apoptosis is the sum of early and late apoptosis. Results of PSMAb-DM1 (Figure 24A - Figure 24F), PSMAb-MMAE (Figure 24G Figure 24L), and PSMAb-MMAF (Figure 24M - Figure 24R) on C4-2 (Figure 24A -Figure 24C, Figure 24G - Figure 24I, Figure 24M - Figure 24O) and PC-3 (Figure 24D - Figure 24F, Figure 24J - Figure 24L, Figure 24P - Figure 24R) cells were shown in flow cytometry data (Figure 24A, Figure 24D, Figure 24G, Figure 24J, Figure 24M, and Figure 24P) and calculated percentages of total (Figure 24B, Figure 24E, Figure 24H, Figure 24K, Figure 24N, and Figure 24Q) and early apoptosis (Figure 24C, Figure 24F, Figure 24I, Figure 24L, Figure 24O and Figure 24R). Figure 25, comprising Figure 25A through Figure 25D, depicts various configurations of a bispecific antibody. DETAILED DESCRIPTION

[0009] The present invention is related to compositions for use in treating cancer. The present invention is based in part upon the discovery of antibody fragments that specifically bind to extracellular domain of PSMA. The present invention thus provides compositions comprising an antibody or antibody fragment that binds to PSMA. It is also described compositions that include an antibody, antibody fragment, bispecific antibody, an antibody-drug conjugate, a PSMA-targeting imaging agent, chimeric antigen receptor, a cell expressing a chimeric antigen receptor, and the like.Definitions

[0010] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.

[0011] As used herein, each of the following terms has the meaning associated with it in this section.

[0012] The articles "a" and "an" are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an element" means one element or more than one element.

[0013] "About" as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20%, ±10%, ±5%, ±1%, or ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.Description

[0014] The present invention provides compositions for use in methods for treating and preventing cancer. The composition comprises an antibody or antibody fragment that specifically binds to the extracellular domain of PSMA as defined in the appended claims, namely wherein the antibody or antigen-binding fragment comprises a light chain region and a heavy chain region that comprise the respective sequences of SEQ ID NOs: 5 and 21, or wherein the antibody or antigen-binding fragment comprises (i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 68 and a light chain comprising the amino acid sequence of SEQ ID NO: 69, or (ii) a heavy chain comprising the amino acid sequence of SEQ ID NO: 53 and a light chain comprising the amino acid sequence of SEQ ID NO: 61.

[0015] The present invention is based upon the discovery of antibody fragments that bind to PSMA. The fragments were identified in yeast-display system expressing an antibody library. As described herein, the antibody fragments provided herein are used to formulate therapeutic and diagnostic compositions that target PSMA found in prostate cancer and in the neovasculature of other solid tumors. In one embodiment, the composition is an antibody-drug conjugate (ADC), wherein the antibody or antibody fragment targets the drug to the tumor location. In one embodiment, the composition is a bispecific antibody, wherein the bispecific antibody comprise the antibody or antibody fragment that specifically binds to PSMA and a second antibody or antibody fragment that binds to a T-cell antigen, (e.g. CD3). In one embodiment, the composition is a chimeric antigen receptor that comprises the antibody or antibody fragment that specifically binds to PSMA. In one embodiment, the invention comprises an isolated nucleic acid encoding an antibody or antibody fragment, bispecific antibody, or chimeric antigen receptor. In one embodiment, the invention comprises a cell that is modified to express an antibody or antibody fragment, bispecific antibody, or chimeric antigen receptor.

[0016] The compositions described herein are useful in a method for treatingprostate cancer. In certain aspects, the method comprises administering to a subject an effective amount of a composition comprising an antibody or antibody fragment that specifically binds to PSMA. For example, in one aspect, the method comprises administering to the subject an antibody or antibody fragment, bispecific antibody, or chimeric antigen receptor. In one aspect, the method comprises administering to a subject an effective amount of a composition comprising an isolated nucleic acid encoding an antibody or antibody fragment, bispecific antibody, or chimeric antigen receptor. In one aspect, the method comprises administering to a subject a cell modified to express an antibody or antibody fragment, bispecific antibody, or chimeric antigen receptor.Compositions

[0017] As described herein, the present disclosure provides a composition comprising an antibody or antibody fragment that specifically binds to PSMA as defined in the appended claims. The present invention is based upon the construction of a large yeast display human scFv library and isolation of a high affinity anti-PSMA scFv. The affinity of the isolated scFv to PSMA was measured to be 9×10 -10< nM. Further, several mutations of the scFv were generated which increased its functionality. The conversion of an scFv to a full-length antibody increased its affinity to 1×10 -10< nM

[0018] Hybridoma technology is well developed traditional way for monoclonal antibody preparation. However, the murine origin of the antibody greatly impedes its application in human beings. Although humanization could partially reduce the immunogenicity of murine antibodies and humanized antibodies are widely used currently in clinic, the immunogenicity related side effects still raise in around 50% patients because humanization could never reach 100% because certain level of murine amino acids need to be remained to keep the antigen binding activity for the antibodies. J591, with an affinity around 3 nM, is a humanized PSMA antibody that has been widely used in research and some clinical trials (McDevitt, M.R., et al. (2000) Cancer Res, 60(21): 6095-100). Therefore, fully human antibodies are the most desirable ones for clinical applications.

[0019] Transgenic mice humab-mouse and xenomouse have been developed by Medarex / GenPharm International and Abgenix for development of fully human antibodies via traditionally hybridoma method. PSMA Development Company, LLC (Progenics Pharmaceuticals, Inc.) has used xenomouse to develop four fully human anti-PSMA antibodies with affinities of 1×10 -9< nM, 7.9×10 -10< nM, 5.1×10 -10< nM, and 2.1×10 -10< nM respectively (U.S. Pat. No. 8,470,330).

[0020] Compared to the transgenic mice, an antibody library is a more convenient and equally efficient for fully human antibody preparation. The rationale is to isolate peripheral blood mononuclear cells (PBMC) from healthy or particular donors, extract mRNA and amplify variable regions of antibody, assemble into single chain antibody (scFv) or Fab format and display on phage or yeast surface via molecular biological strategies. The advantage of the antibody library is that as long as the library size is large enough, high affinity antibodies could be readily isolated. If the library is constructed from human B cells, the derived antibody will be 100% human origin and will not have immunogenicity issues for clinical applications.

[0021] Due to the complicated conformation and structure that has 4 inter chain disulfide bonds, a full-length antibody is difficult to be expressed by E.coli or yeast. Therefore, the most often displayed antibody format are scFv and Fab. scFv contains only the variable regions of heavy and light chain, while Fab also contain the light chain constant region and the first constant region of heavy chain. In certain instances, compared to the small antibody fragments, such as Fv, scFv, Fab or scFv-Fc, a full-length antibody has the most stable structure, longest circulation time, highest affinity, best tolerance to labeling or modification, and could mediate antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cellular cytotoxicity (ADCC). Full-length antibodies are therefore is the most popular format in clinic.

[0022] The strategy for using an antibody library is to first discover the antibody fragment, such as scFv or Fab, then convert them into full-length antibody. Although many scFv or Fab could be successfully converted to a full-length antibody without compromising function, some fragment antibodies will lose their affinity once converted to full-length antibody(Schirrmann, T., et al. Molecules, (2011) 16(1): 412-26; Baker, K.P., et al. (2003) Arthritis Rheum, 48(11): 3253-65; Thie, H., et al. (2011) PLoS One, 6(1): e15921), which might be due to the conformation change of binding site as a result of the addition of constant regions. In terms of the scFv, the inter chain linker may contribute to the antigen binding confirmation in some scFvs, which will be removed when being converted into full-length antibody and therefore impairs the antigen binding affinity. A high affinity scFv or Fab therefore may not ensure a high affinity full antibody derivative. Each conversion should be deemed as a unique case and need to be confirmed by experiments.

[0023] In one embodiment, the present invention provides a composition comprising an antibody drug conjugate (ADC). ADCs are a platform strategy to arm antibodies for antigen specific toxicity delivery. The rationale is to conjugate antibodies, usually tumor targeting antibodies, with super toxic drugs to selectively kill tumor cells in a targeted manner while normal tissue be spared. Drugs used in ADC mainly fall into two types, one is microtubulin inhibitor, such as auristatin (MMAE, MMAF) (Stephan, J.P., et al. (2008) Bioconjug Chem, 19(8): 1673-83; Younes, A., et al. (2010) N Engl J Med, 363(19): 1812-21; Okeley, N.M., et al. (2010) Clin Cancer Res, 16(3): 888-970) and maytansinoid (DM1 and DM4) (Lambert, J.M. et al. (2014). J Med Chem, 57(16): 6949-64; Bender, B., et al. (2014) AAPS J, 16(5): 994-1008; Raufi, A., A.S. Ebrahim et al. (2013) Cancer Manag Res, 5: 225-33); the other type is double strand DNA cleavage agent, such as calicheamicin. Due to the supertoxicity, certain drugs could not be used alone as chemotherapy agents, but rather they have to be conjugated to antibodies to reduce the side effects and improve the therapeutic efficacy.

[0024] In one embodiment, the present invention provides a composition comprising a bispecific antibody. Bispecific monoclonal antibody (BsMAb, BsAb) is another strategy to make powerful anti-tumor weapons using novel antibodies. BsAb is an artificial protein that is composed of fragments of two different monoclonal antibodies and consequently binds to two different types of antigen. The most widely used application of this approach is in cancer immunotherapy, where BsMAbs are engineered that simultaneously bind to a cytotoxic cell (using a receptor like CD3) and a target like a tumor cell to be destroyed (Müller D et al. (2010) BioDrugs, 24(2):89-98; Chames P1 et al. (2009) MAbs, 1(6):539-47). Bi-specific T-cell engagers (BiTEs) and Dual-Affinity Re-Targeting (DART) are examples of small fragment BsAb, various bigger BsAbs were also developed, such as knob-in-hole IgG, CrossMab, TrioMab, DVD Ig (Kontermann RE et al. (2015) Drug Discov Today, 20(7):838-47). In BsAbs, one arm could be T or NK cell activation antibody, such as anti-CD3, or anti-CD16 antibody, the other arm could be tumor targeting antibody; or both arm target different tumor markers for synergetic inhibition of tumor growth.

[0025] In one embodiment, the present invention provides a composition comprising a chimeric antigen receptor (CAR). For example, in certain embodiments, the composition is a cell genetically modified to express a CAR. For example, in certain embodiments, the invention provides, T or NK cells which are genetically engineered to produce CARs on their surface that allow the T or NK cells to recognize a specific protein (antigen) on tumor cells. scFv is the most often used receptors for such engineering and have been successfully used in clinic for cancer treatment(Grupp SA et al. (2013) N Engl J Med, 368(16):1509-18; Porter DL et al. (2011) N Engl J Med, 365(8):725-33). The scFv is fused via a hinge and a transmembrane domain to a signaling intracellular domain. Such molecules result in activation of the T- or NK-cell in response to recognition by the scFv of its target. When T or NK cells express such a CAR, they recognize and kill target cells that express the target antigen. Several CARs have been developed against tumor associated antigens, and adoptive transfer approaches using such CAR-expressing T cells are currently in clinical trial for the treatment of various cancers.Antibodies

[0026] In one embodiment, the present invention provides a composition comprising an antibody or antibody fragment that specifically binds to the extracellular portion of PSMA. For example, the extracellular portion of PSMA, to which the antibody or antibody fragment binds, comprises the amino acid sequence of SEQ ID NO: 1.

[0027] The term "epitope" refers to a region of the antigen that binds to the antibody. It is the region of an antigen recognized by a first antibody wherein the binding of the first antibody to the region prevents binding of a second antibody or other bivalent molecule to the region. The region encompasses a particular core sequence or sequences selectively recognized by a class of antibodies. In general, epitopes are comprised by local surface structures that can be formed by contiguous or noncontiguous amino acid sequences.

[0028] The term "selectively recognizes," "selectively bind" or "selectively recognized" means that binding of the antibody or other bivalent molecule to an epitope is at least 2-fold greater, preferably 2-5 fold greater, and most preferably more than 5-fold greater than the binding of the bivalent molecule to an unrelated epitope or than the binding of an unrelated bivalent molecule to the epitope, as determined by techniques known in the art and described herein, such as, for example, ELISA and cold displacement assays.

[0029] In some embodiments, the term "antibody" refers to the structure that constitutes the natural biological form of an antibody. In most mammals, including humans, and mice, this form is a tetramer and consists of two identical pairs of two immunoglobulin chains, each pair having one light and one heavy chain, each light chain comprising immunoglobulin domains VL and CL, and each heavy chain comprising immunoglobulin domains VH, Cγ1, Cγ2, Cγ3 and Cγ4. In each pair, the light and heavy chain variable regions (VL and VH) are together responsible for binding to an antigen, and the constant regions (CL, Cγ1, Cγ2, Cγ3 and Cγ4, particularly Cγ1, Cγ2, and Cγ3) are responsible for antibody effector functions. In some mammals, for example in camels and llamas, full-length antibodies may consist of only two heavy chains, each heavy chain comprising immunoglobulin domains VH, Cγ2, and Cγ3. By "immunoglobulin (Ig)" herein is meant a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes. Immunoglobulins include but are not limited to antibodies. Immunoglobulins may have a number of structural forms, including but not limited to full-length antibodies, antibody fragments, and individual immunoglobulin domains including but not limited to VH, Cγ1, Cγ2, Cγ3, Cγ4,VL, and CL.

[0030] Depending on the amino acid sequence of the constant domain of their heavy chains, intact antibodies can be assigned to different "classes". There are five-major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into "subclasses" (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.

[0031] In some embodiments, the term "antibody" or "antigen-binding fragment" respectively refer to intact molecules as well as functional fragments thereof, such as Fab, a scFv-Fc bivalent molecule, F(ab')2, and Fv that are capable of specifically interacting with a desired target. In some embodiments, the antigen-binding fragments comprise: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, which can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule that can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab')2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; F(ab')2 is a dimer of two Fab' fragments held together by two disulfide bonds; (4) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (5) Single chain antibody (SCA or scFv), a genetically engineered molecule containing the variable region of the light chain and the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule. (6) scFv-Fc, is created by fusing single-chain Fv (scFv) with a hinge region from an immunoglobulin (Ig) such as an IgG, and Fc regions.

[0032] In one embodiment, the antibody provided herein is a monoclonal antibody. In another embodiment, the antigen-binding fragment provided herein is a single chain Fv (scFv), a diabody, a tandem scFv, a scFv-Fc bivalent molecule, an Fab, Fab', Fv, or F(ab')2.

[0033] In one embodiment, the term "bivalent molecule" or "BV" refers to a molecule capable of binding to two separate targets at the same time. The bivalent molecule is not limited to having two and only two binding domains and can be a polyvalent molecule or a molecule comprised of linked monovalent molecules. The binding domains of the bivalent molecule can selectively recognize the same epitope or different epitopes located on the same target or located on a target that originates from different species. The binding domains can be linked in any of a number of ways including, but not limited to, disulfide bonds, peptide bridging, amide bonds, and other natural or synthetic linkages known in the art (Spatola et al., "Chemistry and Biochemistry of Amino Acids, Peptides and Proteins," B. Weinstein, eds., Marcel Dekker, New York, p. 267 (1983) (general review); Morley, J. S., "Trends Pharm Sci" (1980) pp. 463-468 (general review); Hudson et al., Int J Pept Prot Res (1979) 14, 177-185; Spatola et al., Life Sci (1986) 38, 1243-1249; Hann, M. M., J Chem Soc Perkin Trans I (1982) 307-314; Almquist et al., J Med Chem (1980) 23, 1392-1398; Jennings-White et al., Tetrahedron Lett (1982) 23, 2533; Szelke et al., European Application EP 45665; Chemical Abstracts 97, 39405 (1982); Holladay, et al., Tetrahedron Lett (1983) 24, 4401-4404; and Hruby, V. J., Life Sci (1982) 31, 189-199).

[0034] The present invention provides an anti-PSMA antibody or antibody fragment isolated from a large yeast display human scFv library. In one embodiment, the antigen-binding fragment thereof is high affinity anti-PSMA scFv gy1, comprises the amino acid sequence of SEQ ID NO: 3.

[0035] For example, in one embodiment, the composition comprises an antibody fragment comprising the scFv denoted herein as gy1. In one embodiment gy1 comprises the amino acid sequence of SEQ ID NO: 3. In one embodiment, gy1 comprises a light chain comprising the amino acid sequence of SEQ ID NO: 5 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 21. In one embodiment, gy1 comprises a VL FR1 comprising the amino acid sequence of SEQ ID NO: 7; a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 9; a VL FR2 comprising the amino acid sequence of SEQ ID NO: 11; a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 13; a VL FR3 comprising the amino acid sequence of SEQ ID NO: 15; a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17; a VL FR4 comprising the amino acid sequence of SEQ ID NO: 19; a VH FR1 comprising the amino acid sequence of SEQ ID NO: 23; a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 25; a VH FR2 comprising the amino acid sequence of SEQ ID NO: 27; a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 29; a VH FR3 comprising the amino acid sequence of SEQ ID NO: 31; a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; a VH FR4 comprising the amino acid sequence of SEQ ID NO: 35; and a scFv linker comprising the amino acid sequence of SEQ ID NO: 37.

[0036] Disclosed herein are also variants of the antibody or antibody fragment which comprise one or more mutations. For example, in one embodiment, the antibody or antibody fragment comprises a VL FR2 comprising the amino acid sequence of SEQ ID NO: 39, where SEQ ID NO: 39 comprises a V→A point mutation with respect to SEQ ID NO: 11. In one embodiment, the antibody or antibody fragment comprises a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 41, where SEQ ID NO: 41 comprises a G→E point mutation with respect to SEQ ID NO: 13. In one embodiment, the antibody or antibody fragment comprises a VL FR4 comprising the amino acid sequence of SEQ ID NO: 43, where SEQ ID NO: 43 comprises a V→A point mutation with respect to SEQ ID NO: 19. In one embodiment, the antibody or antibody fragment comprises a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45, where SEQ ID NO: 45 comprises a S→F point mutation with respect to SEQ ID NO: 25. In one embodiment, the antibody or antibody fragment comprises a VH FR3 comprising the amino acid sequence of SEQ ID NO: 47, where SEQ ID NO: 47 comprises a I→V point mutation with respect to SEQ ID NO: 31. In one embodiment, the antibody or antibody fragment comprises a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 49, where SEQ ID NO: 49 comprises a D→G point mutation with respect to SEQ ID NO: 33. In one embodiment, the antibody or antibody fragment comprises a VH FR4 comprising the amino acid sequence of SEQ ID NO: 51, where SEQ ID NO: 51 comprises a G→E point mutation with respect to SEQ ID NO: 35.

[0037] For example, the composition may comprise an antibody fragment comprising a scFv denoted herein as gy1-st. In one embodiment, gy1-st comprises a VL FR2 comprising the amino acid sequence of SEQ ID NO: 39; a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45, and a VH FR4 comprising the amino acid sequence of SEQ ID NO: 51. In one embodiment, gy1-st comprises a VL FR1 comprising the amino acid sequence of SEQ ID NO: 7; a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 9; a VL FR2 comprising the amino acid sequence of SEQ ID NO: 39; a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 13; a VL FR3 comprising the amino acid sequence of SEQ ID NO: 15; a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17; a VL FR4 comprising the amino acid sequence of SEQ ID NO: 19; a VH FR1 comprising the amino acid sequence of SEQ ID NO: 23; a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45; a VH FR2 comprising the amino acid sequence of SEQ ID NO: 27; a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 29; a VH FR3 comprising the amino acid sequence of SEQ ID NO: 31; a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; a VH FR4 comprising the amino acid sequence of SEQ ID NO: 51; and a scFv linker comprising the amino acid sequence of SEQ ID NO: 37.

[0038] For example, in one embodiment, the composition comprises an antibody fragment comprising a scFv denoted herein as gy1-2. In one embodiment, gy1-2 comprises a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 41; a VL FR4 comprising the amino acid sequence of SEQ ID NO: 43; a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45, and a VH FR3 comprising the amino acid sequence of SEQ ID NO: 47. In one embodiment, gy1-2 comprises a VL FR1 comprising the amino acid sequence of SEQ ID NO: 7; a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 9; a VL FR2 comprising the amino acid sequence of SEQ ID NO: 11; a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 41; a VL FR3 comprising the amino acid sequence of SEQ ID NO: 15; a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17; a VL FR4 comprising the amino acid sequence of SEQ ID NO: 43; a VH FR1 comprising the amino acid sequence of SEQ ID NO: 23 a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45; a VH FR2 comprising the amino acid sequence of SEQ ID NO: 27; a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 29; a VH FR3 comprising the amino acid sequence of SEQ ID NO: 47; a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; a VH FR4 comprising the amino acid sequence of SEQ ID NO: 35; and a scFv linker comprising the amino acid sequence of SEQ ID NO: 37.

[0039] In one embodiment, an scFv described herein is engineered into another fragment antibody or full-length antibody, wherein fragment antibody refers to a Fab, Fab', (Fab') 2 , Fv, scFv-Fc, scFv-CH2, scFv-CH3, or a full antibody.

[0040] In one embodiment, the composition comprises an antibody comprising an scFv described herein. For example, in one embodiment, the composition comprises an antibody comprising gy1-2 scFv. In one embodiment, the antibody comprising gy1-2 scFv, is denoted herein as PSMAb. In one embodiment, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 68. In one embodiment, the antibody comprises a heavy chain having a signal peptide, wherein the heavy chain having a signal peptide comprises the amino acid sequence of SEQ ID NO: 53. In one embodiment, the heavy chain signal peptide comprises the amino acid sequence of SEQ ID NO: 55. In one embodiment, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 57. In one embodiment, the antibody comprises a heavy chain constant region of SEQ ID NO: 59. In one embodiment, the antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 69. In one embodiment, the antibody comprises a light chain having a signal peptide, wherein the light chain having a signal peptide comprises the amino acid sequence of SEQ ID NO: 61. In one embodiment, the light chain signal peptide comprises the amino acid sequence of SEQ ID NO: 63. In one embodiment, the antibody comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 65. In one embodiment, the antibody comprises a light chain constant region of SEQ ID NO: 67.

[0041] In one embodiment, full antibody are one of the types of IgG1, IgG2, IgG3 or IgG4. In another embodiment, gy1 scFv was engineered to a IgG1 full antibody.

[0042] In one embodiment, full antibody has a constant region of lambda, kappa or a mutated one from them. In another embodiment, gy1 scFv was engineered to a full antibody using a CL2 constant region.

[0043] In one embodiment, there may or may not be linker peptide(s) between signal peptide and variable region, between variable region and constant region of heavy and / or light chain; one example of such linker peptides is encoded by restriction enzyme sites.

[0044] In one embodiment, the antibody or antibody fragment is displayed on yeast cell surface; in another embodiment, the antibody or antibody fragment is coated on nanoparticle surface; in another embodiment, the antibody or antibody fragment is displayed on mammalian cell surface, such as T cells, NK cells or other human or other mammalian cells; in another embodiment, the antibody or antibody fragment is produced as secretory protein by yeast, E.coli or mammalian cells.

[0045] In one embodiment, the term "binds" or "binding" or grammatical equivalents, refers to the compositions having affinity for each other. "Specific binding" is where the binding is selective between two molecules. A particular example of specific binding is that which occurs between an antibody and an antigen. Typically, specific binding can be distinguished from non-specific when the dissociation constant (KD) is less than about 1×10 -5< M or less than about 1×10 -6< M or 1×10 -7< M. Specific binding can be detected, for example, by ELISA, immunoprecipitation, coprecipitation, with or without chemical crosslinking, two-hybrid assays and the like. Appropriate controls can be used to distinguish between "specific" and "non-specific" binding.

[0046] In one embodiment, the antibody or antigen binding fragment binds its target with a Kd within the 1 nM range; in another embodiment, the antibody or antigen binding fragment binds its target with a Kd within the 0.1 nM range. In another embodiment, gy1 scFv has an affinity of Kd=1.165 nM and IgG1 full antibody PSMAb has an affinity of Kd=0.1 nM.

[0047] The antibody or antibody fragment may have modifications. The modification is one as further defined herein below. The modification may be a N-terminus modification, a C-terminal modification, or it may be in the middle of the protein. In one embodiment, the secretable form of the antibody or antigen-binding fragment comprises an N-terminal modification that allows binding to an Immunoglobulin (Ig) hinge region. In another embodiment, the Ig hinge region is from but is not limited to, an immunoglobulin hinge region. In some embodiments, the modification is direct modification on antibody or antibody fragment. In other embodiments, the modification is indirect modification bridged by one or more other peptides, proteins, chemicals, carbohydrate or even secondary antibodies.

[0048] Additional post-translational modifications encompassed by the invention include, for example, e.g., N-linked or O-linked carbohydrate chains, processing of N-terminal or C-terminal ends, attachment of chemical moieties to the amino acid backbone, chemical modifications of N-linked or O-linked carbohydrate chains, and addition or deletion of an N-terminal methionine residue as a result of procaryotic host cell expression.

[0049] The antibodies or antigen-binding fragments of this invention can be produced by any synthetic or recombinant process such as is well known in the art. The antibodies or antigen-binding fragments of the invention can further be modified to alter biophysical or biological properties by means of techniques known in the art. For example, the polypeptide can be modified to increase its stability against proteases, or to modify its lipophilicity, solubility, or binding affinity to its native receptor.

[0050] In some embodiments, antibody fragments may be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli or mammalian cells (e.g. Chinese hamster ovary cell culture or other protein expression systems) of DNA encoding the fragment. Antibody fragments can, in some embodiments, be obtained by pepsin or papain digestion of whole antibodies by conventional methods. For example, antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab')2. This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab'monovalent fragments. Alternatively, an enzymatic cleavage using pepsin produces two monovalent Fab'fragments and an Fc fragment directly. These methods are described, for example, by Goldenberg, U.S. Pat. Nos. 4,036,945 and 4,331,647, and references contained therein. See also Porter, R. R., Biochem. J., 73: 119-126, 1959. Other methods of cleaving antibodies, such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.

[0051] In one embodiment, the term "framework region" or "FR" are those variable domain residues other than the hypervariable region residues. The framework regions have been precisely defined. See, e.g., Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, US Dept. Health and Human Services, National Institutes of Health, USA (5th ed. 1991). Each variable domain typically has four FRs identified as FR1, FR2, FR3 and FR4. In some embodiments, "FR" also refers to an antibody variable region comprising amino acid residues abutting or proximal to, but outside of the CDR regions i.e. regions which directly interact with the antigen, acting as the recognition element of the antibody molecule within the variable region of an antibody. In one embodiment, the term "framework region" is intended to mean each domain of the framework that is separated by the CDRs. In some embodiments, the sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The combined heavy and light chain framework regions of an antibody serve to position and align the CDRs for proper binding to the antigen.

[0052] In one embodiment, the term "CDR" or "complementarity determining region" refers to amino acid residues comprising non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. In other embodiments, the term "CDR" will comprise regions as described by Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991), and Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987) and MacCallum et al., J. Mol. Biol. 262:732-745 (1996). The amino acids of the CDRs of the variable domains were initially defined by Kabat, based on sequence variability, to consist of amino acid residues 31-35B (H1), 50-65 (H2), and 95-102 (H3) in the human heavy chain variable domain (VH) and amino acid residues 24-34 (L1), 50-56 (L2), and 89-97 (L3) in the human light chain variable domain (VL), using Kabat's numbering system for amino acid residues of an antibody. See Kabat et al., sequences of proteins of immunological interest, US Dept. Health and Human Services, NIH, USA (5th ed. 1991). Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987) presented another definition of the CDRs based on residues that included in the three-dimensional structural loops of the variable domain regions, which were found to be important in antigen binding activity. Chothia et al. defined the CDRs as consisting of amino acid residues 26-32 (H1), 52-56 (H2), and 95-102 (H3) in the human heavy chain variable domain (VH), and amino acid residues 24-34 (L1), 50-56 (L2), and 89-97 (L3) in the human light chain variable domain (VL). Combining the CDR definitions of Kabat and Chothia, the CDRs consist of amino acid residues 26-35B (H1), 50-65 (H2), and 95-102 (H3) in human VH and amino acid residues 24-34 (L1), 50-56 (L2), and 89-97 (L3) in human VL, based on Kabat's numbering system.

[0053] In some embodiments, a "variable region" when used in reference to an antibody or a heavy or light chain thereof is intended to mean the amino terminal portion of an antibody which confers antigen binding onto the molecule and which is not the constant region. The term is intended to include functional fragments thereof which maintain some of all of the binding function of the whole variable region. Therefore, the term "heteromeric variable region binding fragments" is intended to mean at least one heavy chain variable region and at least one light chain variable regions or functional fragments thereof assembled into a heteromeric complex. Heteromeric variable region binding fragments include, for example, functional fragments such as Fab, F(ab)2, Fv, single chain Fv (scfv) and the like. Such functional fragments are well known to those skilled in the art. Accordingly, the use of these terms in describing functional fragments of a heteromeric variable region is intended to correspond to the definitions well known to those skilled in the art. Such terms are described in, for example, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York (1989); Molec. Biology and Biotechnology: A Comprehensive Desk Reference (Myers, R. A. (ed.), New York: VCH Publisher, Inc.); Huston et al., Cell Biophysics. 22:189-224 (1993); Plückthun and Skerra, Meth. Enzymol., 178:497-515 (1989) and in Day, E. D., Advanced Immunochemistry, Second Ed., Wiley-Liss, Inc., New York, N.Y. (1990).

[0054] Methods of making antibodies and antibody fragments are known in the art. (See for example, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1988).

[0055] In one embodiment, the antibody or antigen-binding fragment of the present invention can be purified by methods known in the art, for example, gel filtration, ion exchange, affinity chromatography, etc. Affinity chromatography or any of a number of other techniques known in the art can be used to isolate monoclonal antibodies from serum, ascites fluid, or hybridoma supernatants.

[0056] "Purified" means that the monoclonal antibody is separated from at least some of the proteins normally associated with the monoclonal antibody and preferably separated from all cellular materials other than proteins.

[0057] Also described are chemically modified derivatives of antibodies of the invention which may provide additional advantages such as increased solubility, stability and in vivo or in vitro circulating time of the polypeptide, or decreased immunogenicity (see U.S. Pat. No. 4,179,337). The chemical moieties for derivitization may be selected from water soluble polymers such as polyethylene glycol, ethylene glycol / propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like. The antibodies may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.

[0058] The polymer may be of any molecular weight, and may be branched or unbranched. For polyethylene glycol, the preferred molecular weight is between about 1 kDa and about 100 kDa (the term "about" indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing. Other sizes may be used, depending on the desired therapeutic profile (e.g., the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a therapeutic protein or analog). For example, the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2560, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 11,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,000, 40,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 kDa.

[0059] As noted above, the polyethylene glycol may have a branched structure. Branched polyethylene glycols are described, for example, in U.S. Pat. No. 5,643,575; Morpurgo et al., Appl. Biochem. Biotechnol. 56:59-72 (1996); Vorobjev et al., Nucleosides Nucleic acids 18:2745-2750 (1999); and Caliceti et al., Bioconjug. Chem. 10:638-646 (1999).

[0060] The polyethylene glycol molecules (or other chemical moieties) should be attached to the antibody with consideration of effects on functional or antigenic domains of the antibody. There are a number of attachment methods available to those skilled in the art, e.g., EP 0 401 384, (coupling PEG to G-CSF), see also Malik et al., Exp. Hematol. 20:1028-1035 (1992) (reporting pegylation of GM-CSF using tresyl chloride). For example, polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as, a free amino or carboxyl group. Reactive groups are those to which an activated polyethylene glycol molecule may be bound. The amino acid residues having a free amino group may include, for example, lysine residues and the N-terminal amino acid residues; those having a free carboxyl group may include aspartic acid residues, glutamic acid residues, and the C-terminal amino acid residue. Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecules. Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group.

[0061] As suggested above, polyethylene glycol may be attached to proteins, e.g., antibodies, via linkage to any of a number of amino acid residues. For example, polyethylene glycol can be linked to a protein via covalent bonds to lysine, histidine, aspartic acid, glutamic acid, or cysteine residues. One or more reaction chemistries may be employed to attach polyethylene glycol to specific amino acid residues (e.g., lysine, histidine, aspartic acid, glutamic acid, or cysteine) of the protein or to more than one type of amino acid residue (e.g., lysine, histidine, aspartic acid, glutamic acid, cysteine and combinations thereof) of the protein.Nucleic acids

[0062] In one embodiment, the invention provides polynucleic acids comprising, or alternatively consisting of, a nucleic acid sequence encoding an antibody of the invention (including molecules comprising, or alternatively consisting of, antibody fragments thereof).

[0063] In another embodiment, the polynucleic acids are obtained, and the nucleic acid sequence of the polynucleic acids determined, by any method known in the art. Alternatively, a polynucleic acid encoding an antibody (including molecules comprising, or alternatively consisting of, antibody fragments thereof) are generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized in native or optimized codons for specific species or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody of the invention) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleic acid probe specific for the particular gene sequence to identify, e.g. a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR may then be cloned into replicable cloning vectors using any method well known in the art.

[0064] In some embodiments, the term "nucleic acid" refers to polynucleic acid or to oligonucleic acids such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA) or mimetic thereof. The term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleic acid analogs, and, as applicable to the embodiment being described, single (sense or antisense) and double-stranded polynucleic acids. This term includes oligonucleic acids composed of naturally occurring nucleobases, sugars and covalent internucleoside (backbone) linkages as well as oligonucleic acids having non-naturally-occurring portions, which function similarly. Such modified or substituted oligonucleic acids are often preferred over native forms because of desirable properties such as, for example, enhanced cellular uptake, enhanced affinity for nucleic acid target and increased stability in the presence of nucleases.

[0065] The nucleic acids of the present invention can be produced by any synthetic or recombinant process such as is well known in the art. Nucleic acids according to the invention can further be modified to alter biophysical or biological properties by means of techniques known in the art. For example, the nucleic acid can be modified to increase its stability against nucleases (e.g., "endcapping"), or to increase expression level by codon-optimization, or to modify its lipophilicity, solubility, or binding affinity to complementary sequences.

[0066] Methods for modifying nucleic acids to achieve specific purposes are disclosed in the art, for example, in Sambrook et al. (1989). Moreover, the nucleic acid sequences of the invention can include one or more portions of nucleic acid sequence that are non-coding for the protein of interest. The invention further provides DNA sequences which encode proteins similar to those encoded by sequences as described herein, but which differ in terms of their codon sequence due to the degeneracy of the genetic code or allelic variations (naturally-occurring base changes in the species population which may or may not result in an amino acid change), which may encode the proteins of the invention described herein, as well. Variations in the DNA sequences, which are caused by point mutations or by induced modifications (including insertion, deletion, and substitution) to enhance the activity, half-life or production of the polypeptides encoded thereby, are also encompassed in the invention.

[0067] DNA encoding the antibodies or antigen-binding fragments provided herein is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleic acid probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibodies). Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, yeast cells or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the antibodies in the recombinant host cells. Recombinant production of antibodies is described in more detail below.

[0068] In one embodiment, the composition comprises a nucleic acid molecule encoding an scFv gy1 comprising the amino acid sequence of SEQ ID NO: 3. In one embodiment, the composition comprises a nucleic acid molecule comprising SEQ ID NO: 2.

[0069] For example, in one embodiment, the nucleic acid molecule encodes gy1. In one embodiment the nucleic acid molecule encodes gy1, comprising the amino acid sequence of SEQ ID NO: 3. For example, in one embodiment, the nucleic acid sequence encoding a gy1 comprises the nucleotide sequence of SEQ ID NO: 2. In one embodiment, the nucleic acid molecule encoding gy1 comprises a nucleotide sequence encoding a light chain comprising the amino acid sequence of SEQ ID NO: 5 and a nucleotide sequence encoding a heavy chain comprising the amino acid sequence of SEQ ID NO: 21. For example, in one embodiment, the nucleotide sequence encoding a light chain comprises the nucleotide sequence of SEQ ID NO: 4, and the nucleotide sequence encoding a heavy chain comprises the nucleotide sequence of SEQ ID NO: 20.

[0070] In one embodiment, the nucleic acid molecule encoding gy1 comprises a nucleotide sequence encoding a VL FR1 comprising the amino acid sequence of SEQ ID NO: 7; a nucleotide sequence encoding a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 9; a nucleotide sequence encoding a VL FR2 comprising the amino acid sequence of SEQ ID NO: 11; a nucleotide sequence encoding a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 13; a nucleotide sequence encoding a VL FR3 comprising the amino acid sequence of SEQ ID NO: 15; a nucleotide sequence encoding a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17; a nucleotide sequence encoding a VL FR4 comprising the amino acid sequence of SEQ ID NO: 19; a nucleotide sequence encoding a VH FR1 comprising the amino acid sequence of SEQ ID NO: 23; a nucleotide sequence encoding a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 25; a nucleotide sequence encoding a VH FR2 comprising the amino acid sequence of SEQ ID NO: 27; a nucleotide sequence encoding a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 29; a nucleotide sequence encoding a VH FR3 comprising the amino acid sequence of SEQ ID NO: 31; a nucleotide sequence encoding a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; a nucleotide sequence encoding a VH FR4 comprising the amino acid sequence of SEQ ID NO: 35; and a nucleotide sequence encoding a scFv linker comprising the amino acid sequence of SEQ ID NO: 37.

[0071] For example, in one embodiment, the nucleotide sequence encoding a VL FR1 comprises the nucleotide sequence of SEQ ID NO: 6; the nucleotide sequence encoding a VL CDR1 comprises the nucleotide sequence of SEQ ID NO: 8; the nucleotide sequence encoding a VL FR2 comprises the nucleotide sequence of SEQ ID NO: 10; the nucleotide sequence encoding a VL CDR2 comprises the nucleotide sequence of SEQ ID NO: 12; the nucleotide sequence encoding a VL FR3 comprises the nucleotide sequence of SEQ ID NO: 14; the nucleotide sequence encoding a VL CDR3 comprises the nucleotide sequence of SEQ ID NO: 16; the nucleotide sequence encoding a VL FR4 comprises the nucleotide sequence of SEQ ID NO: 18; the nucleotide sequence encoding a VH FR1 comprises the nucleotide sequence of SEQ ID NO: 22; the nucleotide sequence encoding a VH CDR1 comprises the nucleotide sequence of SEQ ID NO: 24; the nucleotide sequence encoding a VH FR2 comprises the nucleotide sequence of SEQ ID NO: 26; the nucleotide sequence encoding a VH CDR2 comprises the nucleotide sequence of SEQ ID NO: 28; the nucleotide sequence encoding a VH FR3 comprises the nucleotide sequence of SEQ ID NO: 30; the nucleotide sequence encoding a VH CDR3 comprises the nucleotide sequence of SEQ ID NO: 32; the nucleotide sequence encoding a VH FR4 comprises the nucleotide sequence of SEQ ID NO: 34; and the nucleotide sequence encoding a scFv linker comprises the nucleotide sequence of SEQ ID NO: 36.

[0072] For example, in one embodiment, the composition comprises a nucleic acid molecule encoding an antibody fragment comprising a scFv denoted herein as gy1-2. In one embodiment, the nucleic acid molecule encoding gy1-2 comprises a nucleotide sequence encoding VL CDR2 comprising the amino acid sequence of SEQ ID NO: 41; a nucleotide sequence encoding VL FR4 comprising the amino acid sequence of SEQ ID NO: 43; a nucleotide sequence encoding VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45, and a nucleotide sequence encoding VH FR3 comprising the amino acid sequence of SEQ ID NO: 47. In one embodiment, the nucleic acid molecule encoding gy1-2 comprises a nucleotide sequence encoding a VL FR1 comprising the amino acid sequence of SEQ ID NO: 7; a nucleotide sequence encoding a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 9; a nucleotide sequence encoding a VL FR2 comprising the amino acid sequence of SEQ ID NO: 11; a nucleotide sequence encoding a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 41; a nucleotide sequence encoding a VL FR3 comprising the amino acid sequence of SEQ ID NO: 15; a nucleotide sequence encoding a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17; a nucleotide sequence encoding a VL FR4 comprising the amino acid sequence of SEQ ID NO: 43; a nucleotide sequence encoding a VH FR1 comprising the amino acid sequence of SEQ ID NO: 23; a nucleotide sequence encoding a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 45; a nucleotide sequence encoding a VH FR2 comprising the amino acid sequence of SEQ ID NO: 27; a nucleotide sequence encoding a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 29; a nucleotide sequence encoding a VH FR3 comprising the amino acid sequence of SEQ ID NO: 47; a nucleotide sequence encoding a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; a nucleotide sequence encoding a VH FR4 comprising the amino acid sequence of SEQ ID NO: 35; and a nucleotide sequence encoding a scFv linker comprising the amino acid sequence of SEQ ID NO: 37. In one embodiment, the nucleotide sequence encoding a VL FR1 comprises the nucleotide sequence of SEQ ID NO: 6; the nucleotide sequence encoding a VL CDR1 comprises the nucleotide sequence of SEQ ID NO: 8; the nucleotide sequence encoding a VL FR2 comprises the nucleotide sequence of SEQ ID NO: 10; the nucleotide sequence encoding a VL CDR2 comprises the nucleotide sequence of SEQ ID NO: 40; the nucleotide sequence encoding a VL FR3 comprises the nucleotide sequence of SEQ ID NO: 14; the nucleotide sequence encoding a VL CDR3 comprises the nucleotide sequence of SEQ ID NO: 16; the nucleotide sequence encoding a VL FR4 comprises the nucleotide sequence of SEQ ID NO: 42; the nucleotide sequence encoding a VH FR1 comprises the nucleotide sequence of SEQ ID NO: 22; the nucleotide sequence encoding a VH CDR1 comprises the nucleotide sequence of SEQ ID NO: 44; the nucleotide sequence encoding a VH FR2 comprises the nucleotide sequence of SEQ ID NO: 26; the nucleotide sequence encoding a VH CDR2 comprises the nucleotide sequence of SEQ ID NO: 28; the nucleotide sequence encoding a VH FR3 comprises the nucleotide sequence of SEQ ID NO: 46; the nucleotide sequence encoding a VH CDR3 comprises the nucleotide sequence of SEQ ID NO: 32; the nucleotide sequence encoding a VH FR4 comprises the nucleotide sequence of SEQ ID NO: 34; and the nucleotide sequence encoding a scFv linker comprises the nucleotide sequence of SEQ ID NO: 36.

[0073] In one embodiment, the composition comprises a nucleic acid molecule encoding PSMAb. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence that encodes a heavy chain comprising the amino acid sequence of SEQ ID NO: 68. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a heavy chain having a signal peptide, wherein the heavy chain having a signal peptide comprises the amino acid sequence of SEQ ID NO: 53. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding heavy chain signal peptide comprising the amino acid sequence of SEQ ID NO: 55. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 57. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a heavy chain constant region of SEQ ID NO: 59. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a light chain comprising the amino acid sequence of SEQ ID NO: 69. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a light chain having a signal peptide, wherein the light chain having a signal peptide comprises the amino acid sequence of SEQ ID NO: 61. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding the light chain signal peptide comprising the amino acid sequence of SEQ ID NO: 63. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a light chain variable region comprising the amino acid sequence of SEQ ID NO: 65. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a light chain constant region of SEQ ID NO: 67. In one embodiment, the nucleotide sequence encoding a heavy chain having a signal peptide comprises the nucleotide sequence of SEQ ID NO: 52. In one embodiment, the nucleotide sequence encoding heavy chain signal peptide comprises the nucleotide sequence of SEQ ID NO: 54. In one embodiment, the nucleotide sequence encoding a heavy chain variable region comprises the nucleotide sequence of SEQ ID NO: 56. In one embodiment, the nucleotide sequence encoding a heavy chain constant region comprises the nucleotide sequence of SEQ ID NO: 58. In one embodiment, the nucleotide sequence encoding a light chain having a signal peptide comprises the nucleotide sequence of SEQ ID NO: 60. In one embodiment, the nucleotide sequence encoding the light chain signal peptide comprises the nucleotide sequence of SEQ ID NO: 62. In one embodiment, the nucleotide sequence encoding a light chain variable region comprises the nucleotide sequence of SEQ ID NO: 64. In one embodiment, the nucleotide sequence encoding a light chain constant region comprises the nucleotide sequence of SEQ ID NO: 66.

[0074] It is further described methods to express or produce the recombinant protein of the anti-PSMA antibody or antibody fragment using various protein expression system.

[0075] In one embodiment, the disclosurealso provides transformed cells and progeny thereof into which a nucleic acid molecule encoding an antibody or antigen-binding fragment, has been introduced by means of recombinant DNA techniques in vitro, ex vivo or in vivo. The transformed cells, eukaryotic or prokaryotic, may be used to produce recombinant antibody or antibody fragment for purification, or for in situ or secretory expression for various purposes, such as diagnosis or therapy for tumor. The transformed cells can be propagated and the introduced nucleic acid transcribed, or encoded protein expressed. It is understood that a progeny cell may not be identical to the parental cell, since there may be mutations that occur during replication. Transformed cells include but are not limited to prokaryotic and eukaryotic cells such as bacteria, fungi, plant, insect, and animal (e.g., mammalian, including human) cells. The cells may be present in culture, in a cell, tissue or organ ex vivo or present in a subject.

[0076] Typically cell transformation employs a vector. The term "vector," refers to, e.g., a plasmid, virus, such as a viral vector, or other vehicle known in the art that can be manipulated by insertion or incorporation of a nucleic acid, for genetic manipulation (i.e., "cloning vectors"), or can be used to transcribe or translate the inserted polynucleic acid (i.e., "expression vectors"). Such vectors are useful for introducing nucleic acids, including a nucleic acid that encodes an antibody operably linked with an expression control element, and expressing the encoded protein in vitro (e.g., in solution or in solid phase), in cells or in vivo.

[0077] In one embodiment, the expression vector(s) is(are) transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an antibody or antigen-binding fragment of the invention. Thus, the invention includes host cells containing polynucleic acid(s) encoding an antibody of the invention (e.g., whole antibody, a heavy or light chain thereof, or portion thereof, or a single chain antibody, or a fragment thereof), operably linked to a heterologous promoter. In other embodiments, for the expression of entire antibody molecules, vectors encoding both the heavy and light chains are co-expressed in the host cell for expression of the entire immunoglobulin molecule.

[0078] A variety of host-expression vector systems may be utilized to express the antibody molecules of the invention. Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleic acid coding sequences, express an antibody molecule of the invention in situ. These include, but are not limited to, bacteriophage particles engineered to express antibody fragments thereof (single chain antibodies), microorganisms such as bacteria (e.g., E. coli, B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing antibody coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS, CHO, BHK, 293, 3T3, NS0 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter; CMV promoter or EF1α promoter). Preferably, bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant antibody molecule. For example, mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies (Foecking et al., Gene 45:101 (1986); Cockett et al., Bio / Technology 8:2 (11990); B ebbington et al., Bio / Techniques 10:169 (1992); Keen and Hale, Cytotechnology 18:207 (1996)).

[0079] A vector used to transform a cell or a host-expression vector generally contains at least an origin of replication for propagation in the cell. Control elements, including expression control elements as set forth herein, present within a vector, are included to facilitate transcription and translation. The term "expression control element" is intended to include, at a minimum, one or more components whose presence can influence expression, and can include components other than or in addition to promoters or enhancers, for example, leader sequences and fusion partner sequences, internal ribosome binding sites (IRES) elements for the creation of multigene, or polycistronic, messages, splicing signal for introns, maintenance of the correct reading frame of the gene to permit in-frame translation of mRNA, polyadenylation signal to provide proper polyadenylation of the transcript of a gene of interest, stop codons, etc.

[0080] Vectors can include a selection marker. As is known in the art, "selection marker" means a gene that allows for the selection of cells containing the gene. "Positive selection" refers to a process whereby only cells that contain the selection marker will survive upon exposure to the positive selection. Drug resistance is one example of a positive selection marker; cells containing the marker will survive in culture medium containing the selection drug, and cells which do not contain the marker will die. Such markers include drug resistance genes such as neo, which confers resistance to G418, hygr, which confers resistance to hygromycin, or puro which confers resistance to puromycin, among others. Other positive selection marker genes include genes that allow identification or screening of cells containing the marker. These genes include genes for fluorescent proteins (GFP), the lacZ gene, the alkaline phosphatase gene, and surface markers such as CD8, among others.

[0081] Vectors can contain negative selection markers. "Negative selection" refers to a process whereby cells containing a negative selection marker are killed upon exposure to an appropriate negative selection agent. For example, cells which contain the herpes simplex virus-thymidine kinase (HSV-tk) gene (Wigler et al., Cell 11:223 (1977)) are sensitive to the drug gancyclovir (GANC). Similarly, the gpt gene renders cells sensitive to 6-thioxanthine.

[0082] Mammalian expression systems further include vectors specifically designed for in vivo and ex vivo expression. Such systems include adeno-associated virus (AAV) vectors (U.S. Pat. No. 5,604,090). AAV vectors have previously been shown to provide expression of Factor IX in humans and in mice at levels sufficient for therapeutic benefit (Kay et al., Nat. Genet. 24:257 (2000); Nakai et al., Blood 91:4600 (1998)). Adenoviral vectors (U.S. Pat. Nos. 5,700,470, 5,731,172 and 5,928,944), herpes simplex virus vectors (U.S. Pat. No. 5,501,979) and retroviral (e.g., lentivirus vectors are useful for infecting dividing as well as non-dividing cells and foamy virues) vectors (U.S. Pat. Nos. 5,624,820, 5,693,508, 5,665,577, 6,013,516 and 5,674,703 and WIPO publications WO92 / 05266 and WO92 / 14829) and papilloma virus vectors (e.g., human and bovine papilloma virus) have all been employed in gene therapy (U.S. Pat. No. 5,719,054). Vectors also include cytomegalovirus (CMV) based vectors (U.S. Pat. No. 5,561,063). Vectors that efficiently deliver genes to cells of the intestinal tract have been developed and also may be used (see, e.g., U.S. Pat. Nos. 5,821,235, 5,786,340 and 6,110,456). In yeast, vectors that facilitate integration of foreign nucleic acid sequences into a chromosome, via homologous recombination, for example, are known in the art and can be used. Yeast artificial chromosomes (YAC) are typically used when the inserted nucleic acids are too large for more conventional vectors (e.g., greater than about 12 kb).

[0083] In one embodiment, phagemid vectors for use in the invention include any available in the art suitable for the production of the antibodies / antibody templates / FR libraries of the present invention and include phagemid vectors pCB04, pIT1, pIT2, CANTAB 6, pComb 3 HS. Filamentous vectors and methods of phagemid construction are described in, for example, U.S. Pat. No. 6,054,312 and U.S. Pat. No. 6,803,230. Bacteriophage display systems involving non-filamentous bacteriophage vectors known as cytoplasmic bacteriophage or lytic phage can also be utilized as described in for example, U.S. Pat. No. 5,766,905.

[0084] Suitable bacterial expression constructs for use with the present invention include, but are not limited to the pCAL, pUC, pET, pETBlue ™< (Novagen), pBAD, pLEX, pTrcHis2, pSE280, pSE380, pSE420 (Invitrogen), pKK223-2 (Clontech), pTrc99A, pKK223-3, pRIT2T, pMC1871, pEZZ 18 (Pharmacia), pBluescript II SK (Stratagene), pALTER-Ex1, pALTER-Ex2, pGEMEX (Promega), pFivE (MBI), pQE (Qiagen) commercially available expression constructs, and their derivatives, and others known in the art. In some embodiments of the present invention the construct may also include, a virus, a plasmid, a bacmid, a phagemid, a cosmid, or a bacteriophage.

[0085] The use of liposomes for introducing various compositions into cells, including nucleic acids, is known to those skilled in the art (see, e.g., U.S. Pat. Nos. 4,844,904, 5,000,959, 4,863,740, and 4,975,282). A carrier comprising a natural polymer, or a derivative or a hydrolysate of a natural polymer, described in WO 94 / 20078 and U.S. Pat. No. 6,096,291, is suitable for mucosal delivery of molecules, such as polypeptides and polynucleic acids. piperazine based amphilic cationic lipids useful for gene therapy also are known (see, e.g., U.S. Pat. No. 5,861,397). Cationic lipid systems also are known (see, e.g., U.S. Pat. No. 5,459,127). Accordingly, viral and non-viral vector means of delivery into cells or tissue, in vitro, in vivo and ex vivo are included.

[0086] In one embodiment, nucleic acid sequences can be "operably linked", i.e., positioned, to ensure the functioning of an expression control sequence. These expression constructs are typically replicable in the cells either as episomes or as integral parts of the cell's chromosomal DNA, and may contain appropriate origins of replication for the respective prokaryotic strain employed for expression. Commonly, expression constructs contain selection markers, such as for example, tetracycline resistance, ampicillin resistance, kanamycin resistance or chlormaphenicol resistance, facilitating detection and / or selection of those bacterial cells transformed with the desired nucleic acid sequences (see, e.g., U.S. Pat. No. 4,704,362). These markers, however, are not exclusionary, and numerous others may be employed, as known to those skilled in the art. In another embodiment of the present disclosure expression constructs contain both positive and negative selection markers.

[0087] Similarly, reporter genes may be incorporated within expression constructs to facilitate identification of transcribed products. Accordingly, in one embodiment of the present invention, reporter genes utilized are selected from the group consisting of β-galactosidase, chloramphenicol acetyl transferase, luciferase and a fluorescent protein.

[0088] Prokaryotic promoter sequences regulate expression of the encoded polynucleic acid sequences, and in some embodiments of the present invention, are operably linked to polynucleic acids encoding the polypeptides of this invention. In additional embodiments of the present invention, these promoters are either constitutive or inducible, and provide a means of high and low levels of expression of the polypeptides of this invention, and in some embodiments, for regulated expression of multiple polypeptides of the invention, which in some embodiments are expressed as a fusion protein.

[0089] Many well-known bacterial promoters, including the T7 promoter system, the lactose promoter system, typtophan (Trp) promoter system, Trc / Tac Promoter Systems, beta-lactamase promoter system, tetA Promoter systems, arabinose regulated promoter system, Phage T5 Promoter, or a promoter system from phage lambda, may be employed, and others, as well, and comprise embodiments of the present invention. The promoters will typically control expression, optionally with an operator sequence and may include ribosome binding site sequences for example, for initiating and completing transcription and translation. According to additional embodiments, the vector may also contain expression control sequences, enhancers that may regulate the transcriptional activity of the promoter, appropriate restriction sites to facilitate cloning of inserts adjacent to the promoter and other necessary information processing sites, such as RNA splice sites, polyadenylation sites and transcription termination sequences as well as any other sequence which may facilitate the expression of the inserted nucleic acid.

[0090] In another embodiment, the present disclosure comprises methods of use of a polynucleic acid, vector, antibodies and / or fragment thereof as herein described and / or compositions comprising the same in treating, inhibiting or preventing.Detection of PSMA

[0091] It is to be understood by a skilled artisan that the antibody, antigen-binding fragments, or compositions provided herein can be used in diagnostic or therapeutic procedures.

[0092] In one embodiment, provided herein is a method of diagnosing the presence of a tumor or a cancer growth in a subject. In another embodiment, the method comprises sampling a tissue sample isolated from the subject with a composition comprising the antibody or antigen-binding fragment provided herein, whereby specific binding of said antibody or antigen-binding fragment to the tissue sample is indicative of the presence of a tumor or cancer growth in the subject. In another embodiment, the method further comprises detecting a secondary reagent that specifically binds to the antibody or antigen-binding fragment but does not antagonize binding of the antibody or antigen-binding fragment to its target. In another embodiment, the "secondary reagent" is a photoactivatable agent, a fluorophore, a radioisotope, a bioluminescent protein, a bioluminescent peptide, a fluorescent tag, a fluorescent protein, or a fluorescent peptide.

[0093] In one embodiment, the term "cancer" and "cancerous" refer to or describe, in one embodiment, the physiological condition in mammals that is typically characterized by unregulated cell growth. In the context of the present invention, cancer is prostate cancer.

[0094] In another embodiment, "sampling" comprises the step of testing or analyzing the sample using a detection assay that enables the detection of a secondary reagent that is complexed with or conjugated to the antibody or antigen-binding fragment and emits a detectable "signal" when the antibody or antigen-binding fragment is specifically bound to the target. In another embodiment, the detection is achieved using assays routinely used in the art such as, but not limited to immunological assays (for e g, immunohistochemistry, ELISA, etc.) or microscopic imaging.

[0095] In one embodiment, the term "labeled" refers to antibodies of the invention having one or more elements, isotopes, or chemical compounds attached to enable the detection in a screen. In general, labels fall into three classes: a) immune labels, which may be an epitope incorporated as a fusion partner that is recognized by an antibody, b) isotopic labels, which may be radioactive or heavy isotopes, and c) small molecule labels, which may include fluorescent and calorimetric dyes, or molecules such as biotin that enable other labeling methods. In one embodiment, antibodies of the invention are labeled with biotin. In other related embodiments, biotinylated antibodies of the invention may be used, for example, as an imaging agent or as a means of identifying one or more ligand molecules. In another embodiment, the label can be a nanoparticle that can be detected or visualized once bound to the antibody or antigen-binding fragment. Labels may be incorporated into the compound at any position and may be incorporated in vitro or in vivo during protein expression.

[0096] In one embodiment, the conjugate formed by the antibody or antigen-binding fragment and the secondary reagent provided herein are used for various applications such as, but not limited to, flow cytometry, ELISA, Western blotting, immunohistochemistry, membrane assays, and diagnostic and therapeutic methods as further described herein or as routinely applied in the art.Imaging of tumors with abnormal PSMA expression

[0097] In vivo imaging methods are not part of the invention.

[0098] The composition of the present invention may be administered to a subject having a disease involving inappropriate expression of a target antigen, a protein or other molecule. For example, the composition comprising an antibody or antibody fragment that binds to PSMA is administered to detect the presence, abundance, location, or combination thereof of PSMA in the subject. Within the scope of the present disclosure this is meant to include diseases and disorders characterized by aberrant proteins, due for example to alterations in the amount of a protein present, protein localization, posttranslational modification, conformational state, the presence of a mutant or pathogen protein, etc. Similarly, the disease or disorder may be characterized by alterations molecules including but not limited to polysaccharides and gangliosides. An overabundance may be due to any cause, including but not limited to overexpression at the molecular level, prolonged or accumulated appearance at the site of action, or increased activity of a protein relative to normal. Included within this definition are diseases and disorders characterized by a reduction of a protein. This reduction may be due to any cause, including but not limited to reduced expression at the molecular level, shortened or reduced appearance at the site of action, mutant forms of a protein, or decreased activity of a protein relative to normal. Such an overabundance or reduction of a protein can be measured relative to normal expression, appearance, or activity of a protein, and said measurement may play an important role in the development and / or clinical testing of the antibodies of the present invention.

[0099] In one aspect of the present disclosure, antibody or antibody fragment of the present invention binds the antigen expressed on tumor cells, such as prostate cancer cells when administrated in a subject; in another embodiment, antibody or antibody fragment of the present invention administrated in a subject binds the antigen expressed on neovasculature of solid tumors, such as the tumors with PSMA positive neovasculature, including but not limited to lung cancer, liver cancer, pancreas cancer, colon cancer, gastric cancer, breast cancer, ovarian cancer, kidney cancer, prostate cancer, bladder cancer, melanoma, glioma etc.

[0100] In one aspect of the disclosure, provided herein is a method of imaging a PSMA-containing tumor. In another aspect, the method comprises the step of applying the antibody or antigen-binding fragment provided herein that is operably linked to a secondary reagent. In another aspect, the prostate or other types solid tumor could be visualized once the antibody or antigen-binding fragment has bound its target. In yet another embodiment, the secondary reagent is a photoactivatable agent, a fluorophore, a radioisotope, a bioluminescent protein, a bioluminescent peptide, a fluorescent tag, a fluorescent protein, or a fluorescent peptide. Non-limiting examples of secondary reagents are provided below.

[0101] In one aspect, the detectable label or secondary reagent attached thereto, include labels such as, but not limited to a fluorescent label (e.g., fluorescein, isothiocyanate (FITC), a cyanine dye, etc.), an affinity label (e.g., biotin, avidin, protein A, etc.), an enzymatic label (e.g., horseradish peroxidase or alkaline phosphatase), or an isotopic label (e.g., 124I) or any other such detectable moiety to allow for detection and isolation of the antibody.

[0102] Detection methods for identification of binding species within the population of altered variable regions can be direct or indirect and can include, for example, the measurement of light emission, radioisotopes, calorimetric dyes and fluorochromes. Direct detection includes methods that operate without intermediates or secondary measuring procedures to assess the amount of bound antigen or ligand. Such methods generally employ ligands that are themselves labeled by, for example, radioactive, light emitting or fluorescent moieties. In contrast, indirect detection includes methods that operate through an intermediate or secondary measuring procedure. These methods generally employ molecules that specifically react with the antigen or ligand and can themselves be directly labeled or detected by a secondary reagent. For example, an antibody specific for a ligand can be detected using a secondary antibody capable of interacting with the first antibody specific for the ligand, again using the detection methods described above for direct detection. Indirect methods can additionally employ detection by enzymatic labels. Moreover, for the specific example of screening for catalytic antibodies, the disappearance of a substrate or the appearance of a product can be used as an indirect measure of binding affinity or catalytic activity.

[0103] In specific aspect, antibodies of the invention are labeled with near infrared dye. For example, antibodies of the invention may be labeled with IRDye800CW or Indocyanine Green (ICG).

[0104] In specific aspects, antibodies of the invention are attached to macrocyclic chelators useful for conjugating radiometal ions, including but not limited to, 111In, 177Lu, 90Y, 166Ho, 153Sm, 215Bi and 225Ac to polypeptides. In a preferred embodiment, the radiometal ion associated with the macrocyclic chelators attached to antibodies of the invention is 111In. In another preferred embodiment, the radiometal ion associated with the macrocyclic chelator attached to antibodies polypeptides of the invention is 90Y. In specific embodiments, the macrocyclic chelator is 1,4,7,10-tetraazacyclododecane-N,N',N",N"'-tetraacetic acid (DOTA). In specific embodiments, the macrocyclic chelator is .quadrature.-(5-isothiocyanato-2-methoxyphenyl)-1,4,7,10-tetraazacyclodo-decane-1,4,7,10-tetraacetic acid. In other specific embodiments, the DOTA is attached to the antibody of the invention via a linker molecule. Examples of linker molecules useful for conjugating a macrocyclic chelator such as DOTA to a polypeptide are commonly known in the art-see, for example, DeNardo et al., Clin Cancer Res. 4(10):2483-90, 1998; Peterson et al., Bioconjug. Chem. 10(4):553-7, 1999; and Zimmerman et al, Nucl. Med. Biol. 26(8):943-50, 1999. In addition, see U.S. Pat. Nos. 5,652,361 and 5,756,065, which disclose chelating agents that may be conjugated to antibodies, and methods for making and using them.Methods of Treatment

[0105] It is also described a method of treating a PSMA-expression cancer in a subject comprising the step of targeting said tumor cell with said antibody or antigen binding fragment.

[0106] In certain embodiments, the method comprises administering to the subject a composition comprising an antibody or antibody fragment. In one embodiment, the antibody or antibody fragment is operably linked to a biologically active agent or a combination of such agents, wherein said agent is a toxin, a radioisotope, a nanoparticle or a bio-active peptide.

[0107] In one embodiment, the disclosure provides a method of treating a solid tumor with abnormal PSMA expression, such as prostate cancer or solid tumors with high PSMA expression in neovasculature, in a subject comprising the step of targeting PSMA high expression cells with said antibody or antigen binding fragment. In certain aspects, the method described herein (not part of the invention) comprises administering to a subject having a tumor associated with high PSMA expression, a composition comprising an antibody or antibody fragment. In one aspect, the antibody or antibody fragment is operably linked to a biologically active agent or a combination of such agents, wherein said agent is a toxin, a radioisotope, a nanoparticle or a bio-active peptide. The tumor is prostate cancer.

[0108] It is further described a method of inhibiting or suppressing a tumor in a subject, which method comprises the step of administering an effective amount of the antibody or antigen-binding fragment of the present invention.

[0109] It is also described a method of delaying progression of a solid tumor in a subject, which method comprises administering to the subject an effective amount of the antibody or antigen-binding fragment thereof provided herein. The subject mounts an immune response against a vasculature of the solid tumor, thereby delaying progression of the solid tumor in the subject.

[0110] The term "operably linked" refers to the positioning / linking of the two or more molecules or sequences in such a manner as to ensure the proper function or expression of the molecule and sequence.

[0111] The term "therapeutically effective amount" refers to an amount that provides a therapeutic effect for a given condition and administration regimen. In the present invention, the therapeutic effect is the prevention or inhibition of tumor growth, infiltration, spread, metastasis or relapse, or preferably reduction of tumor burden, or the improvement of patient outcome.

[0112] The term "preventing, or treating" refers to any one or more of the following: delaying the onset of symptoms, reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, prolonging patient survival, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, increasing time to sustained progression, expediting remission, inducing remission, augmenting remission, speeding recovery, or increasing efficacy of or decreasing resistance to alternative therapeutics. In one aspect, "treating" refers to both therapeutic treatment and prophylactic or preventive measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder as described hereinabove.

[0113] "symptoms" are manifestation of a disease or pathological condition as described hereinabove.

[0114] The methods provided herein further comprise proteolytic inhibitors, pharmaceutical carriers, diluents, and adjuvants.

[0115] The compositions described herein may comprise an antibody, or antigen-binding fragment of this invention, alone or in some embodiments, in combination with a second pharmaceutically active agent. In one embodiment, the term "pharmaceutically active agent" refers to any medicament which satisfies the indicated purpose. In some embodiments, the pharmaceutically active agent of this invention includes, but is not limited to a chemotherapeutic drug, radio therapy drug, angiogenesis inhibitor, tumor imaging probe, immue modulator or any other tumor therapy and / or imaging drug / agent, and the like.

[0116] Provided herein is a method of delivering a biologically active agent and the antibody or antigen-binding fragment of the present invention for the treatment of a tumor in a subject. The method may comprise the step of concomitantly but individually administering the biologically active agent and the antibody or antigen-binding fragment, or the method may comprise the step of separately administering the biologically active agent and the antibody or antigen-binding fragment.

[0117] In one embodiment, the antibody or antigen-binding fragment provided herein are themselves "biologically active," meaning they are able to exert the biological action or an enhanced action of their corresponding parental antibodies even after modification, in particular in binding to the target antigen, inhibiting binding of ligands to receptors, further in terms of modulation, in particular inhibition of antigen-mediated signal transduction and prophylaxis or therapy of antigen-mediated diseases. The term "biologically active", when used in reference to any of the biologically active agents described herein also refers to the agent's ability to modulate the immune response in a manner that can lead to a preventive, diagnostic, or therapeutic effect as will be understood by a skilled artisan. In some embodiments, agents that are used to achieve this biological activity include but are not limited to a cytokine, an enzyme, a chemokine, a radioisotope, an enzymatically active toxin, a therapeutic nano particle or a chemotherapeutic agent, as will be understood by a skilled artisan.

[0118] In an alternate embodiment, the polypeptides of antibodies are conjugated or operably linked so as to function in their intended purpose to an enzyme in order to employ Antibody Dependent Enzyme Mediated Prodrug Therapy (ADEPT). ADEPT may be used by conjugating or operably linking the antibody or Fc fusion to a prodrug-activating enzyme that converts a prodrug (e.g. a peptidyl chemotherapeutic agent) to an active anti-cancer drug. The enzyme component of the immunoconjugate useful for ADEPT includes any enzyme capable of acting on a prodrug in such a way so as to convert it into its more active, cytotoxic form. Other additional modifications of the modified molecules provided herein are contemplated herein. For example, the polypeptide / antibody may be linked to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol.

[0119] In another embodiment, the antibody / polypeptide provided herein is administered with one or more immunomodulatory agents. Such agents may increase or decrease production of one or more cytokines, up- or down-regulate self-antigen presentation, mask MHC antigens, or promote the proliferation, differentiation, migration, or activation state of one or more types of immune cells. Immunomodulatory agents include but are not limited to: non-steroidal anti-inflammatory drugs (NSAIDs) such as aspirin, ibuprofen, celecoxib, diclofenac, etodolac, fenoprofen, indomethacin, ketoralac, oxaprozin, nabumentone, sulindac, tolmentin, rofecoxib, naproxen, ketoprofen, and nabumetone; steroids (e.g. glucocorticoids, dexamethasone, cortisone, hydroxycortisone, methylprednisolone, prednisone, prednisolone, trimcinolone, azulfidineicosanoids such as prostaglandins, thromboxanes, and leukotrienes; as well as topical steroids such as anthralin, calcipotriene, clobetasol, and tazarotene); cytokines such as TGFb, IFNa, IFNb, IFNg, IL-2, IL-4, IL-10; cytokine, chemokine, or receptor antagonists including antibodies, soluble receptors, and receptor-Fc fusions against BATF, B7, CCR2, CCR5, CD2, CD3, CD4, CD6, CD7, CD8, CD11, CD14, CD15, CD17, CD18, CD2O, CD23, CD28, CD40, CD40L, CD44, CD45, CD52, CD64, CD80, CD86, CD147, CD152, complement factors (C5, D) CTLA4, eotaxin, Fas, ICAM, ICOS, IFN-α IFN-β, IFN-γ., IFNAR, IgE, IL-1, IL-2, IL-2R, IL-4, IL-5R, IL-6, IL-8, IL-9 IL-12, IL-13, IL-13R1, IL-15, IL-18R, IL-23, integrins, LFA-1, LFA-3, MHC, selectins, TGF-β, TNF-α, TNF-β, TNF-R1, T-cell receptor, including Enbrel ®< . (etanercept), Humira ®< . (adalimumab), Remicade ®< (infliximab) , PD1 antibodies (OPDIVO ®< (nivolumab), KEYTRUDA ®< (pembrolizumab)) or PD-L1 antibodies (durvalumab, MPDL3280A); heterologous anti-lymphocyte globulin; other immunomodulatory molecules such as 2-amino-6-aryl-5 substituted pyrimidines, anti-idiotypic antibodies for MHC binding peptides and MHC fragments, azathioprine, brequinar, bromocryptine, cyclophosphamide, cyclosporine A, D-penicillamine, deoxyspergualin, FK506, glutaraldehyde, gold, hydroxychloroquine, leflunomide, malononitriloamides (e.g. leflunomide), methotrexate, minocycline, mizoribine, mycophenolate mofetil, rapamycin, and sulfasasazine.

[0120] In an alternate embodiment, antibodies of the present invention are administered with a cytokine. By "cytokine" as used herein is meant a generic term for proteins released by one cell population that act on another cell as intercellular mediators. Examples of such cytokines are lymphokines, monokines, and traditional polypeptide hormones. Included among the cytokines are fibroblast growth factor; prolactin; placental lactogen; tumor necrosis factor-alpha and -beta; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF-beta; platelet-growth factor; transforming growth factors (TGFs) such as TGF-alpha and TGF-beta; insulin-like growth factor-I and -II; erythropoietin (EPO); osteoinductive factors; interferons such as interferon-alpha, beta, and -gamma; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); interleukins (ILs) such as IL-1, IL-1alpha, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; IL-15, a tumor necrosis factor such as TNF-alpha or TNF-beta; and other polypeptide factors including LIF and kit ligand (KL). As used herein, the term cytokine includes proteins from natural sources or from recombinant cell culture, and biologically active equivalents of the native sequence cytokines.

[0121] A chemotherapeutic or other cytotoxic agent may be administered as a prodrug. The term "prodrug" refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. See, for example Wilman, 1986, Biochemical Society Transactions, 615th Meeting Belfast, 14:375-382; and Stella et al., "Prodrugs: A Chemical Approach to Targeted Drug Delivery," Directed Drug Delivery, Borchardt et al., (ed.): 247-267, Humana Press, 1985. The prodrugs that may find use with the compositions and methods as provided herein include but are not limited to phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, beta-lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs which can be converted into the more active cytotoxic free drug. Examples of cytotoxic drugs that can be derivatized into a prodrug form for use with the antibodies / polypeptides of the compositions and methods provided herein include but are not limited to any of the aforementioned chemotherapeutic agents.

[0122] In some embodiments, any combination of the antibody / polypeptide with the biological active agents specified above, i.e., a cytokine, an enzyme, a chemokine, a radioisotope, an enzymatically active toxin, or a chemotherapeutic agent can be applied. In another embodiment, the antibody / polypeptide can be operably-linked with the biologically active agent and used in the methods described herein or antibody / polypeptide provided herein can merely be used in combination with the biologically active agents, in a manner in which both are administered separately (i.e.-not conjugated) to achieve the desired preventive, diagnostic, or therapeutic effect.PSMA-targeted antibody drug conjugate

[0123] In one embodiment, the invention provides antibody-drug conjugates (ADCs), comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate). In one specific embodiment, the drugs include but not limited to tubulin inhibitor and DNA cleavage reagent, such as Maytansinoids, Auristatins, Dolastatins and Calicheamicin. It is herein further described methods of using the ADCs. In one aspect, an ADC comprises any of the above PSMA antibodies or antibody fragments covalently attached to a cytotoxic agent or a detectable agent.

[0124] The use of antibody-drug conjugates for the local delivery of cytotoxic or cytostatic agents, i.e. drugs to kill or inhibit tumor cells in the treatment of cancer (Syrigos and Epenetos (1999) Anticancer Research 19:605-614; Niculescu-Duvaz and Springer (1997) Adv. Drg Del. Rev. 26:151-172; U.S. Pat. No. 4,975,278) allows targeted delivery of the drug moiety to tumors, and intracellular accumulation therein, where systemic administration of these unconjugated drug agents may result in unacceptable levels of toxicity to normal cells as well as the tumor cells sought to be eliminated (Baldwin et al., (1986) Lancet pp. (Mar. 15, 1986):603-05; Thorpe, (1985) "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review," in Monoclonal Antibodies '84: Biological And Clinical applications, A. Pinchera et al. (ed.s), pp. 475-506). Maximal efficacy with minimal toxicity is sought thereby. Both polyclonal antibodies and monoclonal antibodies have been reported as useful in these strategies (Rowland et al., (1986) Cancer Immunol. Immunother., 21:183-87). Drugs used in these methods include daunomycin, doxorubicin, methotrexate, and vindesine (Rowland et al., (1986) supra). Toxins used in antibody-toxin conjugates include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al (2000) Jour. of the Nat. Cancer Inst. 92(19):1573-1581; Mandler et al (2000) Bioorganic & Med. Chem. Letters 10:1025-1028; Mandler et al (2002) Bioconjugate Chem. 13:786-791), maytansinoids (EP 1391213; Liu et al., (1996) Proc. Natl. Acad. Sci. USA 93:8618-8623), and calicheamicin (Lode et al (1998) Cancer Res. 58:2928; Hinman et al (1993) Cancer Res. 53:3336-3342). The toxins may affect their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.

[0125] Examples of antibody drug conjugates are, ZEVALIN ®< (ibritumomab tiuxetan, Biogen / Idec) which is an antibody-radioisotope conjugate composed of a murine IgG1 kappa monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes and 111In or 90Y radioisotope bound by a thiourea linker-chelator (Wiseman et al (2000) Eur. Jour. Nucl. Med. 27(7):766-77; Wiseman et al (2002) Blood 99(12):4336-42; Witzig et al (2002) J. Clin. Oncol. 20(10):2453-63; Witzig et al (2002) J. Clin. Oncol. 20(15):3262-69).

[0126] Additionally, MYLOTARG ™< (gemtuzumab ozogamicin, Wyeth Pharmaceuticals), an antibody drug conjugate composed of a human CD33 antibody linked to calicheamicin, was approved in 2000 for the treatment of acute myeloid leukemia by injection (Drugs of the Future (2000) 25(7):686; U.S. Pat. Nos. 4,970,198; 5,079,233; 5,585,089; 5,606,040; 5,693,762; 5,739,116; 5,767,285; 5,773,001).

[0127] Finally, the auristatin peptides, such as monomethyl auristatin E (MMAE), synthetic analogs of dolastatin, were conjugated to chimeric monoclonal antibodies cBR96 (specific to Lewis Y on carcinomas) and cAC10 (specific to CD30 on hematological malignancies) (Doronina et al (2003) Nature Biotechnology 21(7):778-784). The cAC10 is under therapeutic development.

[0128] Further, chemotherapeutic agents useful in the generation of ADCs are described herein. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. See, e.g., WO 93 / 21232 published Oct. 28, 1993. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 131I, 131In, 90Y, and 186Re. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis(p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al (1987) Science, 238:1098. Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleic acid to the antibody (WO94 / 11026).

[0129] Conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, maytansinoids, dolastatins, auristatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein.Maytansinoids:

[0130] Maytansine compounds suitable for use as maytansinoid drug moieties are well known in the art, and can be isolated from natural sources according to known methods, produced using genetic engineering techniques (see Yu et al (2002) PNAS 99:7968-7973), or maytansinol and maytansinol analogues prepared synthetically according to known methods.

[0131] Exemplary maytansinoid drug moieties include those having a modified aromatic ring, such as: C-19-dechloro (U.S. Pat. No. 4,256,746) (prepared by lithium aluminum hydride reduction of ansamytocin P2); C-20-hydroxy (or C-20-demethyl)+ / -C-19-dechloro (U.S. Pat. Nos. 4,361,650 and 4,307,016) (prepared by demethylation using Streptomyces or Actinomyces or dechlorination using LAH); and C-20-demethoxy, C-20-acyloxy (-OCOR), + / -dechloro (U.S. Pat. No. 4,294,757) (prepared by acylation using acyl chlorides). and those having modifications at other positions

[0132] Exemplary maytansinoid drug moieties also include those having modifications such as: C-9-SH (U.S. Pat. No. 4,424,219) (prepared by the reaction of maytansinol with H2S or P2S5); C-14-alkoxymethyl(demethoxy / CH2OR)(U.S. Pat. No. 4,331,598); C-14-hydroxymethyl or acyloxymethyl (CH2OH or CH2OAc) (U.S. Pat. No. 4,450,254) (prepared from Nocardia); C-15-hydroxy / acyloxy (U.S. Pat. No. 4,364,866) (prepared by the conversion of maytansinol by Streptomyces); C-15-methoxy (U.S. Pat. Nos. 4,313,946 and 4,315,929) (isolated from Trewia nudlflora); C-18-N-demethyl (U.S. Pat. Nos. 4,362,663 and 4,322,348) (prepared by the demethylation of maytansinol by Streptomyces); and 4,5-deoxy (U.S. Pat. No. 4,371,533) (prepared by the titanium trichloride / LAH reduction of maytansinol).

[0133] ADCs containing maytansinoids, methods of making same, and their therapeutic use are disclosed, for example, in U.S. Pat. Nos. 5,208,020; 5,416,064; 6,441,163 and European Patent EP 0 425 235 B1. Liu et al., Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996) described ADCs comprising a maytansinoid designated DM1 linked to the monoclonal antibody C242 directed against human colorectal cancer. The conjugate was found to be highly cytotoxic towards cultured colon cancer cells, and showed antitumor activity in an in vivo tumor growth assay. Chari et al., Cancer Research 52:127-131 (1992) describe ADCs in which a maytansinoid was conjugated via a disulfide linker to the murine antibody A7 binding to an antigen on human colon cancer cell lines, or to another murine monoclonal antibody TA.1 that binds the HER-2 / neu oncogene. The cytotoxicity of the TA.1-maytansonoid conjugate was tested in vitro on the human breast cancer cell line SK-BR-3, which expresses 3×10 5< HER-2 surface antigens per cell. The drug conjugate achieved a degree of cytotoxicity similar to the free maytansinoid drug, which could be increased by increasing the number of maytansinoid molecules per antibody molecule. The A7-maytansinoid conjugate showed low systemic cytotoxicity in mice.

[0134] An exemplary maytansinoids embodiment is DM1 (wherein the wavy line indicates the covalent attachment to a linker (L) of an antibody drug conjugate). Auristatins and Dolastatins:

[0135] In some embodiments, the ADC comprises an antibody of the invention conjugated to dolastatins or dolostatin peptidic analogs and derivatives, the auristatins (U.S. Pat. Nos. 5,635,483; 5,780,588). Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (U.S. Pat. No. 5,663,149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965). The dolastatin or auristatin drug moiety may be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (WO 02 / 088172).

[0136] Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, disclosed in "Senter et al, Proceedings of the American Association for Cancer Research, Volume 45, Abstract Number 623, presented Mar. 28, 2004 and described in United States Patent Publication No. 2005 / 0238649.

[0137] ADC using MMAE and MMAF with various linker components have been disclosed (US 2005 / 0238649, US08968742).

[0138] An exemplary auristatin embodiment is MMAE (wherein the wavy line indicates the covalent attachment to a linker (L) of an antibody drug conjugate).

[0139] Another exemplary auristatin embodiment is MMAF, wherein the wavy line indicates the covalent attachment to a linker (L) of an antibody drug conjugate (US 2005 / 0238649):

[0140] Typically, peptide-based drug moieties can be prepared by forming a peptide bond between two or more amino acids and / or peptide fragments. Such peptide bonds can be prepared, for example, according to the liquid phase synthesis method (see E. Schröder and K. Lübke, "The Peptides", volume 1, pp 76-136, 1965, Academic Press) that is well known in the field of peptide chemistry. The auristatin / dolastatin drug moieties may be prepared according to the methods of: U.S. Pat. No. 5,635,483; U.S. Pat. No. 5,780,588; Pettit et al (1989) J. Am. Chem. Soc. 111:5463-5465; Pettit et al (1998) Anti-Cancer Drug Design 13:243-277; Pettit, G. R., et al. Synthesis, 1996, 719-725; Pettit et al (1996) J. Chem. Soc. Perkin Trans. 1 5:859-863; and Doronina (2003) Nat Biotechnol 21(7):778-784.Calicheamicin:

[0141] In other embodiments, the ADC comprises an antibody of the invention conjugated to one or more calicheamicin molecules. The calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations. For the preparation of conjugates of the calicheamicin family, see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296 (all to American Cyanamid Company). Structural analogues of calicheamicin which may be used include, but are not limited to, γ1 I, α2 I, α3 I, N-acetyl-γ1 I, PSAG and θ1 I (Hinman et al., Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998) and the aforementioned U.S. patents to American Cyanamid). Another anti-tumor drug that the antibody can be conjugated is QFA which is an antifolate. Both calicheamicin and QFA have intracellular sites of action and do not readily cross the plasma membrane. Therefore, cellular uptake of these agents through antibody mediated internalization greatly enhances their cytotoxic effects.Other Cytotoxic Agents:

[0142] Other antitumor agents that can be conjugated to the antibodies of the invention include BCNU, streptozoicin, vincristine and 5-fluorouracil, the family of agents known collectively LL-E33288 complex described in U.S. Pat. Nos. 5,053,394, 5,770,710, as well as esperamicins (U.S. Pat. No. 5,877,296).

[0143] Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93 / 21232 published Oct. 28, 1993.

[0144] The present invention further contemplates an ADC formed between an antibody and a compound with nucleolytic activity (e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).

[0145] For selective destruction of the tumor, the antibody may comprise a highly radioactive atom. A variety of radioactive isotopes are available for the production of radioconjugated antibodies. Examples include At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu. When the conjugate is used for detection, it may comprise a radioactive atom for scintigraphic studies, for example tc99m or I123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.

[0146] The radio- or other labels may be incorporated in the conjugate in known ways. For example, the peptide may be biosynthesized or may be synthesized by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen. Labels such as tc99m or I123, Re186, Re188 and In111 can be attached via a cysteine residue in the peptide. Yttrium-90 can be attached via a lysine residue. The IODOGEN method (Fraker et al (1978) Biochem. Biophys. Res. Commun. 80: 49-57 can be used to incorporate iodine-123. "Monoclonal Antibodies in Immunoscintigraphy" (Chatal, CRC Press 1989) describes other methods in detail.PSMA-targeted Antibody-Drug Conjugate Compounds:

[0147] The present invention provides, inter alia, antibody-drug conjugate compounds for targeted delivery of drugs. The inventors have made the discovery that the antibody-drug conjugate compounds have potent cytotoxic and / or cytostatic activity against cells expressing PSMA. The antibody-drug conjugate compounds comprise an Antibody unit covalently linked to at least one Drug unit. The Drug units can be covalently linked directly or via a Linker unit (-LU-).

[0148] In some embodiments, the antibody drug conjugate compound has the following formula:         Ab-(LU-D)p or a pharmaceutically acceptable salt or solvate thereof; wherein: Ab is the Antibody unit, e.g., gy1 or its mutated variants derived full antibody or antibody fragment of the present invention, , such as PSMAb, and (LU-D) is a Linker unit-Drug unit moiety, wherein: LU- is a Linker unit, and -D is a drug unit having cytostatic or cytotoxic activity against a target cell; and p is an integer from 1 to 20.

[0149] In some embodiments, p ranges from 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some embodiments, p ranges from 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4 or 2 to 3. In other embodiments, p is 1, 2, 3, 4, 5 or 6. In some embodiments, p is 2 or 4.

[0150] In some embodiments, the antibody drug conjugate compound has the following formula:         Ab-(A a -W w -Y y -D) p or a pharmaceutically acceptable salt or solvate thereof, wherein: Ab is the Antibody unit, e.g., gy1 or its mutated variants derived full antibody or antibody fragment of the present invention, such as PSMAb; and -A a -W w -Y y - is a Linker unit (LU), wherein: -A- is a Stretcher unit, a is 0 or 1, each -W- is independently an Amino Acid unit, w is an integer ranging from 0 to 12, -Y- is a self-immolative spacer unit, y is 0, 1 or 2; -D is a drug units having cytostatic or cytotoxic activity against the target cell; and p is an integer from 1 to 20.

[0151] In some embodiments, a is 0 or 1, w is 0 or 1, and y is 0, 1 or 2. In some embodiments, a is 0 or 1, w is 0 or 1, and y is 0 or 1. In some embodiments, p ranges from 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some embodiments, p ranges from 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4 or 2 to 3. In other embodiments, p is 1, 2, 3, 4, 5 or 6. In some embodiments, p is 2 or 4. In some embodiments, when w is not zero, y is 1 or 2. In some embodiments, when w is 1 to 12, y is 1 or 2. In some embodiments, w is 2 to 12 and y is 1 or 2. In some embodiments, a is 1 and w and y are 0.

[0152] For compositions comprising a plurality antibodies, the drug loading is represented by p, the average number of drug molecules per Antibody. Drug loading may range from 1 to 20 drugs (D) per Antibody. The average number of drugs per antibody in preparation of conjugation reactions may be characterized by conventional means such as mass spectroscopy, ELISA assay, and HPLC. The quantitative distribution of Antibody-Drug-Conjugates in terms of p may also be determined. In some instances, separation, purification, and characterization of homogeneous Antibody-Drug-conjugates where p is a certain value from Antibody-Drug-Conjugates with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis. In exemplary embodiments, p is from 2 to 8.

[0153] The generation of Antibody-drug conjugate compounds can be accomplished by any technique known to the skilled artisan. Briefly, the Antibody-drug conjugate compounds comprise gy1 or its mutated variants derived full antibody or antibody fragment of the present invention as the Antibody unit, a drug, and optionally a linker that joins the drug and the binding agent. In a preferred embodiment, the Antibody is antibody or antibody fragments derived from gy1 or its variants with point mutations, as described elsewhere herein. A number of different reactions are available for covalent attachment of drugs and / or linkers to binding agents. This is often accomplished by reaction of the amino acid residues of the binding agent, e.g., antibody molecule, including the amine groups of lysine, the free carboxylic acid groups of glutamic and aspartic acid, the sulfhydryl groups of cysteine and the various moieties of the aromatic amino acids. One of the most commonly used non-specific methods of covalent attachment is the carbodiimide reaction to link a carboxy (or amino) group of a compound to amino (or carboxy) groups of the antibody. Additionally, bifunctional agents such as dialdehydes or imidoesters have been used to link the amino group of a compound to amino groups of an antibody molecule. Also available for attachment of drugs to binding agents is the Schiff base reaction. This method involves the periodate oxidation of a drug that contains glycol or hydroxy groups, thus forming an aldehyde which is then reacted with the binding agent. Attachment occurs via formation of a Schiff base with amino groups of the binding agent. Isothiocyanates can also be used as coupling agents for covalently attaching drugs to binding agents. Other techniques are known to the skilled artisan and within the scope of the present invention.

[0154] In certain embodiments, an intermediate, which is the precursor of the linker, is reacted with the drug under appropriate conditions. In certain embodiments, reactive groups are used on the drug and / or the intermediate. The product of the reaction between the drug and the intermediate, or the derivatized drug, is subsequently reacted with the gy1 or its variants derived full antibody or antibody fragment under appropriate conditions.PSMA-targeted CAR-T or CAR-NK

[0155] Recent developments using chimeric antigen receptor (CAR) modified autologous T cell (CART) therapy, which relies on redirecting T cells to a suitable cell-surface molecule on cancer cells such as B cell malignancies, show promising results in harnessing the power of the immune system to treat B cell malignancies and other cancers (see, e.g., Sadelain et al., Cancer Discovery 3:388-398 (2013)). The clinical results of the murine derived CART19 (i.e., "CTL019") have shown promise in establishing complete remissions in patients suffering with CLL as well as in childhood ALL (see, e.g., Kalos et al., Sci Transl Med 3:95ra73 (2011), Porter et al., NEJM 365:725-733 (2011), Grupp et al., NEJM 368:1509-1518 (2013)). Besides the ability for the chimeric antigen receptor on the genetically modified T cells to recognize and destroy the targeted cells, a successful therapeutic T cell therapy needs to have the ability to proliferate and persist over time, and to further monitor for leukemic cell escapees. The variable quality of T cells whether it's a result of energy, suppression or exhaustion will have effects on CAR-transformed T cells' performance but for which skilled practitioners have limited control over at this time. To be effective, CAR transformed patient T cells need to persist and maintain the ability to proliferate in response to the CAR's antigen. It has been shown that ALL patient T cells perform can do this with CART19 comprising a murine scFv (see, e.g., Grupp et al., NEJM 368:1509-1518 (2013)).

[0156] The invention addresses controlling an immune response in patients by providing fully human antibody fragments (e.g., scFv) that bind PMSA integrated into a Chimeric Antigen Receptor (CAR) construct that will redirect the engineered T cell to recognize and kill PSMA positive tumor cells.

[0157] The invention provides an isolated chimeric antigen receptor (CAR), wherein the CAR comprises the antibody or fragment described herein, a transmembrane domain, and an intracellular signaling domain comprising one or more stimulatory domains.

[0158] Accordingly, in one aspect, the invention pertains to an isolated nucleic acid molecule encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an antibody or antibody fragment which includes a PSMA binding domain, a transmembrane domain, and an intracellular signaling domain (e.g., an intracellular signaling domain comprising a costimulatory domain and / or a primary signaling domain). In one embodiment, the CAR comprises an antibody or antibody fragment which includes a fully human anti-PSMA binding domain described herein, a transmembrane domain described herein, and an intracellular signaling domain described herein (e.g., an intracellular signaling domain comprising a costimulatory domain and / or a primary signaling domain).

[0159] The anti-PSMA binding domain comprises an antibody or antibody fragment described elsewhere herein. For example, in certain embodiments, the anti-PSMA binding domain comprises gy1, gy1-2 or PSMAb, as described elsewhere herein.

[0160] For example, in certain embodiments, the anti-PSMA binding domain comprises one or more of SEQ ID NO: 3.

[0161] For example, in certain embodiments, the anti-PSMA binding domain is encoded by SEQ ID NO: 2.

[0162] In one embodiment, the encoded transmembrane domain is a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD27, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154. In one embodiment, the encoded transmembrane domain comprises the amino acid sequence of SEQ ID NO: 75. In one embodiment, the encoded transmembrane domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO:75, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:75. In one embodiment, the nucleic acid sequence encoding the transmembrane domain comprises a sequence of SEQ ID NO:74, or a sequence with 95-99% identify thereof.

[0163] In one embodiment, the encoded anti-PSMA binding domain is connected to the transmembrane domain by a hinge region, e.g., a hinge region described herein. In one embodiment, the encoded hinge region comprises the amino acid sequence of SEQ ID NO:73, or a sequence with 95-99% identity thereof. In one embodiment, the nucleic acid sequence encoding the hinge region comprises a sequence of SEQ ID NO:72, or a sequence with 95-99% identify thereof.

[0164] In one embodiment, the nucleic acid molecule further comprises a sequence encoding a costimulatory domain. In one embodiment, the costimulatory domain is a functional signaling domain obtained from a protein selected from the group consisting of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a / CD18), ICOS (CD278), and 4-1BB (CD137). In one embodiment, the encoded costimulatory domain comprises a sequence of SEQ ID NO:77. In one embodiment, the encoded costimulatory domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO:77, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:77. In one embodiment, the nucleic acid sequence encoding the costimulatory domain comprises a sequence of SEQ ID NO:76, or a sequence with 95-99% identify thereof. In one embodiment, the isolated nucleic acid molecule further comprises a sequence encoding an intracellular signaling domain, e.g., an intracellular signaling domain described herein. In one embodiment, the encoded intracellular signaling domain comprises a functional signaling domain of 4-1BB and / or a functional signaling domain of CD3 zeta. In one embodiment, the encoded functional CD3 zeta intracellular signal domain comprises a sequence of SEQ ID NO: 79. In one embodiment, the encoded costimulatory domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO:79, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:79. In one embodiment, the nucleic acid sequence encoding the costimulatory domain comprises a sequence of SEQ ID NO:78, or a sequence with 95-99% identify thereof. In another embodiment, the CAR constructure may contain two or more costimulation signal domains that selected from the group consisting of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a / CD18), ICOS (CD278), and 4-1BB (CD137).

[0165] In another aspect, the invention pertains to an nucleic acid molecule encoding a CAR construct comprising a leader sequence, e.g., a leader sequence described herein, e.g., of SEQ ID NO:71; a human anti-PSMA binding domain described herein; a hinge region described herein, e.g., of SEQ ID NO:73; a transmembrane domain described herein, e.g., a transmembrane domain comprising SEQ ID NO:75; and an intracellular signaling domain, e.g., an intracellular signaling domain described herein. In one embodiment, the encoded intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein, e.g., a 4-1BB costimulatory domain having a sequence of SEQ ID NO:77, and / or a primary signaling domain, e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:79. In one embodiment, the isolated nucleic acid molecule encoding the CAR construct includes a leader sequence encoded by the nucleic acid sequence of SEQ ID NO:71, or a sequence with 95-99% identity thereto.

[0166] In another embodiment, the CAR comprises the amino acid sequence of SEQ ID NO: 81, or a sequence with 95-99% identity thereto. In one embodiment, the CAR is encoded by a nucleotide sequence comprising SEQ ID NO:80 or a sequence with 95-99% identity thereto.

[0167] The invention provides an isolated host cell which expresses the inventive nucleic acid sequence encoding the CAR described herein. In one embodiment, the host cell is a T- cell. The T-cell of the invention can be any T-cell, such as a cultured T-cell, e.g., a primary T-cell, or a T-cell from a cultured T-cell line, or a T-cell obtained from a mammal. If obtained from a mammal, the T-cell can be obtained from numerous sources, including but not limited to blood, bone marrow, lymph node, the thymus, or other tissues or fluids. T-cells can also be enriched for or purified. The T-cell preferably is a human T-cell (e.g., isolated from a human). The T-cell can be of any developmental stage, including but not limited to, a CD4+ / CD8+ double positive T-cell, a CD4+ helper T-cell, e.g., Th, and Th2 cells, a CD8+ T- cell (e.g., a cytotoxic T-cell), a tumor infiltrating cell, a memory T-cell, a naive T-cell, and the like. In one embodiment, the T-cell is a CD8+ T-cell or a CD4+ T-cell. T-cell lines are available from, e.g., the American Type Culture Collection (ATCC, Manassas, VA), and the German Collection of Microorganisms and Cell Cultures (DSMZ) and include, for example, Jurkat cells (ATCC TIB- 152), Sup-T1 cells (ATCC CRL-1942), RPMI 8402 cells (DSMZ ACC-290), Karpas 45 cells (DSMZ ACC-545), and derivatives thereof.

[0168] In another embodiment, the host cell is a natural killer (NK) cell. NK cells are a type of cytotoxic lymphocyte that plays a role in the innate immune system. NK cells are defined as large granular lymphocytes and constitute the third kind of cells differentiated from the common lymphoid progenitor which also gives rise to B and T lymphocytes (see, e.g., Immunobiology, 5th ed., Janeway et al., eds., Garland Publishing, New York, NY (2001)). NK cells differentiate and mature in the bone marrow, lymph node, spleen, tonsils, and thymus. Following maturation, NK cells enter into the circulation as large lymphocytes with distinctive cytotoxic granules. NK cells are able to recognize and kill some abnormal cells, such as, for example, some tumor cells and virus-infected cells, and are thought to be important in the innate immune defense against intracellular pathogens. As described above with respect to T-cells, the NK cell can be any NK cell, such as a cultured NK cell, e.g., a primary NK cell, or an NK cell from a cultured NK cell line, or an NK cell obtained from a mammal. If obtained from a mammal, the NK cell can be obtained from numerous sources, including but not limited to blood, bone marrow, lymph node, the thymus, or other tissues or fluids. NK cells can also be enriched for or purified. The NK cell preferably is a human NK cell (e.g., isolated from a human). NK cell lines are available from, e.g., the American Type Culture Collection (ATCC, Manassas, VA) and include, for example, NK-92 cells (ATCC CRL-2407), NK92MI cells (ATCC CRL-2408), and derivatives thereof.

[0169] In another aspect, it is provided a population of CAR-expressing cells, e.g., CART cells. In some embodiments, the population of CAR-expressing cells comprises a mixture of cells expressing different CARs. For example, in one embodiment, the population of CART cells can include a first cell expressing a CAR having an anti-PSMA binding domain described herein, and a second cell expressing a CAR having a different anti- PSMA binding domain, e.g., an anti-PSMA binding domain described herein that differs from the anti- PSMA binding domain in the CAR expressed by the first cell. As another example, the population of CAR-expressing cells can include a first cell expressing a CAR that includes an anti- PSMA binding domain, e.g., as described herein, and a second cell expressing a CAR that includes an antigen binding domain to a target other than PSMA (e.g., PSCA). In one embodiment, the population of CAR-expressing cells includes, e.g., a first cell expressing a CAR that includes a primary intracellular signaling domain, and a second cell expressing a CAR that includes a secondary signaling domain.

[0170] In another aspect, it is herein provided a population of cells wherein at least one cell in the population expresses a CAR having an anti- PSMA domain described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a CAR-expressing cell. For example, in one embodiment, the agent can be an agent which inhibits an inhibitory molecule. Inhibitory molecules, e.g., can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response. Examples of inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFR beta. In one embodiment, the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein. In one embodiment, the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PD1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFR beta, or a fragment of any of these (e.g., at least a portion of an extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 41BB, CD27 or CD28, e.g., as described herein) and / or a primary signaling domain (e.g., a CD3 zeta signaling domain described herein). In one embodiment, the agent comprises a first polypeptide of PD1 or a fragment thereof (e.g., at least a portion of the extracellular domain of PD1), and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and / or a CD3 zeta signaling domain described herein).

[0171] The present invention also provides nucleic acid molecules encoding one or more CAR constructs described herein. In one aspect, the nucleic acid molecule is provided as a messenger RNA transcript. In one aspect, the nucleic acid molecule is provided as a DNA construct.

[0172] The nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the gene of interest can be produced synthetically, rather than cloned.

[0173] The present invention also provides vectors in which a DNA of the present invention is inserted. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.

[0174] In another embodiment, the vector comprising the nucleic acid encoding the desired CAR of the invention is an adenoviral vector (A5 / 35). In another embodiment, the expression of nucleic acids encoding CARs can be accomplished using of transposons such as sleeping beauty, crisper, CAS9, and zinc finger nucleases. See below June et al. 2009 Nature Reviews Immunology 9.10: 704-716.

[0175] In brief summary, the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector. The vectors can be suitable for replication and integration eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.

[0176] The expression constructs described herein may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466. In another embodiment, the invention provides a gene therapy vector.

[0177] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

[0178] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01 / 96584; WO 01 / 29058; and U.S. Pat. No. 6,326,193).

[0179] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, lentivirus vectors are used.

[0180] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.

[0181] An example of a promoter that is capable of expressing a CAR transgene in a mammalian T cell is the EFla promoter. The native EFla promoter drives expression of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. The EFla promoter has been extensively used in mammalian expression plasmids and has been shown to be effective in driving CAR expression from transgenes cloned into a lentiviral vector. See, e.g., Milone et al., Mol. Ther. 17(8): 1453-1464 (2009). In one aspect, the EF1a promoter comprises the sequence provided as SEQ ID NO:100.

[0182] Another example of a promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the elongation factor-la promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.

[0183] In order to assess the expression of a CAR polypeptide or proteins thereof, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.

[0184] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5'flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.

[0185] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.

[0186] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and / or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY). A preferred method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection

[0187] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.

[0188] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle). Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles or other suitable sub-micron sized delivery system.

[0189] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid / DNA or lipid / expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.

[0190] Lipids suitable for use can be obtained from commercial sources. For example, dimyristyl phosphatidylcholine ("DMPC") can be obtained from Sigma, St. Louis, Mo.; dicetyl phosphate ("DCP") can be obtained from K & K Laboratories (Plainview, N.Y.); cholesterol ("Choi") can be obtained from Calbiochem-Behring; dimyristyl phosphatidylglycerol ("DMPG") and other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, Ala.). Stock solutions of lipids in chloroform or chloroform / methanol can be stored at about -20° C. Chloroform is used as the only solvent since it is more readily evaporated than methanol. "Liposome" is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 Glycobiology 5: 505-10). However, compositions that have different structures in solution than the normal vesicular structure are also encompassed. For example, the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules. Also contemplated are lipofectamine-nucleic acid complexes.

[0191] Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present invention, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, "molecular biological" assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical" assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.

[0192] The present invention further provides a vector comprising a CAR encoding nucleic acid molecule. In one aspect, a CAR vector can be directly transduced into a cell, e.g., a T cell or NK cell. In one aspect, the vector is a cloning or expression vector, e.g., a vector including, but not limited to, one or more plasmids (e.g., expression plasmids, cloning vectors, minicircles, minivectors, double minute chromosomes), retroviral and lentiviral vector constructs. In one aspect, the vector is capable of expressing the CAR construct in mammalian T cells. In one aspect, the mammalian T cell is a human T cell.Sources of T Cells

[0193] Prior to expansion and genetic modification, a source of T cells is obtained from a subject. The term "subject" is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain aspects, any number of T cell lines available in the art, may be used. In certain aspects, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll ™< separation. In one preferred aspect, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In one aspect, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. The cells may be washed with phosphate buffered saline (PBS). In an alternative aspect, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium can lead to magnified activation. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated "flow-through" centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.

[0194] In one aspect, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation. A specific subpopulation of T cells, such as CD3+, CD28+, CD4+, CD8+, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques. For example, in one aspect, T cells are isolated by incubation with anti-CD3 / anti-CD28 (e.g., 3×28)-conjugated beads, such as DYNABEADS ®< M-450 CD3 / CD28 T, for a time period sufficient for positive selection of the desired T cells. In one aspect, the time period is about 30 minutes. In a further aspect, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further aspect, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another preferred aspect, the time period is 10 to 24 hours. In one aspect, the incubation time period is 24 hours. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells. Thus, by simply shortening or lengthening the time T cells are allowed to bind to the CD3 / CD28 beads and / or by increasing or decreasing the ratio of beads to T cells (as described further herein), subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process. Additionally, by increasing or decreasing the ratio of anti-CD3 and / or anti-CD28 antibodies on the beads or other surface, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points. The skilled artisan would recognize that multiple rounds of selection can also be used in the context of this invention. In certain aspects, it may be desirable to perform the selection procedure and use the "unselected" cells in the activation and expansion process. "Unselected" cells can also be subjected to further rounds of selection.

[0195] Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. One method is cell sorting and / or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8. In certain aspects, it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4+, CD25+, CD62Lhi, GITR+, and FoxP3+. Alternatively, in certain aspects, T regulatory cells are depleted by anti-C25 conjugated beads or other similar method of selection.

[0196] In one embodiment, a T cell population can be selected that expresses one or more of IFN-γ, TNFα, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, or other appropriate molecules, e.g., other cytokines. Methods for screening for cell expression can be determined, e.g., by the methods described in PCT Publication No.: WO 2013 / 126712.

[0197] For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In certain aspects, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (e.g., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one aspect, a concentration of 2 billion cells / ml is used. In one aspect, a concentration of 1 billion cells / ml is used. In a further aspect, greater than 100 million cells / ml is used. In a further aspect, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells / ml is used. In yet one aspect, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells / ml is used. In further aspects, concentrations of 125 or 150 million cells / ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (e.g., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.

[0198] In a related aspect, it may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized. This selects for cells that express high amounts of desired antigens to be bound to the particles. For example, CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute concentrations. In one aspect, the concentration of cells used is 5×10e6 / ml. In other aspects, the concentration used can be from about 1×10 5< / ml to 1×10 6< / ml, and any integer value in between.

[0199] In other aspects, the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C or at room temperature.

[0200] T cells for stimulation can also be frozen after a washing step. Wishing not to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After the washing step that removes plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80° C at a rate of 1° C per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20° C or in liquid nitrogen.

[0201] In certain aspects, cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods described herein.Activation and Expansion of T Cells

[0202] T cells may be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.

[0203] Generally, the T cells may be expanded by contact with a surface having attached thereto an agent that stimulates a CD3 / TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells. In particular, T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4+ T cells or CD8+ T cells, an anti-CD3 antibody and an anti-CD28 antibody. Examples of an anti-CD28 antibody include 9.3, B-T3, XR-CD28 (Diaclone, Besancon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol. Meth. 227(1-2):53-63, 1999).

[0204] In certain aspects, the primary stimulatory signal and the costimulatory signal for the T cell may be provided by different protocols. For example, the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in "cis" formation) or to separate surfaces (i.e., in "trans" formation). Alternatively, one agent may be coupled to a surface and the other agent in solution. In one aspect, the agent providing the costimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain aspects, both agents can be in solution. In one aspect, the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents. In this regard, see for example, U.S. Patent Application Publication Nos. 20040101519 and 20060034810 for artificial antigen presenting cells (aAPCs) that are contemplated for use in activating and expanding T cells in the present invention.

[0205] In one aspect, the two agents are immobilized on beads, either on the same bead, i.e., "cis," or to separate beads, i.e., "trans." By way of example, the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the costimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts. In one aspect, a 1:1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used. In certain aspects of the present invention, a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular aspect an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1. In one aspect, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect of the present invention, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain aspects of the invention, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1. In one particular aspect, a 1:100 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:75 CD3:CD28 ratio of antibody bound to beads is used. In a further aspect, a 1:50 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:30 CD3:CD28 ratio of antibody bound to beads is used. In one preferred aspect, a 1:10 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:3 CD3:CD28 ratio of antibody bound to the beads is used. In yet one aspect, a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.

[0206] Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells. As those of ordinary skill in the art can readily appreciate, the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many. In certain aspects the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further aspects the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells. The ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, and 15:1 with one preferred ratio being at least 1:1 particles per T cell. In one aspect, a ratio of particles to cells of 1:1 or less is used. In one particular aspect, a preferred particle: cell ratio is 1:5. In further aspects, the ratio of particles to cells can be varied depending on the day of stimulation. For example, in one aspect, the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition). In one particular aspect, the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation. In one aspect, particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation. In one aspect, the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation. In one aspect, particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation. One of skill in the art will appreciate that a variety of other ratios may be suitable for use in the present invention. In particular, ratios will vary depending on particle size and on cell size and type. In one aspect, the most typical ratios for use are in the neighborhood of 1:1, 2:1 and 3:1 on the first day.

[0207] In further aspects, the cells, such as T cells, are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured. In an alternative aspect, prior to culture, the agent-coated beads and cells are not separated but are cultured together. In a further aspect, the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.

[0208] By way of example, cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3×28 beads) to contact the T cells. In one aspect the cells (for example, 104 to 109 T cells) and beads (for example, DYNABEADS ®< M-450 CD3 / CD28 T paramagnetic beads at a ratio of 1:1) are combined in a buffer, for example PBS (without divalent cations such as, calcium and magnesium). Again, those of ordinary skill in the art can readily appreciate any cell concentration may be used. For example, the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest. Accordingly, any cell number is within the context of the present invention. In certain aspects, it may be desirable to significantly decrease the volume in which particles and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and particles. For example, in one aspect, a concentration of about 2 billion cells / ml is used. In one aspect, greater than 100 million cells / ml is used. In a further aspect, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells / ml is used. In yet one aspect, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells / ml is used. In further aspects, concentrations of 125 or 150 million cells / ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain aspects. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.

[0209] In one aspect of the present disclosure, the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In one aspect, the mixture may be cultured for 21 days. In one aspect of the invention the beads and the T cells are cultured together for about eight days. In one aspect, the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more. Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-γ, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ, and TNF-α or any other additives for the growth of cells known to the skilled artisan. Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol. Media can include RPMI 1640, AIM-V, DMEM, MEM, α-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and / or an amount of cytokine(s) sufficient for the growth and expansion of T cells. Antibiotics, e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject. The target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C.) and atmosphere (e.g., air plus 5% CO2).

[0210] T cells that have been exposed to varied stimulation times may exhibit different characteristics. For example, typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (TH, CD4+) that is greater than the cytotoxic or suppressor T cell population (TC, CD8+). Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of TH cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising predominately of TH cells may be advantageous. Similarly, if an antigen-specific subset of TC cells has been isolated it may be beneficial to expand this subset to a greater degree.

[0211] Further, in addition to CD4 and CD8 markers, other phenotypic markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.

[0212] Once a PSMA CAR is constructed, various assays can be used to evaluate the activity of the molecule, such as but not limited to, the ability to expand T cells following antigen stimulation, sustain T cell expansion in the absence of re-stimulation, and anti-cancer activities in appropriate in vitro and animal models. Assays to evaluate the effects of a PSMA CAR are described in further detail below

[0213] Western blot analysis of CAR expression in primary T cells can be used to detect the presence of monomers and dimers. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Very briefly, T cells (1:1 mixture of CD4+ and CD8+ T cells) expressing the CARs are expanded in vitro for more than 10 days followed by lysis and SDS-PAGE under reducing conditions. CARs containing the full length TCR-ζ cytoplasmic domain and the endogenous TCR-ζ chain are detected by western blotting using an antibody to the TCR-ζ chain. The same T cell subsets are used for SDS-PAGE analysis under non-reducing conditions to permit evaluation of covalent dimer formation.

[0214] In vitro expansion of CAR+ T cells following antigen stimulation can be measured by flow cytometry. For example, a mixture of CD4+ and CD8+ T cells are stimulated with αCD3 / αCD28 aAPCs followed by transduction with lentiviral vectors expressing GFP under the control of the promoters to be analyzed. Exemplary promoters include the CMV IE gene, EF-1α, ubiquitin C, or phosphoglycerokinase (PGK) promoters.

[0215] Sustained CAR+ T cell expansion in the absence of re-stimulation can also be measured. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Briefly, mean T cell volume (fl) is measured on day 8 of culture using a Coulter Multisizer III particle counter following stimulation with αCD3 / αCD28 coated magnetic beads on day 0, and transduction with the indicated CAR on day 1.PSMA targeted bispecific antibodies

[0216] Different from natural antibodies, bispecific antibodies (BsAbs) are artificial antibodies that bear double specificities, targeting two different tumor antigens, or one on tumor cells and the other on effector cells that can recruit the immunological effector cells to tumor sites efficiently and activate them to kill tumor cells specifically. Examples for the former, i.e., BsAbs targeting two different tumor associated antigens are bH1, which binds Her2 and VEGF simultaneously (Bostrom J1 et al. 2009, Science 323: 1610-4), or ErBb2 / ErBb3 dual targeting bispecific scFv (Robinson MK et al. 2008, Br J Cancer 99:1415-25). The two tumor associated antigens could both be expressed on tumor cells, or one expressed on tumor cells and the other on tumor cell associated cells, such as tumor microenvironment cells, e.g., fibroblast, vasular cells, endothelium, pericytes or immuno cells in tumor microenvironent (macrophage, B cells, T cells etc.). Examples for the latter, i.e., BsAbs targeting one tumor associated antigen and an immunoactiavable antigen are BsAbs with one arm targeting a tumor antigen, such as Her2, CD19, or CD123 and the other arm targeting immunoactivatable antigen, such as CD3 or CD16 (Kontermann RE, et al. 2015, Drug Discovery Today 20: 838-847) that could engage tumor cells and immuno cells such as T cells, NK cells or macrophage etc..

[0217] A BsAb containg an anti-CD3 antibody will engage T cells and tumor cells togather, leading to killing of the tumor cells (Muller and Kontermann, BioDrugs 2010; 24: 89-98, Baeuerle and Reinhardt 2009, Cancer Research 96: 4941) activated T cells. Blinatumomab (Bargou et al, Science 2008, 321: 974- 976) is a single chain antibody construct named BiTE which induces cytotoxicity by targeting CD19 and CD3. Other antibody fragment based T-cell engaging bispecifics have been described (Moore et al. 2011, Blood 117 :4542-4551, Baeuerle et el . Current opinion in Molecular Therapeutics 2009, 11: 22-30). The BiTE ™< format is a bi-specific single chain antibody construct that links variable domains derived from two different antibodies. Blinatumomab, however, possesses poor half-life in vivo, and is difficult to manufacture in terms of production and stability. Thus, there is a need for improved bi-specific antibodies, capable of targeting T-cells to tumor cells and having improved manufacturability.

[0218] BsAbs are hybrid proteins that can be generated by chemical cross-link, hybridoma technology or genetic methods. In the chemical cross-link method, two kinds of monoclonal antibodies and fragments thereof were dissociated by reductants to generate monovalent antibodies and fragments thereof. The resulting BsAb is constructed via chemical cross-linking of two monovalent antibodies and fragments thereof from different parental antibodies. This strategy can be used for rapid production of BsAb in large scale but BsAb can be inactivated sometimes during cross-link and it is difficult to guarantee the homogeneity of products. Another strategy for production of BsAb is hybridoma technology by which an established hybridoma cell line secreting one monoclonal antibody was fused to spleen cells immunized with the other antigen or two established hybridoma cell lines secreting two different monoclonal antibodies were fused each other to create hybrid hybridomas. The former resulting hybridoma is called dimeric hybridoma and tetrameric hybridoma. Generally, BsAb produced by hybridoma technology keeps high bioactivities. However, the procedures are tedious and time-consuming and it is not easy to isolate BsAb from other non-active and unwanted antibodies generated simultaneously. These BsAb formats encountered another predictable problems: too large size and murine components contained in BsAb are immunogenic in patients and will induce the production of human anti-mouse antibodies (HAMA), which may prevent reuse of these BsAbs in clinic. Furthermore, production and purification of these formats of BsAb are expensive, which limits the application of BsAbs in clinic. Replacement of these traditional methods with gene recombination approaches has accelerated progress in this area. Based on the technology of small molecular antibodies, production of BsAb by gene engineering has advantages over those described above, such as the stability of process, large scale production, low cost and easy-to-use. Gene engineering has led to the development of various small molecular BsAb formats by connecting two different kinds of scFvs. There are three kinds of BsAb formats classified by different links. (1) mini-antibodies are heterodimers assembled by connecting two scFv fragments together with an oligomerized domain (e.g. leucine zipper motifs derived from Fos or Jun transcription factors). (2) Diabodies are non-covalently associated dimmers which are assembled by two single chains VH1-VL2 and VH2-VL1, both connected by a short linker that is too short to allow pairing between V-domains from the same chain. Thus, each chain alone is not capable of binding antigen, but co-expression of two chains (VH1-VL2 and VH2-VL1) leads to assembly of heterodimeric diabodies which can bind to two kinds of antigens. (3) ScBsAb: a interlinker was used for connecting two different scFvs with different specificities and ScBsAb was expressed in the host cells as a single polypeptide. The intralinker between two domains within scFv is often (Gly4Ser)3. As for the interlinker between two scFvs, there are two strategies for designing it. For the purpose of avoiding false paring between heterogenous variable regions, the interlinker is often a short peptide linker less than ten amino acid residues such as Gly4Ser. Another strategy is to select a longer linker for the interlinker. In a word, the most important for designing interlinkers is to ensure the proper pairing between variable domains and folding of proteins, resulting in the formation of BsAb which maintains biological activities and stability. Some novel properties for facilitating purification and extending the plasma half-life time should be introduced.

[0219] BsAb-mediated immunotherapy plays a promising role in the clinical biotherapy for tumors. Tumor-killing effects mediated by BsAb is based on stimulating the immune system, highly specific with tumors and free of MHC restriction. Therefore, BsAb-mediated therapy is the complementarity of traditional methods such as surgery, radiotherapy and chemotherapy. BsAb can not only cure tumors but also stimulate the immune system to provide and keep the immune protection for a long time. Based on results of experiments in mouse and clinic, optimal BsAb prepared for trial use should have at least five characteristics as follows: 1 ): It targets to the relevant tumor antigens with high specificity and affinity; 2 ): It can bind to trigger factors on effector cells-cytotoxic cells and result in cross link only when BsAb binds to tumor antigens; 3): BsAb is able to promote the effective cytotoxicity and inflammation selectively produced by the corresponding group of leukocytes at tumor sites; 4): BsAb must be humanized to minimize induction of human anti-mouse response following repeated uses; Finally, 5): BsAb should be not only small enough to penetrate into tumors but also large enough to keep in the circulation for a sufficient time.

[0220] Based on these points described above, numerous BsAbs triggering many kinds of immune effector cells and targeting different tumor cells have been developed in the past few years, wherein the effector cells include T lymphocytes, NK cells, monocytes, macropghages, neutrophils, LAK cells (lymphokine-activated cytotoxic cells) and TIL cells (tumor infiltrating lymphocytes) etc. T cells are commonly recognized as the major specific cells for immune responses. CD3 expressed on the surface of all mature T cells is the common surface marker for T cells. CD3 binds to TCR non-covalently, forming the whole TCR-CD3 complex, and involves in immune responses against antigen stimulus. Now CD3 is surface trigger molecule on immune effector cells used most widely and successfully. Following anti-CD3 antibody within BsAb binds to CD3 molecule on the surface of T cells, numerous effects as follows will be produced to kill tumor cells. These effects include: (1) proliferation and differentiation of T cells. Firstly, BsAb can activate the rest T cells, resulting in Th cell and Tc cell derived from the premature effector T cells with CD4+ or CD8+. Secondly, BsAb can activate numerous memory cells to proliferate and differentiate into effector T cells which will attack and kill tumor cells. The number of effector cells is directly related to the rate of tumor elimination. (2) release of cytokines: CD4+ Th cells activated by BsAb can secrete a great deal of IL-2. IL-2 not only stimulates the proliferation of Th cells in autocrine, but also activates naive CD8+T cells in paracrine to become Tc cells, resulting in enlargement of cytotoxicity of Tc cells. In addition, IL-2 is a costimulating signal for activating T cells. Therefore, IL-2 plays a vital role in BsAb-mediated immune effects. Some other cytokines, such as TNF-α and IFN-γ are produced in the process of T-cell activation and can produce 'stander-by' effect by inhibiting the growth of 'stander-by' tumor cells through the medium among cells. (3) cytotoxicity: In vitro experiments indicate that mediated by BsAb, CD8+ Tc interacts with tumor cells directly, releases cytotoxic materials through granule exocytosis and lyses target cells, which takes place rapidly usually within 4-6 hours following targeting tumor cells. The major components in the cytotoxic materials are perforin and serine easterases or granzymes. Perforins can attack the plasma membrane and form ion channels, thus causing entry of plenty of ions and water, resulting in the lysis and necrosis of cells while granzymes are similar to lymphotoxin, capable of activating DNases in the cell, thus causing lysis of nucleic DNA, resulting in the apoptosis of target cells.

[0221] Currently, Fv fragment is widely used for construction of BsAb, since it is the minimal unit with the complete antigen-binding site, small (about 1 / 6 of the whole antibody), absence of Fc domain, lower immunogenicity, easily penetration into the wall of blood vessels and solid tumors. However, Fv is unstable and easy to dissociate in vivo because the covalent bond between VH and VL domains is unable to generate. In order to improve the stability of Fv fragment, a polypeptide intralinker between VH and VL domains is used to form so called ScFv. The intralinker is commonly a short flexible peptide with 15 amino acid residues in length such as (Gly 4 Ser) 3 . In one embodiment of the present invention, the said intralinker was used in anti-CD3 ScFv and a different intralinker is used for anti-PSMA scFv.

[0222] Bispecific antibodies having a standard IgG format can be challenging to produce because they include four different polypeptide chains. The efficacy of a smaller, more easily-produced bispecific molecule has been clinically demonstrated in non-Hodgkin's lymphoma. See, e.g., Bargou et al. (2008), Science 321(5891): 974-977.

[0223] Prolonged administration by continuous intravenous infusion was used to achieve these results because of the short in vivo half life of this small, single chain molecule. Hence, there is a need in the art for bispecific therapeutics that retain similar therapeutic efficacy, that have a format that is straightforward to produce, and that have favorable pharmacokinetic properties, including a longer half-life.

[0224] A Bispecific-Fc (B s-Fc) as described herein can bind to two different proteins and contains an Fc region of an antibody or a portion thereof. A Bs-Fc can have favorable pharmacokinetic properties relative to a bispecific single chain molecule lacking an Fc region. One protein bound by a Bs-Fc can be expressed on an immune effector cell such as a T cell, an NK cell, a neutrophil, or a macrophage, and the other protein can be expressed on a target cell, for example, a cancer cell, a cell infected by a pathogen, or a cell mediating a disease, such as a fibroblast causing fibrosis. The Bs-Fc molecules described herein can elicit activation of an immune effector cell in the presence of a target cell and / or killing of a target cell in the presence of an immune effector cell.

[0225] In one aspect, provided herein is a Bs-Fc (Figure 25A - Figure 25D), which can comprise: (a) a polypeptide chain having the formula V1-L1-V2-L2-V3-L3-V4-L4-Fc, wherein Fc is an Fc polypeptide chain, wherein V1, V2, V3, and V4 are each immunoglobulin variable regions that have different amino acid sequences, wherein L1, L2, L3, and L4 are linkers, and wherein L2 and / or L4 can be present or absent (Figure 25A); or (b) a polypeptide chain having the formula Fc-L4-V1-L1-V2-L2-V3-L3-V4, wherein Fc is an Fc polypeptide chain, wherein V1, V2, V3, and V4 are each immunoglobulin variable regions that have different amino acid sequences, wherein L1, L2, L3, and L4 are linkers, and wherein L2 and / or L4 can be present or absent wherein the disulfide bonds of Fc can be at the N terminus (Figure 25C) or C terminus (Figure 25D); wherein the Bs-Fc mediates cytolysis of a target cell displaying a target cell protein by an immune is effector cell, and does not mediate cytolysis of a cell not displaying the target cell protein by the immune effector cell and / or wherein the Bs-Fc can bind to a target cell and to an immune effector cell. The Fc polypeptide chains in the first and second polypeptide chains can be human IgG Fc polypeptide chains. V1 can be a heavy chain variable (VH) region, and V2 can be a light chain variable (VL) region. In an alternate embodiment, V1 can be a VL region and V2 can be a VH region. V3 and V4 can be a VH and a VL region, respectively, or V3 and V4 can be a VL and a VH region, respectively, wherein Figure 25B shows an example. L1 and L3 can be at least 15 amino acids long, and L2, when present, can be less than 12 amino acids long. V1 and V2 can bind to a target cell or an immune effector cell when they are part of an IgG and / or an scFv antibody, and V3 and V4 can bind to a target cell or an immune effector cell when they are part of an IgG and / or an scFv antibody.

[0226] In the present invention, the single-chain bispecific antibody (ScBsAb) connected by an Gly 4 Ser interlinker and fused to an engineered IgG4 Fc was constructed to prolong the circulating life.

[0227] In one embodiment of the present invention, one of the two scFvs of ScBsAb was anti-CD3 scFv. In one embodiment of the present invention, the anti-CD3 scFv was derived from OKT3 antibody with a nucleic acid sequence shown in SEQ ID NO. 82 and amino acid sequence shown in SEQ ID NO. 83. In one embodiment of the present invention, the anti-CD3 scFv was derived from humanized OKT3 antibody with a nucleic acid sequence shown in SEQ ID NO. 88 and amino acid sequence shown in SEQ ID NO. 89.

[0228] The other scFv of the ScBsAb targets PSMA. In one embodiment, the anti-PSMA scFv is gy1, gy1-2, as described elsewhere herein. For example, in one embodiment, the PSMA-binding portion of the BsAb comprises SEQ ID NO: 3. In certain embodiments, the PSMA-binding portion of the BsAb is encoded by SEQ ID NO: 2.

[0229] To prolong the circulation life of ScBsAb, the size has to be increased above the molecular weight cutoff for glomerular filtration, i.e., around 60 kDa (Pisal DS et al. 2010, J Pharm Sci. 99: 2557-2575). Among the tags or fusion proteins, Fc is perfect because it prolong circulation time not only by enlarging the size of the protein of interest, but also by its interaction with the neonatal Fc receptor (FcRn). Therefore, in one embodiment of the present invention, a Fc domain was fused to the ScBsAb. In another embodiment of the invention, IgG4 Fc was fused to ScBsAb.

[0230] ADCC and CDC function is unwanted in BsAb since the binding of BsAb on CD3 will trigger the depletion of T cells through these functions. IgG4 does not bind C1q so there is no CDC. Furthermore, IgG4 has low affinity to activating FcγR while retaining relatively high affinity to the inhibiting FcγRIIb, IgG4 therefore has very weak ADCC. To completely abrogate ADCC, we have mutated the N297 to A297 to inhibit IgG4 binding to Fc receptors. But IgG binding to FcRn dose not depend on Fc glycosylation, so N297A mutation will not affect the half life of the IgG4 Fc fused protein. In one embodiment of the present invention, a N297A mutated IgG4 Fc is fused to the ScBsAb to prolong the circulation life. The nucleic acid and amino acid sequences were shown in SEQ ID NO. 96 and 97.

[0231] Both the S228 at the hinge region and R409 at CH3 of IgG4 are required for Fab Arm Exchange (FAE) for IgG4, which happens in physiological conditions, such as that observed in therapeutic IgG4 antibody natalizumab. So we used IgG1 hinge between the ScBsAb and Fc to avoid FAE. The other advantage of the use of IgG1 hinge is that IgG1 hinge is longer (15 aa) than that of IgG4 (12 aa) so is more flexible. To avoid disulfide bond mismatch, the C220 responsible for Fab formation with CL is mutated to A (C220A). Therefore, in one embodiment of the present invention, the linker between ScBsAb and Fc is IgG1 hinge; in another specific embodiment, the linker between ScBsAb and Fc is a C220A muated IgG1 hinge, whose nucleic acid and amino acid sequences were shown in SEQ ID NO. 94 and 95.

[0232] In an aspect of the present disclosure, an expression vector for ScBsAb expression has the expression cassette selected from the following 5 options: Cassette 1: (Kozak) -SP-MCS-G 4 S-scFv2-mIgG1 hinge - mIgG4 Fc Cassette 2: SP-MCS-G4S-scFv2-mIgG1 hinge - mIgG4 Fc Cassette 3: (Kozak) -SP-scFv1-G 4 S-scFv2-mIgG1 hinge - mIgG4 Fc Cassette 4: SP-scFv1-G 4 S-scFv2-mIgG1 hinge - mIgG4 Fc Cassette 5: scFv1-G 4 S-scFv2-mIgG1 hinge - mIgG4 Fc (abbreviation: SP: signal peptide; MCS: multiple clone site; mIgG1 hinge: mutated IgG1 hinge; mIgG4 Fc: mutated IgG4 Fc)

[0233] In one embodiment, the bispecific antibody comprises the amino acid sequence of SEQ ID NO: 99. In one embodiment, the composition comprises a nucleotide sequence encoding SEQ ID NO. 99. In one specific embodiment of the invention, the composition comprises a nucleotide sequence of SEQ ID NO. 98.

[0234] In one embodiment, the bispecific antibody comprises the amino acid sequence of SEQ ID NO: 101. In one embodiment, the composition comprises a nucleotide sequence encoding SEQ ID NO. 101. In one specific embodiment of the invention, the composition comprises a nucleotide sequence of SEQ ID NO. 100.

[0235] In one embodiment, the bispecific antibody comprises the amino acid sequence of SEQ ID NO: 103. In one embodiment, the composition comprises a nucleotide sequence encoding SEQ ID NO. 103. In one specific embodiment of the invention, the composition comprises a nucleotide sequence of SEQ ID NO. 102.

[0236] In one embodiment, an anti-PSMA & anti-CD3 ScBsAb comprises the amino acid of SEQ ID NO. 105 or an amino acid sequence with homology more than 90%, 91%, 92%, 93%, 94% or 95% thereof.

[0237] In one embodiment, an anti-PSMA & anti-CD3 ScBsAb comprises the amino acid of SEQ ID NO. 106 or an amino acid sequence with homology more than 90%, 91%, 92%, 93%, 94% or 95% thereof.

[0238] In one embodiment, an anti-PSMA & anti-CD3 ScBsAb comprises the amino acid of SEQ ID NO. 108 or a amino acid sequence with homology more than 90%, 91%, 92%, 93%, 94% or 95% thereof.

[0239] In one embodiment, an anti-PSMA & anti-CD3 ScBsAb comprises the amino acid of SEQ ID NO. 109 or an amino acid sequence with homology more than 90%, 91%, 92%, 93%, 94% or 95% thereof.

[0240] In one embodiment, a BsAb expression vector comprises a nucleic acid sequence of SEQ ID NO. 104 or nucleic acid sequence encoding the amino acid sequence of SEQ ID NO. 105 or an amino acid sequence with homology more than 90%, 91%, 92%, 93%, 94% or 95% thereof.

[0241] In one embodiment, a BsAb expression vector comprises a nucleic acid sequence of SEQ ID NO. 107 or nucleic acid sequence encoding the amino acid sequence of SEQ ID NO. 108 or an amino acid sequence with homology more than 90%, 91%, 92%, 93%, 94% or 95% thereof.

[0242] The scFv against CD3 molecule in anti-PSMA ScBsAb used in the present invention is a humanized scFv and the PSMA scFv is a fully human antibody, which will significantly minimize the immunogenicity of the BsAb and improve the overall outcome of cancer treatment.Combination Therapies

[0243] A composition comprising an antibody, antibody fragment, ADC, CAR-expressing cell, or bispecific antibody described herein may be used in combination with other known agents and therapies. Administered "in combination", as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as "simultaneous" or "concurrent delivery". In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.

[0244] A composition comprising an antibody, antibody fragment, ADC, CAR-expressing cell, or bispecific antibody described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the CAR-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.

[0245] In further aspects, a composition comprising an antibody, antibody fragment, ADC, CAR-expressing cell, or bispecific antibody described herein may be used in a treatment regimen in combination with surgery, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, and irradiation. peptide vaccine, such as that described in Izumoto et al. 2008 J Neurosurg 108:963-971.

[0246] In one embodiment, a composition comprising an antibody, antibody fragment, ADC, CAR-expressing cell, or bispecific antibody described herein can be used in combination with a chemotherapeutic agent. Exemplary chemotherapeutic agents include an antiandrogen (androgen antagonists), anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)). a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludarabine)), an mTOR inhibitor, a TNFR glucocorticoid induced TNFR related protein (GITR) agonist, a proteasome inhibitor (e.g., aclacinomycin A, gliotoxin or bortezomib), an immunomodulator such as thalidomide or a thalidomide derivative (e.g., lenalidomide).

[0247] General Chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex ®< ), bicalutamide (Casodex ®< ), bleomycin sulfate (Blenoxane ®< ), busulfan (Myleran ®< ), busulfan injection (Busulfex ®< ), capecitabine (Xeloda ®< ), N4-pentoxycarbonyl-5-deoxy-5-fluorocytidine, carboplatin (Paraplatin ®< ), carmustine (BiCNU ®< ), chlorambucil (Leukeran ®< ), cisplatin (Platinol ®< ), cladribine (Leustatin ®< ), cyclophosphamide (Cytoxan ®< or Neosar ®< ), cytarabine, cytosine arabinoside (Cytosar-U ®< ), cytarabine liposome injection (DepoCyt ®< ), dacarbazine (DTIC-Dome ®< ), dactinomycin (Actinomycin D, Cosmegan), daunorubicin hydrochloride (Cerubidine ®< ), daunorubicin citrate liposome injection (DaunoXome ®< ), dexamethasone, docetaxel (Taxotere ®< ), doxorubicin hydrochloride (Adriamycin ®< , Rubex ®< ), etoposide (Vepesid ®< ), fludarabine phosphate (Fludara ®< ), 5-fluorouracil (Adrucil ®< , Efudex ®< ), flutamide (Eulexin ®< ), tezacitibine, Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea ®< ), Idarubicin (Idamycin ®< ), ifosfamide (IFEX ®< ), irinotecan (Camptosar ®< ), L-asparaginase (ELSPAR ®< ), leucovorin calcium, melphalan (Alkeran ®< ), 6-mercaptopurine (Purinethol ®< ), methotrexate (Folex ®< ), mitoxantrone (Novantrone ®< ), mylotarg, paclitaxel (Taxol ®< ), phoenix (Yttrium90 / MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (Gliadel ®< ), tamoxifen citrate (Nolvadex ®< ), teniposide (Vumon ®< ), 6-thioguanine, thiotepa, tirapazamine (Tirazone ®< ), topotecan hydrochloride for injection (Hycamptin ®< ), vinblastine (Velban ®< ), vincristine (Oncovin ®< ), and vinorelbine (Navelbine ®< ).

[0248] Exemplary Antiandrogen (androgen antagonists) agents include Bicalutamide, Goserelin Acetate SR Depo.

[0249] Exemplary alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard ®< , Chlorethaminacil ®< , Demethyldopan ®< , Desmethyldopan ®< , Haemanthamine ®< , Nordopan ®< , Uracil Nitrogen Mustard ®< , Uracillost ®< , Uracilmostaza ®< , Uramustin ®< , Uramustine ®< ), chlormethine (Mustargen ®< ), cyclophosphamide (Cytoxan ®< , Neosar ®< , Clafen ®< , Endoxan ®< , Procytox ®< , Revimmune ™< ), ifosfamide (Mitoxana ®< ), melphalan (Alkeran ®< ), Chlorambucil (Leukeran ®< ), pipobroman (Amedel ®< , Vercyte ®< ), triethylenemelamine (Hemel ®< , Hexylen ®< , Hexastat ®< ), triethylenethiophosphoramine, Temozolomide (Temodar ®< ), thiotepa (Thioplex ®< ), busulfan (Busilvex ®< , Myleran ®< ), carmustine (BiCNU ®< ), lomustine (CeeNU ®< ), streptozocin (Zanosar ®< ), and Dacarbazine (DTIC-Dome ®< ). Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin ®< ); Temozolomide (Temodar ®< and Temodal ®< ); Dactinomycin (also known as actinomycin-D, Cosmegen ®< ); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran ®< ); Altretamine (also known as hexamethylmelamine (HMM), Hexylen ®< ); Carmustine (BiCNU ®< ); Bendamustine (Treanda ®< ); Busulfan (Busulfex ®< and Myleran ®< ); Carboplatin (Paraplatin ®< ); Lomustine (also known as CCNU, CeeNU ®< ); Cisplatin (also known as CDDP, Platinol ®< and Platinol ®< -AQ); Chlorambucil (Leukeran ®< ); Cyclophosphamide (Cytoxan ®< and Neosar ®< ); Dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC-Dome ®< ); Altretamine (also known as hexamethylmelamine (HMM), Hexylen ®< ); Ifosfamide (Ifex ®< ); Prednumustine; Procarbazine (Matulane ®< ); Mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, Mustargen ®< ); Streptozocin (Zanosar ®< ); Thiotepa (also known as thiophosphoamide, TESPA and TSPA, Thioplex ®< ); Cyclophosphamide (Endoxan ®< , Cytoxan ®< , Neosar ®< , Procytox ®< , Revimmune ®< ); and Bendamustine HCl (Treanda ®< ).

[0250] Exemplary mTOR inhibitors include, e.g., temsirolimus; ridaforolimus (formally known as deferolimus, (1R,2R,4S)-4-[(2R)-2[(1R,9S,12S,15R,16E,18R,19R,21R, 23S,24E,26E,28Z,30S,32S,35R)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23, 29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.04,9]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl]-2-methoxycyclohexyl dimethylphosphinate, also known as AP23573 and MK8669, and described in PCT Publication No. WO 03 / 064383); everolimus (Afinitor ®< or RAD001); rapamycin (AY22989, Sirolimus ®< ); simapimod (CAS164301-51-3); emsirolimus, (5-{2,4-Bis[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl}-2-methoxyphenyl)methanol (AZD8055); 2-Amino-8-[trans-4-(2-hydroxyethoxy)cyclohexyl]-6-(6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3-d]pyrimidin-7(8H)-one (PF04691502, CAS 1013101-36-4); and N2-[1,4-dioxo-4-[[4-(4-oxo-8-phenyl-4H-1-benzopyran-2-yl)morpholinium-4-yl]methoxy]butyl]-L-arginylglycyl-L-α-aspartylL-serine-, inner salt (SF1126, CAS 936487-67-1), and XL765.

[0251] Exemplary immunomodulators include, e.g., afutuzumab (available from Roche ®< ); pegfilgrastim (Neulasta ®< ); lenalidomide (CC-5013, Revlimid ®< ); thalidomide (Thalomid ®< ), actimid (CC4047); and IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon γ, CAS 951209-71-5, available from IRX Therapeutics).

[0252] Exemplary anthracyclines include, e.g., doxorubicin (Adriamycin ®< and Rubex ®< ); bleomycin (Lenoxane ®< ); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine ®< ); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome ®< ); mitoxantrone (DHAD, Novantrone ®< ); epirubicin (Ellence ™< ); idarubicin (Idamycin ®< , Idamycin PFS ®< ); mitomycin C (Mutamycin ®< ); geldanamycin; herbimycin; ravidomycin; and desacetylravidomycin.

[0253] Exemplary vinca alkaloids include, e.g., vinorelbine tartrate (Navelbine ®< ), Vincristine (Oncovin ®< ), and Vindesine (Eldisine ®< )); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ ®< and Velban ®< ); and vinorelbine (Navelbine ®< ).

[0254] Exemplary proteosome inhibitors include bortezomib (Velcade ®< ); carfilzomib (PX-171-007, (S)-4-Methyl-N-((S)-1-(((S)-4-methyl-1-((R)-2-methyloxiran-2-yl)-1-oxopentan-2-yl)amino)-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-(2-morpholinoacetamido)-4-phenylbutanamido)-pentanamide); marizomib (NPI-0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and O-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]-L-seryl-O-methyl-N-[(1S)-2-[(2R)-2-methyl-2-oxiranyl]-2-oxo-1-(phenylmethyl)ethyl]-L-serinamide (ONX-0912).

[0255] Exemplary GITR agonists include, e.g., GITR fusion proteins and anti-GITR antibodies (e.g., bivalent anti-GITR antibodies) such as, e.g., a GITR fusion protein described in U.S. Pat. No. 6,111,090, European Patent No.: 090505B1, U.S. Pat. No. 8,586,023, PCT Publication Nos.: WO 2010 / 003118 and 2011 / 090754, or an anti-GITR antibody described, e.g., in U.S. Pat. No. 7,025,962, European Patent No.: 1947183B1, U.S. Pat. No. 7,812,135, U.S. Pat. No. 8,388,967, U.S. Pat. No. 8,591,886, European Patent No.: EP 1866339, PCT Publication No.: WO 2011 / 028683, PCT Publication No.:WO 2013 / 039954, PCT Publication No.: WO2005 / 007190, PCT Publication No.: WO 2007 / 133822, PCT Publication No.: WO2005 / 055808, PCT Publication No.: WO 99 / 40196, PCT Publication No.: WO 2001 / 03720, PCT Publication No.: WO99 / 20758, PCT Publication No.: WO2006 / 083289, PCT Publication No.: WO 2005 / 115451, U.S. Pat. No. 7,618,632, and PCT Publication No.: WO 2011 / 051726.

[0256] In one embodiment, the subject can be administered an agent which reduces or ameliorates a side effect associated with the administration of a naked antibody or antibody fragment, ADC, CAR-expressing cell, or Bispecific antibody.

[0257] In one embodiment, the subject can be administered an agent which enhances the activity of a naked antibody or antibody fragment, ADC, CAR-expressing cell, or Bispecific antibody. For example, in one embodiment, the agent can be an agent which inhibits an inhibitory molecule. Inhibitory molecules, e.g., Programmed Death 1 (PD1), can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response. Examples of inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFR beta. Inhibition of an inhibitory molecule, e.g., by inhibition at the DNA, RNA or protein level, can optimize a naked antibody or antibody fragment, ADC, CAR-expressing cell, or Bispecific antibody performance. In embodiments, an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, can be used to inhibit expression of an inhibitory molecule in the CAR-expressing cell or bispecific Ab reacting cells. In an embodiment the inhibitor is an shRNA. In one embodiment, the inhibitor of an inhibitory signal can be, e.g., an antibody or antibody fragment that binds to an inhibitory molecule. For example, the agent can be an antibody or antibody fragment that binds to PD1, PD-L1, PD-L2 or CTLA4 (e.g., ipilimumab (also referred to as MDX-010 and MDX-101, and marketed as Yervoy ®< ; Bristol-Myers Squibb; Tremelimumab (IgG2 monoclonal antibody available from Pfizer, formerly known as ticilimumab, CP-675,206).). In an embodiment, the agent is an antibody or antibody fragment that binds to TIM3. In an embodiment, the agent is an antibody or antibody fragment that binds to LAG3.

[0258] PD1 is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS, and BTLA. PD1 is expressed on activated B cells, T cells and myeloid cells (Agata et al. 1996 Int. Immunol 8:765-75). Two ligands for PD1, PD-L1 and PD-L2 have been shown to downregulate T cell activation upon binding to PD 1 (Freeman et al. 2000 J Exp Med 192:1027-34; Latchman et al. 2001 Nat Immunol 2:261-8; Carter et al. 2002 Eur J Immunol 32:634-43). PD-L1 is abundant in human cancers (Dong et al. 2003 J Mol Med 81:281-7; Blank et al. 2005 Cancer Immunol. Immunother 54:307-314; Konishi et al. 2004 Clin Cancer Res 10:5094). Immune suppression can be reversed by inhibiting the local interaction of PD1 with PD-L1. Antibodies, antibody fragments, and other inhibitors of PD1, PD-L1 and PD-L2 are available in the art and may be used combination with a PSMA targeted naked antibody or antibody fragment, ADC, CAR-expressing cell, or Bispecific antibody described herein. For example, nivolumab (also referred to as BMS-936558 or MDX1106; Bristol-Myers Squibb) is a fully human IgG4 monoclonal antibody which specifically blocks PD 1. Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD1 are disclosed in U.S. Pat. No. 8,008,449 and WO2006 / 121168. Pidilizumab (CT-011; Cure Tech) is a humanized IgGlk monoclonal antibody that binds to PD1Pidilizumab and other humanized anti-PD1 monoclonal antibodies are disclosed in WO2009 / 101611. Lambrolizumab (also referred to as MK03475; Merck) is a humanized IgG4 monoclonal antibody that binds to PD1. Lambrolizumab and other humanized anti-PD1 antibodies are disclosed in U.S. Pat. No. 8,354,509 and WO2009 / 114335. MDPL3280A (Genentech / Roche) is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1. MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Pat. No. 7,943,743 and U.S Publication No.: 20120039906. Other anti-PD-L1 binding agents include YW243.55.S70 (heavy and light chain variable regions are shown in SEQ ID NOs 20 and 21 in WO2010 / 077634) and MDX-1 105 (also referred to as BMS-936559, and, e.g., anti-PD-L1 binding agents disclosed in WO2007 / 005874). AMP-224 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010 / 027827 and WO2011 / 066342), is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD1 and B7-H1. Other anti-PD1 antibodies include AMP 514 (Amplimmune), among others, e.g., anti-PD1 antibodies disclosed in U.S. Pat. No. 8,609,089, US 2010028330, and / or US 20120114649.

[0259] In some embodiments, the agent which enhances the activity of a CAR-expressing cell can be, e.g., a fusion protein comprising a first domain and a second domain, wherein the first domain is an inhibitory molecule, or fragment thereof, and the second domain is a polypeptide that is associated with a positive signal, e.g., a polypeptide comprising an antracellular signaling domain as described herein. In some embodiments, the polypeptide that is associated with a positive signal can include a costimulatory domain of CD28, CD27, ICOS, e.g., an intracellular signaling domain of CD28, CD27 and / or ICOS, and / or a primary signaling domain, e.g., of CD3 zeta, e.g., described herein. In one embodiment, the fusion protein is expressed by the same cell that expressed the CAR. In another embodiment, the fusion protein is expressed by a cell, e.g., a T cell that does not express an anti-PSMA CAR.Formulations and route of administration

[0260] The antibodies, ADC, CAR-expressing cell, or Bispecific antibody of the present invention may find use in a wide range of products. In one embodiment the antibody, ADC, CAR-expressing cell, or Bispecific antibody of the invention is a therapeutic, a diagnostic, or a research reagent. In one embodiment, an antibody ADC, CAR-expressing cell, or Bispecific antibody of the invention is a therapeutic. In some embodiments, antibody or antibody fragment, ADC, CAR-expressing cell, or Bispecific antibody of the present invention is used for industrial uses. An antibody of the present invention may find use in an antibody composition that is monoclonal or polyclonal. The antibodies of the present invention may be agonists, antagonists, neutralizing, inhibitory, or stimulatory. In one embodiment, the antibodies or antibody fragments, ADC, CAR-expressing cell, or Bispecific antibody of the present invention are used to kill target cells that bear the target antigen, for example cancer cells. In an alternate embodiment, the antibodies of the present invention are used to block, antagonize, or agonize the target antigen. In an alternate embodiment, the antibodies of the present invention are used to block, antagonize, or agonize the target antigen and kill the target cells that bear the target antigen. In another embodiment, the target cell is a tumor cell or it's neovasculature. In one embodiment, neovasculature plays an important role in angiogenesis and are also considered to be a target of the antibodies or antibody fragments, ADC, CAR-expressing cell, or Bispecific antibody provided herein.

[0261] The disclosure further provides kits comprising one or more compositions of the invention, including pharmaceutical formulations, packaged into suitable packaging material. In another embodiment, a kit includes a nucleic acid encoding the antibody or antigen-binding fragments, Car T or Car NK cells, or bispecific antibody, thereof of the invention. In additional embodiments, a kit includes nucleic acids that further include an expression control element; an expression vector; a viral expression vector; an adeno-associated virus expression vector; an adenoviral expression vector; and a retroviral expression vector. In yet an additional embodiment, a kit includes a cell that express the antibody or antigen-binding fragments thereof of the invention, such as the Car T or Car NK cells.

[0262] In additional embodiments, a kit includes a label or packaging insert including instructions for expressing an antibody or bispecific antibody or a nucleic acid encoding the antibody, antigen-binding fragments or bispecific antibody thereof in cells in vitro, in vivo, or ex vivo. In yet additional embodiments, a kit includes a label or packaging insert including instructions for treating a subject (e.g., a subject having or at risk of having asthma) with the antibody or antibody fragment, ADC, CAR-expressing cell, or Bispecific antibody thereof of the invention in vivo, or ex vivo.

[0263] As used herein, the term "packaging material" refers to a physical structure housing the components of the kit. The packaging material can maintain the components sterilely, and can be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampules, etc.). The label or packaging insert can include appropriate written instructions, for example, practicing a method as described herein, e.g., treating the common cold. Kits of the invention therefore can additionally include instructions for using the kit components in a method as described herein.

[0264] Instructions can include instructions for practicing any of the methods described herein. Thus, pharmaceutical compositions of the present disclosure can be included in a container, pack, or dispenser together with instructions for administration to a subject. Instructions may additionally include indications of a satisfactory clinical endpoint or any adverse symptoms that may occur, or additional information required by the Food and Drug Administration for use on a human subject.

[0265] In one embodiment, polypeptides as described herein are administered as part of a vaccine. In some embodiments, the term vaccine is to be understood to encompass any immunomodulating composition, and such vaccines may comprise an adjuvant, an antigen, an immuno-modulatory compound, or a combination thereof, in addition to the polypeptides of this invention.

[0266] In some embodiments, an adjuvant may include, but is not limited to: (A) aluminium compounds (e.g. aluminium hydroxide, aluminium phosphate, aluminium hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate, etc. [e.g. see chapters 8 & 9 of ref. 96]), or mixtures of different aluminium compounds, with the compounds taking any suitable form (e.g. gel, crystalline, amorphous, etc.), and with adsorption being preferred; (B) MF59 (5% Squalene, 0.5% Tween 80, and 0.5% Span 85, formulated into submicron particles using a microfluidizer); (C) liposomes; (D) ISCOMs, which may be devoid of additional detergent; (E) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-block polymer L121, and thr-MDP, either micro fluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion; (F) Ribi ™< adjuvant system (RAS), (Ribi Immunochem) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (Detox ™< ); (G) saponin adjuvants, such as QuilA or QS21, also known as Stimulon ™< ; (H) chitosan; (I) complete Freund's adjuvant (CFA) and incomplete Freund's adjuvant (IFA); (J) cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc.), interferons (e.g. interferon-γ), macrophage colony stimulating factor, tumor necrosis factor, etc.; (K) monophosphoryl lipid A (MPL) or 3-O-deacylated MPL (3dMPL)]; (L) combinations of 3dMPL with, for example, QS21 and / or oil-in-water emulsions; (M) oligonucleic acids comprising CpG motifs] i.e. containing at least one CG dinucleic acid, with 5-methylcytosine optionally being used in place of cytosine; (N) a polyoxyethylene ether or a polyoxyethylene ester; (O) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol; (P) an immuno-stimulatory oligonucleic acid (e.g. a CpG oligonucleic acid) and a saponin; (O) an immuno-stimulant and a particle of metal salt; (R) a saponin and an oil-in-water emulsion; (S) a saponin (e.g. QS21)+3dMPL+IL12 (optionally+a sterol); (T) E. coli heat-labile enterotoxin ("LT"), or detoxified mutants thereof, such as the K63 or R72 mutants; (U) cholera toxin ("CT"), or diphtheria toxin ("DT") or detoxified mutants of either; (V) double-stranded RNA; (W) monophosphoryl lipid A mimics, such as aminoalkyl glucosaminide phosphate derivatives e.g. RC-529]; (X) polyphosphazene (PCPP); or (Y) a bioadhesive such as esterified hyaluronic acid microspheres or a mucoadhesive such as crosslinked derivatives of poly(acrylic acid), polyvinyl alcohol, polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose.

[0267] In some embodiments, administration of the compounds of this invention is intended to reduce the severity of the pathologic condition. By the term "reduce the severity of the pathologic condition", it is to be understood that any reduction via the methods, compounds and compositions disclosed herein, is to be considered encompassed by the invention. Reduction in severity may, in one embodiment comprise enhancement of survival, or in another embodiment, halting disease progression, or in another embodiment, delay in disease progression.

[0268] In one embodiment, dosing is dependent on the cellular responsiveness to the administered molecules / compounds or compositions comprising same. In general, the doses utilized for the above described purposes will vary, but will be in an effective amount to exert the desired effect, as determined by a clinician of skill in the art. As used herein, the term "pharmaceutically effective amount" refers to an amount of a compound as described herein, which will produce the desired alleviation in symptoms or other desired phenotype in a patient.

[0269] In one embodiment of the invention, the concentrations of the compounds will depend on various factors, including the nature of the condition to be treated, the condition of the patient, the route of administration and the individual tolerability of the compositions.

[0270] In some embodiments, any of the compositions of this invention will comprise a compound, in any form or embodiment as described herein. In some embodiments, any of the compositions of this invention will consist essentially of a compound, in any form or embodiment as described herein. In some embodiments, the term "comprise" refers to the inclusion of the indicated active agent, such as the compound of this invention, as well as inclusion of other active agents, and pharmaceutically acceptable carriers, excipients, emollients, stabilizers, etc., as are known in the pharmaceutical industry.

[0271] In some embodiments, the compositions of this invention will consist essentially of a polypeptide / polynucleic acid / vector as herein described. In some embodiments, the term "consisting essentially of" refers to a composition whose only active ingredient of a particular class of agents, is the indicated active ingredient, however, other compounds may be included which are involved directly in the therapeutic effect of the indicated active ingredient. In some embodiments, the term "consisting essentially of" refers to a composition whose only active ingredient of targeting a particular mechanism, or acting via a particular pathway, is the indicated active ingredient, however, other compounds may be included which are involved directly in the therapeutic effect of the indicated active ingredient, which for example have a mechanism of action related to but not directly to that of the indicated agent. In some embodiments, the term "consisting essentially of" refers to a composition whose only active ingredient is the indicated active ingredient, however, other compounds may be included which are for stabilizing, preserving, etc. the formulation, but are not involved directly in the therapeutic effect of the indicated active ingredient. In some embodiments, the term "consisting essentially of" may refer to components which facilitate the release of the active ingredient. In some embodiments, the term "consisting" refers to a composition, which contains the active ingredient and a pharmaceutically acceptable carrier or excipient.

[0272] It will be appreciated that the actual amounts of active compound in a specific case will vary according to the specific compound being utilized, the particular compositions formulated, the mode of application, and the particular conditions and organism being treated. Dosages for a given host can be determined using conventional considerations, e.g., by customary comparison of the differential activities of the subject compounds and of a known agent, e.g., by means of an appropriate, conventional pharmacological protocol.

[0273] In one embodiment, the compounds of the invention are administered acutely for acute treatment of temporary conditions, or may be administered chronically, especially in the case of progressive, recurrent, or degenerative disease. In one embodiment, one or more compounds of the invention may be administered simultaneously, or in another embodiment, they may be administered in a staggered fashion. In one embodiment, the staggered fashion may be dictated by the stage or phase of the disease.

[0274] Parenteral vehicles (for subcutaneous, intravenous, intraarterial, or intramuscular injection) include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's and fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like. Examples are sterile liquids such as water and oils, with or without the addition of a surfactant and other pharmaceutically acceptable adjuvants. In general, water, saline, aqueous dextrose and related sugar solutions, and glycols such as propylene glycols or polyethylene glycol are preferred liquid carriers, particularly for injectable solutions. Examples of oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.

[0275] In one embodiment, the route of administration may be parenteral, or a combination thereof. In another embodiment, the route may be intra-ocular, conjunctival, topical, transdermal, intradermal, subcutaneous, intraperitoneal, intravenous, intra-arterial, vaginal, rectal, intratumoral, parcanceral, transmucosal, intramuscular, intravascular, intraventricular, intracranial, inhalation (aerosol), nasal aspiration (spray), intranasal (drops), sublingual, oral, aerosol or suppository or a combination thereof. In one embodiment, the dosage regimen will be determined by skilled clinicians, based on factors such as exact nature of the condition being treated, the severity of the condition, the age and general physical condition of the patient, body weight, and response of the individual patient.

[0276] For intranasal administration or application by inhalation, solutions or suspensions of the compounds mixed and aerosolized or nebulized in the presence of the appropriate carrier suitable. Such an aerosol may comprise any agent described herein.

[0277] For parenteral application, particularly suitable are injectable, sterile solutions, preferably oily or aqueous solutions, as well as suspensions, emulsions, or implants, including suppositories and enemas. Ampoules are convenient unit dosages. Such a suppository may comprise any agent described herein.

[0278] Sustained or directed release compositions can be formulated, e.g., liposomes or those wherein the active compound is protected with differentially degradable coatings, e.g., by microencapsulation, multiple coatings, etc. Such compositions may be formulated for immediate or slow release. It is also possible to freeze-dry the new compounds and use the lyophilisates obtained, for example, for the preparation of products for injection.

[0279] For liquid formulations, pharmaceutically acceptable carriers may be aqueous or non-aqueous solutions, suspensions, emulsions or oils. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate.

[0280] Aqueous carriers include water, alcoholic / aqueous solutions, emulsions or suspensions, including saline and buffered media. Examples of oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.

[0281] In one embodiment, a composition of or used in the methods described herein may be administered alone or within a composition. In another embodiment, compositions of this invention admixture with conventional excipients, i.e., pharmaceutically acceptable organic or inorganic carrier substances suitable for parenteral, enteral (e.g., oral) or topical application which do not deleteriously react with the active compounds may be used. In one embodiment, suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions, alcohols, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatine, carbohydrates such as lactose, amylose or starch, magnesium stearate, talc, silicic acid, viscous paraffin, white paraffin, glycerol, alginates, hyaluronic acid, collagen, perfume oil, fatty acid monoglycerides and diglycerides, pentaerythritol fatty acid esters, hydroxy methylcellulose, polyvinyl pyrrolidone, etc. In another embodiment, the pharmaceutical preparations can be sterilized and if desired mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and / or aromatic substances and the like which do not deleteriously react with the active compounds. In another embodiment, they can also be combined where desired with other active agents, e.g., vitamins.

[0282] Pharmaceutical compositions include "pharmaceutically acceptable" and "physiologically acceptable" carriers, diluents or excipients. In one embodiment, the terms "pharmaceutically acceptable" and "physiologically acceptable" refers to any formulation which is safe, and provides the appropriate delivery for the desired route of administration of an effective amount of at least one compound for use in the present invention. This term refers to the use of buffered formulations as well, wherein the pH is maintained at a particular desired value, ranging from pH 4.0 to pH 9.0, in accordance with the stability of the compounds and route of administration. The terms include solvents (aqueous or non-aqueous), solutions, emulsions, dispersion media, coatings, isotonic and absorption promoting or delaying agents, compatible with pharmaceutical administration. Such formulations can be contained in a liquid; emulsion, suspension, syrup or elixir, or solid form; tablet (coated or uncoated), capsule (hard or soft), powder, granule, crystal, or microbead. Supplementary active compounds (e.g., preservatives, antibacterial, antiviral and antifungal agents) can also be incorporated into the compositions.

[0283] Pharmaceutical compositions of the present disclosure can include one or more further chemotherapeutic agents selected from the group consisting of nitrogen mustards (e.g., cyclophosphamide and ifosfamide), aziridines (e.g., thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine and streptozocin), platinum complexes (e.g., carboplatin and cisplatin), non-classical alkylating agents (e.g., dacarbazine and temozolamide), folate analogs (e.g., methotrexate), purine analogs (e.g., fludarabine and mercaptopurine), adenosine analogs (e.g., cladribine and pentostatin), pyrimidine analogs (e.g., fluorouracil (alone or in combination with leucovorin) and gemcitabine), substituted ureas (e.g., hydroxyurea), antitumor antibiotics (e.g., bleomycin and doxorubicin), epipodophyllotoxins (e.g., etoposide and teniposide), microtubule agents (e.g., docetaxel and paclitaxel), camptothecin analogs (e.g., irinotecan and topotecan), enzymes (e.g., asparaginase), cytokines (e.g., interleukin-2 and interferon-α), monoclonal antibodies (e.g., trastuzumab and bevacizumab), recombinant toxins and immunotoxins (e.g., recombinant cholera toxin-B and TP-38), cancer gene therapies, physical therapies (e.g., hyperthermia, radiation therapy, and surgery) and cancer vaccines (e.g., vaccine against telomerase).

[0284] The compositions (e.g., antibodies, and bispecific molecules) of the invention can also be administered together with complement. Accordingly, within the scope of the invention are compositions comprising human antibodies, multispecific or bispecific molecules and serum or complement. These compositions are advantageous in that the complement is located in close proximity to the human antibodies, multispecific or bispecific molecules. Alternatively, the human antibodies, multispecific or bispecific molecules of the invention and the complement or serum can be administered separately.

[0285] Pharmaceutical compositions can be formulated to be compatible with a particular local or systemic route of administration. Thus, pharmaceutical compositions include carriers, diluents, or excipients suitable for administration by particular routes. Specific non-limiting examples of routes of administration for compositions of the invention are inhalation or intranasal delivery. Additional routes include parenteral, e.g., intravenous, intradermal, subcutaneous, oral, transdermal (topical), transmucosal, and rectal administration.

[0286] Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.

[0287] Pharmaceutical compositions for injection include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL ™< (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. Fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Antibacterial and antifungal agents include, for example, parabens, chlorobutanol, phenol, ascorbic acid and thimerosal. Isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride can be included in the composition. Including an agent which delays absorption, for example, aluminum monostearate and gelatin can prolong absorption of injectable compositions.

[0288] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of above ingredients followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle containing a basic dispersion medium and other ingredients as above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation include, for example, vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.

[0289] For transmucosal or transdermal administration, penetrants appropriate to the barrier be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays, inhalation devices (e.g., aspirators) or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.

[0290] The present invention's antibodies, including subsequences and modified forms and nucleic acids encoding them, can be prepared with carriers that protect against rapid elimination from the body, such as a controlled release formulation or a time delay material such as glyceryl monostearate or glyceryl stearate. The compositions can also be delivered using implants and microencapsulated delivery systems to achieve local or systemic sustained delivery or controlled release.

[0291] Biodegradable, biocompatable polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to cells or tissues using antibodies or viral coat proteins) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811.

[0292] Additional pharmaceutical formulations appropriate for the compositions for administration in the methods of the invention are known in the art (see, e.g., Remington's Pharmaceutical Sciences (1990) 18th ed., Mack Publishing Co., Easton, Pa.; The Merck Index (1996) 12th ed., Merck Publishing Group, Whitehouse, N.J.; and Pharmaceutical Principles of Solid Dosage Forms, Technonic Publishing Co., Inc., Lancaster, Pa., (1993)). The pharmaceutical formulations can be packaged in dosage unit form for ease of administration and uniformity of dosage. "Dosage unit form" as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the pharmaceutical carrier or excipient.

[0293] Although the pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical composition suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and perform such modification with little, if any, experimentation. Subjects to which administration of the pharmaceutical compositions of the invention is contemplated include, but are not limited to, humans and other primates, and other mammals.

[0294] In one embodiment, the term "about" means in quantitative terms plus or minus 5%, or in another embodiment plus or minus 10%, or in another embodiment plus or minus 15%, or in another embodiment plus or minus 20%.

[0295] The term "subject" refers in one embodiment to a mammal including a human in need of therapy for, or susceptible to, a condition or its sequelae. The subject may include dogs, cats, pigs, cows, sheep, goats, horses, rats, and mice and humans. The term "subject" does not exclude an individual that is normal in all respects.

[0296] It is to be understood that any assay for measuring a particular activity which is modulated by the therapeutic compound may be employed, as a means of determining the efficacy of the compound, in one embodiment, optimal loading of the compound, in another embodiment, timing and dosage, in another embodiment, or a combination thereof.EXPERIMENTAL EXAMPLES

[0297] The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified.Example 1: Panning of yeast display human scFv library

[0298] The 1×10 11< yeast display naive human scFv library was constructed and the extracellular domain of human PSMA was purchased from R&D systems. The method of library panning was previously described (Zhao et al., J Immunol Methods. 2011; 363(2):221-32.). Briefly, the recombinant PSMA protein was biotinylated and incubated with induced yeast display scFv library; the PSMA binding yeast cells were isolated using streptavidin (SA) conjugated microbeads and then flowcytometry activated cell sorting (FACS); scFv gene was amplified from the isolated yeast cells and cloned into a secretory expression yeast strain YVH10; individual secretory scFv expression was induced in 96 well plates and PSMA binding clones were identified by high throughput ELISA.Biotinylation of PSMA recombinant protein

[0299] PSMA recombinant protein buffer was changed into PBS via dialysis against PBS at 4°C and the concentration was adjusted to 0.5 mg / ml. EZ-Link Sulfo-NHS-Biotin Reagent (10mM; dissolved in cold water) (life technologies) was mixed with PSMA recombinant protein to a final molar ratio of 1:20 (protein:biotin). The PSMA recombinant protein mixture was incubated at 4 °C for 2 hours. Unreacted free biotin reagents was removed by dialysis and the biotinylated protein was aliquoted and stored at -80°C.Yeast display scFv library panning using magnetic beads

[0300] The yeast display scFv library was thawed from -80 °C and centrifugated at 3000 rpm for 5 minutes. The supernatant was discarded, and the yeast cells were resuspended with 12 L SD-CAA medium (one liter SD-CAA medium contains 5 g casamino acids, 1.7 g Yeast Nitrogen Base without ammonium SO 4 & amino acids, 5.3 g ammonium sulfade, 10.2 g Na 2 HPO 4 .7H 2 O, 8.6 g NaH 2 PO 4 .H 2 O and 20 g dextrose). The cells were cultured at 30 °C overnight with rocking at 200 rpm. The next day, yeast cells were harvested by centrifuging at 3000 rpm for 5 minutes and an appropriate amount was resuspended into 12 L S-CAA-GRD induction medium (one liter S-CAA-GRD medium contains 5 g casamino acids, 1.7 g Yeast Nitrogen Base without ammonium SO 4 & amino acids, 5.3 g ammonium sulfade, 10.2 g Na 2 HPO 4 .7H 2 O, 8.6 g NaH 2 PO 4 .H 2 O, 1 g dextrose, 20g galactose and 20 g raffinose) so that the final concentration was OD600=0.5 and induced at 20 °C overnight. Induced yeast cells were harvested by centrifugation at 3000 rpm for 5 minutes and washed twice by 2 L PBE buffer (PBE buffer is PBS bufer containing 2 mM EDTA and 0.5% BSA) and finally resuspended in 200 ml PBE. Cells were incubated with 40 µg biotinylated PSMA protein at room temperature (RT) for 1.5 hours and then 4 °C for 0.5 hour. The following steps were done at 4 °C or on ice. Cells were harvested by centrifuging at 3000 rpm for 5 minutes and washed twice with 2 L PBE and resuspended in 200 ml PBE. Then, 2 ml streptavidin microbeads (Miltenyi Biotec) was added to the cells and incubated with slow rocking for 1 hour. One liter PBE was added to cells, the solution was vortexed to make sure the cells were separated in single cells, and filtered using 70 µm strainer. Sixteen Miltenyi LS columns were used for PSMA binding yeast cell isolation. Briefly, 7mL of the strained cell suspension was added to the column. After each 7 mL of cells entered the column and the flow has stopped, the column was removed from magnet and immediately put back into magnet. This rearranges the iron beads in the column and allows the cells that are physically trapped between the beads to pass through. With the column back in the magnet, 1ml of wash buffer was added, and after the wash flowed through, another 7 mL of cells was added onto column. The column removal procedure was repeated between each loading of cells. Once all of the cells were loaded on the column, the column was washed with 3 mL of wash buffer. This wash removes the cells in the void volume of the column. The column was removed from magnet and immediately replaced as before. Wash was repeated twice. Once the column has stopped dripping, the column was removed from magnet and 7mL of wash buffer was then added. The plunger was used to push all remaining cells out into a 15-mL conical tube.

[0301] The harvested cells were loaded once more to two new columns to further remove the nonspecific cells. The final eluted cells were harvested by centrifuging at 3000 rpm for 5 minutes. The cells were spread on SD-CAA plates and cultured for 2 days at 30 °C. A total of 2.5×10 7< clones were obtained from the first round of magnetic sorting. Cells were scraped and induced for the second round of magnetic sorting. An aliquot was also stored in SD-CAA containing 10% glycerol at -80 °C.

[0302] 5×10 9< first round magnetic sorted yeast cells were inoculated into 200 ml S-CAA-GRD medium for induction at 20 °C overnight. The next day, 2.5×10 9< induced cells were harvested by centrifuging at 3000 rpm for 5 minutes and washed twice with 15 ml PBE. Cells were resuspended in 3 ml PBE and incubated with 3µg biotinylated PSMA protein at RT for 1.5 hours and then at 4 °C for half hour. All the following steps were performed at 4 °C or on ice. After incubation, cells were pelleted by centrifuging at 3000 rpm for 5 minutes and then washed three times with 15 ml PBE. Cells were pelleted again and resuspended in 3 ml PBE and incubated with 50µl anti-biotin antibody conjugated microbads at 4 °C for 1 hour. Cells were washed once with PBE, resuspended in 15 ml PBE and filtered through a 70 µm strainer, and the PSMA binding yeast cells were isolated using one Miltenyi Macs LS column as described above. The second round magnetic sorting gave rise to 5.1×10 6< clones.

[0303] A third round of magnetic sorting was performed to further enrich PSMA specific yeast population. Briefly, 1×10 9< cells were induced in 50 ml S-CAA-GRD at 20 °C overnight and 5×10 8< cells were taken for futher panning. Cells were washed twice with 15 ml PBE and resuspended in 3 ml PBE, followed by incubation with 1 µg biotinylated PSMA protein at RT for 1.5 hour and then at 4 °C for half hour. All the following steps were performed at 4 °C or on ice. After incubation, cells were pelleted by centrifuging at 3000 rpm for 5 minutes and then washed three times with 15 ml PBE. Cells were pelleted again and resuspended in 3 ml PBE and incubated with 50µl streptavidin conjugated microbads at 4 °C for 1 hour. Cells were washed once with PBE, resuspended in 15 ml PBE and filtered through a 70 µm strainer, and the PSMA binding yeast cells were isolated using one Miltenyi Macs LS column as described above. The third round magnetic sorting gave rise to 1×10 7< clones.Yeast display scFv library panning using flow sorting

[0304] Yeast cells obtained from the third magnetic sorting were further subjected to three rounds of flow sorting. All the centrifuging were 3000 rpm for 5 minutes and all the steps were at 4°C or on ice if not indicated otherwise. 2×10 9< cells isolated from the third magnetic sorting were induced in 100 ml S-CAA-GRD medium at 20 °C overnight, from which, 1×10 8< cells were taken for the first round flow sorting. Cells were pelleted and washed twice with 15 ml PBE and then resuspended in 1 ml PBE and incubated with 0.2 µg biotinylated PSMA protein at RT for 1.5 hours and then at 4 °C for half hour. Cells were washed three times with PBE and then incubated with 50 µl anti-V5-Alexa647 (AbD Stereo) and 50 µl Streptavidin-PE (SA-PE) (BD biosciences) in 1 ml PBE at 4 °C for 1 hour in darkness. After staining, cells were washed three time with 15 ml PBE and resuspended in 1 ml PBE for flow sorting by flowcytometry, in which Alexa647 and PE double positive cells were sorted as PSMA binding population. Staining controls that were also set up in parallel included: (1) unstaining control; (2) anti-V5-Alexa647 staining only; and (3) SA-PE staining only. 1.2×10 6< double positive cells were sorted and cultured on SD-CAA plates at 30°C for 2 days.

[0305] Cells isolated from the first flow sorting were further subjected to the second and third flow sorting. Sample preparation was similar to the first flow sorting except that in the second flow sorting, 50 ng biotinylated PSMA protein and anti-biotin-FITC (Abcam) were used instead for staining; and in the third round flow sorting, biotinylated PSMA protein further decreased to 2 ng and SA-PE was used for detection of PSMA binding. Finally, 1×10 6< and 2×10 4< cells (top 0.1% population) were sorted in the second and third flow sorting.Example 2: Identification of individual anti-PSMA clonesConversion of enriched display scFv library to secretory scFv library

[0306] Plasmid harboring the scFv gene in the display EBY100 cells were extracted and scFv gene fragments were amplified and cloned into the secretory vector pYS1 and transformed into yeast strain YVH10 for secretory scFv expression.

[0307] Yeast plasmid was extracted after expansion of the top 0.1% population sorted during the third flow sorting following the protocol of a yeast plasmid extraction kit (Zymo Research) and the scFv gene fragments were amplified by PCR using the following primers, Forward: 5'-GACTACAAGGACGACGATGAC-3' (SEQ ID NO: 111), and Reverse: 5'-AGTAGAATCAAGACCTAGTAGAGGG-3' (SEQ ID NO: 112). The amplified scFv gene fragments were then purified and co-transformed into yeast strain YVH10 along with Sfi I / Not I linearized secretory scFv expression vector pYS1. The molar ratio of the scFv gene / vector was 3:1 and 1 µg vector was used for transformation. YVH10 competent cell preparation and transformation was described previously (Zhao et al., J Immunol Methods. 2011; 363(2):221-32.). Transformed cells were cultured on SD-CCA-Trp (SD-CAA plus 0.008% tryptophan) at 30 °C for 2 days.Identification of PSMA binding scFv clones

[0308] Three hundred and eighty four secretory scFv clones were picked, cultured in SD-CAA-Trp and soluble scFv expression was induced in 96 deep well plates for 2 days at 20°C in S-CAA-GRD-Trp. PSMA binding scFv was identified using ELISA. Briefly, ELISA plates were coated with 50 µl / well 1µg / ml anti-Flag antibody (Sigma) at 4 °C overnight, washed twice with PBST (PBS containing 0.05% Tween 20) and blocked with PBSTM (PBST containing 5% non-fat dry milk (Biorad)) for 2 hours at RT. The plates were then incubated with 100 µl scFv containing supernatant that was 1:1 diluted with PBSTM at RT for 1 hour, washed six times with PBST and then incubated with 0.4 µg / ml, 50 ml / well biotinylated PSMA protein in PBSTM at RT for 1 hour. After 6 washes as above, the plates were incubated with 100 µl 1:1000 diluted Streptavidin-HRP)(BD Biosciences) in PBSTM at RT for 1 hour, washed again for six times and TMB (KPL) and stop buffer was incubated sequentially with the plate to develop colorimetric assay. Light absorbance was measured at OD450. Among the 384 clones analyzed, 260 showed positive signals (OD450 values are greater than two folds of the background value). Ninety-six randomly picked clones were further analyzed for PSMA binding. Results showed that all of bound specifically to PSMA but not to control protein Fc (human IgG1 Fc recombinant protein), among which, 30 clones were picked for plasmid extraction, and scFv fragments were PCR amplified and sequenced after purification using a Qiagen PCR purification kit. The PCR primers are: forward: CTATTGCCAGCATTGCTGC (SEQ ID NO: 113), reverse: ATAGGGACCTAGACTTCAGG (SEQ ID NO: 114); the sequencing primers are: forward: CCTTCTACTCCTCCTACACC (SEQ ID NO: 115), reverse: GGAGGGCGTGAATGTAAGC (SEQ ID NO: 116). Sequencing showed all the clones have almost the same scFv sequence, i.e., gy1 as shown in SEQ ID NOs 2, 4 and 20, with some point mutations shown in SEQ ID NOs: 38, 40, 42, 44, 46, 48, and 50.Example 3: characterization of anti-PSMA scFv

[0309] Yeast display library panning used recombinant extracellular domain of PSMA, which may have a different conformation from the one expressed on living cell surface. Therefore, it is necessary to evaluate the binding capability of gy1 scFv to natively conformational PSMA expressed on cell surface, and the internalization upon antigen binding.Binding of gy1 scFv to PSMA expressed on cells surface

[0310] scFv gy1 binding on PSMA was studied on LNCap FGC cells using flowcytometry. Briefly, LNCap FGC cells were cultured in RPMI 1640 medium containing 10% FBS at 37 °C with 5% CO 2 . Cells were washed with PBS and detached by incubation with 0.02% Versene buffer (1.37 M NaCl, 26.8 mM KCl, 80.7 mM Na 2 HPO 4 , 14.7 mM KH 2 PO4, 5.4 mM disodium EDTA, 0.2% D-glucose). Cells were washed once with PBS and incubated on ice for 1 hour with gy1-containing yeast supernatant that was diluted 3-fold with FACS (PBS containing 0.2% FBS) buffer. Cells were washed three time with cold PBS and then incubated with 1: 200 diluted anti-V5-Alexa647 in FACS buffer on ice for 1 hour in darkness. Non-bound anti-V5-Alexa647 was removed by three time washes with cold PBS and then cells were resuspended in 300µl FACS containing 8µl via-probe (BD biosciences). Gyl binding on LNCap FGC cells were detected using flow cytometry where only living cells were gated and analyzed. Flow cytometry controls include: (1) dead cells resuspended in via-probe containing FACS buffer. Dead cells were prepared by freeze-thawing cells at -80 °C and 37 °C for two cycles; (2) dead cells resuspended in FACS buffer without via-probe; (3) unstaining cells with via-probe; and (4) anti-V5-Alexa647 staining only with via-probe. Results showed that gy1 scFv could significantly bind on Ln-Cap FGC cells (Figure 1).Internalization

[0311] Internalization is the prerequisite for an antibody if used to deliver drugs selectively into tumor cells. To evaluate the potential of gy1 for development of ADC, immunotoxin and nanomedicine, gy1 internalization was examined using flow cytometry. Flow cytometry is a simple alternative to confocal for internalization assay. The rationale is that internalization is an active process that is very efficient at 37 °C but will not happen at 4 °C. If dye-labeled antibody are incubated with cells at 37 °C and 4 °C respectively, antibody molecules will bind on cell surface and some of them will be internalized at 37 °C; while antibody will bind on cell surface only at 4 °C because internalization will not happen. Trypsin is then used to remove all the cell surface proteins, including the dye labeled antibody. Positive dye signal in cells indicates internalization occurred while negative dye signal means internalization did not occur.

[0312] Briefly, LnCap FGC cells were seeded in two 48 well plates. The next day, 100 µl gy1 scFv containing yeast supernatant was preincubated with 4 µl anti-V5-Alexa467 in 200 µl volume (100 µl supernatant plus 100 µl cell medium) at RT for 1 hour. Then, cells were washed once with medium and incubated with the 200 µl gy1 containing medium (100 µl fresh medium plus 100 µl preincubated gy1-dye medium) at 37 °C and 4 °C respectively for 1 hour in darkness. As controls, cells were also incubated with same concentrated anti-V5-Alexa467 for the both temperatures. After two washes with cold PBS, 200 µl trypsin was added into wells to digest cell surface proteins for 30 min at RT. Then 500 µl medium was added to each well to stop trypsinization and cells were washed twice and then suspended in via-probe containing FACS buffer for flowcytometry analysis. Dead cell controls were also set up as above.

[0313] Flow cytometry results showed that when gy1 scFv was incubated with Ln-Cap FGC cells at 4 °C, antibody could only bind on cell surface; while when the incubation was at 37 °C, gy1 scFv could not only bind to cells, but also significantly internalized (Figure 2), which laid the foundation of PSMA targeted drug delivery using gy1 antibody or antibody fragments.Affinity measurement

[0314] Soluble gy1 expression YVH10 clone cultured in SD-CAA-Trp medium was scaled up to 500 ml and then cells were pelleted and resuspended in the same volume YEPD-GRD-Trp induction medium (YEPD medium contains Peptone 20 g / L, yeast extact 10 g / L, Dextrose20 g / L. YEPD-GRD-Trp is YEPD medium containing 1 g / L dextrose, 20 g / L galactose and 20 g / L raffinose and 0.008% tryptophan ) to induce scFv expression at 20 °C for 4 days. scFv was purified using Nickel column because scFv has a 6xHis tag at C terminus. The supernatant were filtered through a 0.45 µm filter and pH was adjusted to 8.0 by mixing with same volume EQ buffer (0.3 M NaCl, 0.05 M phosphate buffer, pH8.0) and loaded on a HisTrp HP column (GE healthcare) that equilibrated with 5 column volume EQ buffer. Column was washed with more than 10 column volume wash buffer (EQ buffer containing 10 mM imidazole) and scFv was eluted with elution buffer (EQ buffer containing 250 mM imidazole). scFv was then concentrated with centrifugal filter units (Amico) and imidazole was removed by dialysis againt PBS. Aliquoted scFv was stored at -80 °C.

[0315] Capture ELISA was used to measure the affinity of gy1 scFv. There is a Flag tag and a V5 tag at the N and C terminus of scFv, and thus antibodies to these tags were used to capture the scFv for ELISA assay. Briefly, anti-Flag antibody (Sigma) was coated on ELISA plate at 1µg / ml, 50 µl / well at 4 °C overnight in PBS. Plates were washed twice with PBST, blocked with PBSTM 2 hours at RT and incubated with triplicate 3-fold serially diluted gy1 scFv, starting from 100 nM down to 0.137 nM in PBSTM at RT for 1 hour. Plate was washed 6 times with PBST and then incubated with 0.5 µg / ml biotinylated PSMA in PBSTM for 1 more hour at RT. After 6 washes, plate was incubated with 1: 1000 diluted streptavidin-HRP (BD Bioscience) in PBSTM at RT for 30 min. Plate was washed again for 6 times and incubated with TMB for 20 min at RT, colorimertric reaction was stopped with stop buffer and the absorbance was read at OD450. Affinity was calculated using GraphPad Prism software, which was Kd=1.165 nM (Figure 3).Example 4: Gy1 expression and purification in E.coli

[0316] Over glycosylation of recombinant proteins expressed in yeast usually arises immunogenicity issues which may restrain their clinical application. To overcome this potential problem, prokaryotic expression of gy1 scFv in E.coli was pursued. The gy1 gene was amplified and cloned into the prokaryotic expression vector pET302 (named pET302-gy1), and then transformed into E. coli BL21 and induced to expression by 0.05 mM isopropyl-1-thio-b-galactopyranoside (IPTG) for 4 hours at 30 °C. E.coli cells were lysed using sonicator and gy1 protein was then purified using HisTrp HP column as described above (Figure 4). An anti-HER2 scFv (named NCP1) was expressed and purified in the same way and was used as a negative control.

[0317] Binding of E.coli expressed gy1 scFv to PMSA positive and negative cells was studied using flow cytometry. Briefly, Prostate cancer cells, LNCaP, C4-2, PC3-PSMA+ and PC3-PSMA-cells were detached with Versene solution (1.37 M NaCl, 26.8 mM KCl, 80.7 mM Na 2 HPO 4 , 14.7 mM KH2PO4, 5.4 mM disodium EDTA, 0.2% D-glucose) and suspended in PBS at a density of 1×10 6< cells / mL, cells were washed with PBS and incubated with 100 nM gy1 or control scFv NCP1 at 4°C for 30min, followed by washing and incubation with FITC-conjugated mouse anti-6His IgG (AbD Serotec; Bio-Rad) for 30 minutes at 4°C in darkness. Cells were then washed and analyzed by flow cytometry. In parallel, PSMA protein expression was detected by a PE conjugated commercial anti-PSMA monoclonal antibody (Biolegend, CA, USA). Results showed that E.coli expressed gy1 can bind only PSMA positive cells, but not negative cells (Figure 5).Example 5: gy1 affinity measurement by cell ELISA

[0318] To evaluate the binding affinity of E.coli expressed gy1 scFv to cell surface PSMA, PSMA-positive C4-2 cells were seeded at 5 × 10 4< per well in 96-well plate and cultured overnight. The next day, cells were fixed with 4% paraformaldehyde for 20 min before being treated with 3% H 2 O 2 for 20 minutes to block endogenous peroxidase followed by blocking with 6% bovine serum albumin for 30 min at room temperature. Three-fold serially diluted gy1 and the control scFv NCP1, from 8100 nM down to 0.005 nM, were added and incubated for 1 hour at 37 °C. Cells were then washed with PBST and incubated with HRP-conjugated mouse anti-6His antibody (AbD Serotec, Bio-Rad, Oxford, UK) for 1h at room temperature. Colorimetric signals were developed by addition of 3, 3', 5, 5'-tetramethylbenzidine (TMB, eBioscience, CA, USA) and stopped by incubation with 1 M H 2 SO 4 for 15 minutes. The absorbance was measured at 450 nm using a Sunrise microplate reader (Tecan, Groedig, Austria) and the binding curves were analyzed using GraphPad Prism 5.0 software. The gy1 affinity was calculated using non-linear regression analysis of a one-site binding hyperbola equation. The affinity of E.coli expressed scFv gy1 was calculated as Kd=4.134nM (Figure 6)Example 6: gy1 internalization assay using confocal imaging

[0319] E.coli expressed gy1 scFv was used to study internalization using confocal imaging. Prostate cancer cells, i.e., LnCap, C4-2, PC3-PSMA +< , and PC3-PSMA -< , grown on coverslips at 50% confluence were incubated with 200 nM gy1 or NCP1 for 2 h at 37°C. Cells were washed, fixed with 4% paraformaldehyde for 20 minutes. Internalized gy1 was detected by FITC-conjugated mouse anti-6His IgG (AbD Serotec; Bio-Rad). Cell were then stained with 4',6-diamidino-2-phenylindole (DAPI) to visualize the nuclei. Finally, cells were washed with PBS and mounted on slides and observed under laser scanning confocal microscopy (FluoView FV1000, Olympus). Results showed that intense fluorescence signal can be observed in the cytoplasm of PSMA positive cell lines LNCaP, C4-2 and PC3-PSMA+. While in PSMA negative PC3-PSMA-cells, no fluorescence signal can be detected (Figure 7). These results further demonstrated that gy1 can be effectively internalized into PSMA positive cells.

[0320] To investigate the subcellular transportation of gy1 after internalization, immunofluorescent staining was performed to examine the co-localization of gy1 (green fluorescence) with certain cellular organelles, including endosome, lysosome, Golgi and ER (red fluorescence) in C4-2 cells. Staining of the cellular organelles were performed using CellLight ®< Reagents (Invitrogen Life technologies, CA, USA) including CellLight ®< Lysosomes-RFP, CellLight ®< Endosomes-RFP, CellLight ®< Golgi-RFP and CellLight ®< ER-RFP according to the manufacturer's protocol. Cell images were captured by laser scanning confocal microscopy (FluoView FV1000, Olympus). Results showed that after a 4 hour incubation, gylwas predominantly accumulated in endosomes and lysosomes (yellow fluorescence, Figure 8A), suggesting that gy1 internalizes into target cells through the endosome-lysosome pathway. There was no overlap between the signals of gy1 and Golgi or ER for different periods of incubation times (Figure 8B).

[0321] Internalized protein mainly have two trafficking pathways. One is directly through endosome to lysosome and the other is from Golgi apparatus to ER, which is called retrograde trafficking and is commonly used for recycling transportation. It was further investigated whether gy1 may also use the second pathway by co-staining gy1 with Golgi apparatus or ER. Results showed that even being incubated for different time points, no co-localization could be observed between gy1 and Golgi or ER (Figure 8B). which abrogates the possibility of the second trafficking pathway after gylinternalization.Example 7: In vivo tumor targeting by gy1

[0322] To evaluate the capability and efficiency of gy1 for in vivo PSMA targeting, as well as to evaluate the feasibility of gy1 based intraoperative optical imaging for PCa, PSMA positive and negative xenograft nude mouse models were established using luciferase-expressing PC3-PSMA+ and PC3-PSMA- cells. The xenograft tumor models were developed by injecting 5×10 6< firefly luciferase-expressing PC3-PSMA+ or PC3-PSMA- cells in 0.1 mL PBS subcutaneously in the right hip of each mouse. Two weeks after inoculation, tumor tissue was isolated and H&E and immunohistochemistry staining were performed to check the tissue morphology and PSMA expression level. Results showed PSMA can be detected in the PC3-PSMA+ prostate cancer tissue, but not the PC3-PSMA- prostate cancer tissue (Figure 9). Luciferase expression was also confirmed in both xenograft models by Xenogen IVIS Kinetic imaging system (Figure 11, left panel). This pair of PSMA positive and negative prostate cancer xenograft mouse model was used for gy1 targeting evaluation.

[0323] For in vivo optical imaging study, the gy1 and NCP1 proteins were labeled with IRDye800 using IRDye800cw labeling kit (Li-Cor Biosciences, Nebraska, USA) with a protein / dye ratio of 1: 20 at concentration of 1 mg / ml following the manufacture's protocol. Extra dye was removed through dialysis. Dye labeling did not compromise the PSMA binding affinity of gy1 as confirmed on PC3-PSMA+ cells by flow cytometry analysis (Figure 10). For each mouse, 0.2 µmol / kg of the IRDye800-labeled gy1 or NCP1 was injected intravenously, and the mouse was anesthetized at indicated time points and the IRDye800 fluorescence was monitored in a real-time manner under the Xenogen IVIS Kinetic imaging system at an excitation wavelength of 745 nm. Identical illumination settings (1 second exposure, f / stop = 2) were used for all images. In parallel with the in vivo whole-body near-infrared fluorescence imaging (FLI), five mice in each group treated for 12 hours were sacrificed and different tissues were isolated and their fluorescence intensities were analyzed. Fluorescence intensities were calculated using Living Image software and presented as photon flux (p / s / cm 2< / sr).

[0324] Results showed that the IRDye800 labeled gy1 diffused rapidly throughout the whole body after 1 hour and can be detected in tumor tissues from 2 hours. The IRDye800 labeled gy1 was then gradually cleared from the body, but was still specifically retained in PSMA positive tumor tissues, but not in PSMA negative tumor tissues (Figure 11, right panel, Figure 12). Highest signal / background ratio in tumor was obtained at 6 hour post-injection, and the signal in tumor was nearly undetectable after 24 hours. Five mice in each group were sacrificed at 12 hours after gy1 injection and different tissues were collected for further bio-distribution evaluation. Consistent with the FLI data, strongest fluorescent signal can be detected in tumor tissues in the PC3-PSMA+ group, relatively weak signals can be detected in kidney, liver and spleen, while only negligible signals can be detected in other tissues. While in the PC3-PSMA- group, no obvious fluorescent signal can be detected in tumor tissues (Figure 13A and Figure 13B). These data suggested that gy1 can specifically target and distribute in PSMA positive tumor tissues in vivo, which encourages the development of PSMA targeted imaging and therapy strategy using gy1, such as intraoperative optical imaging, PET imaging, nanomedicine and antibody drug conjugate.Example 8: Engineering of gy1 scFv into full antibody

[0325] Gy1 scFv with mutations of SEQ ID NOS: 40 / 41, 42 / 43, 44 / 45, 46 / 47 (gy1-2) were engineered into full antibody by grafting signal peptides and constant regions for both heavy and light chains respectively. By sequence analysis of antibody germline data base, IGHV3-30-3*02 and IGLV1-50*01 signal peptide, and IgG1 and CL1 constant regions were chosen for heavy and light chain respectively. The nucleic acid and amino acid sequence of heavy and light chain is shown in SEQ ID NOs. 52 / 53 and 60 / 61 and matured heavy and light chain (after signal peptide cleavage) sequences are shown in SEQ ID NOs. 68 and 69. The engineered full antibody was named PSMAb. The nucleic acid sequences of heavy and light chain were codon optimized for CHO cell expression, synthesized, and cloned into vector pcDNA3 respectively. Recombinant PSMAb was expressed by transient co-transfection of heavy and light chain expression vector at the ratio of 1:4 into suspension CHO cells (CHO-S) following the manufacture's protocol (FreeStyle ™< CHO Expression system of life technologies). After 7 days expression, the supernatant was collected and PSMAb was purified using HiTrap rProtein A FF column (GE healthcare life sciences). Briefly, supernatant was mixed with same volume buufer A (20 mM sodium pho'sphate buffer, pH 7.0), filtered through a 0.45 µm membrane and applied onto a HiTrap rProtein A FF column that was equilibrated with 5 column volume buffer A. Column was washed with 10 column volume buffer A and antibody was eluted with buffer B (0.1 M citric acid, pH 3.5) and neutralized with buffer C (1.0 M Tris-Hcl pH 9.0). Antibody was buffer changed into PBS by dialysis, aliquoted and stored at -80 °C (Figure 14A).Example 9: characterization of PSMAb full antibodyAffinity measurement

[0326] ELISA was used to measure the affinity of PSMAb as described in Example 5, except that a control human IgG1 (Sigma) was used instead of PSMAb for negative controls, and a HRP-conjugated anti-human IgG Fc Ab (1:20000, Abcam) was used as the secondary antibody. PSMAb 3-fold serially dilution started from 100 nM down to 0.19 pM. The calculated affinity of PSMAb is 0.1 nM (Figure 14B)Cell binding and blocking assay

[0327] PSMAb binding to PSMA expressed on cell surface have been studied by flow cytometry on several prostate cell lines, i.e., PSMA+ cells C4-2, LNCaP, PC-3-PSMA+, and PSMA- cells PC-3 and DU-145. Briefly, detached cells were incubated with PSMAb, negative control human IgG (Sigma) or positive control antibody LNI-17 (Biolegend) first, after 3 washed and then incubated with 1:20 diluted PE conjugated secondary antibody (Biolegend). Cell binding signal was deteced by flowcytometry. Results showed that PSMAb can bind only on PSMA-positive cells, but not negative cells (Figure 15), consistent with the PSMA expression levels confirmed by LNI-17 staining.

[0328] To further confirm the binding of PSMAb to PSMA+ cells was PSMA specific, a blocking assay was performed using recombinant PSMA protein or control protein BSA. The blocking assay was studied on PC3-PSMA+ cells using flow cytometry as described above, except that before incubation with cells, PSMAb at concentration of 2 nM was pre-incubated with 2, 6 and 10 nM recombinant PSMA, or 10 nM BSA as a control at RT for 2 hours. Results showed that PSMA recombinant protein can completely block the binding of PSMAb to PC3-PSMA+ cells even at the same concentration of the antibody, i.e., 2 nM (Figure 16).Internalization of PSMAb

[0329] Internalization of PSMAb was studied on prostate cancer cells C4-2, LNCaP, PC-3 and DU-145 as described in Example 6 except that a control human IgG1 was used as negative control and the secondary antibody was FITC conjugated anti-human IgG Fc antibody (1:50; Santa Cruz biotechnology,USA). Results demonstrated that PSMAb can be selectively and effectively internalized into PSMA positive cells (Figure 17).Example 10: In vivo tumor targeting of PSMAb

[0330] To evaluate the efficiency of tumor targeting and the potential for intraoperative optical imaging of PSMAb, PSMAb was labeled with a near infrared dye IRDye800CW, and 50 µg labeled PSMAb / mouse was tail-vein injected to the PC3-PSMA+ or PC3-PSMA- xenograft model and the real time biodistribution of PSMAb was monitored using Xenogen IVIS Kinetic imaging system as described in Example 7. In vivo optical imaging showed that PSMAb diffused rapidly throughout the whole body and can be detected in tumor tissues from 24 hours post-injection, and was then gradually cleared from body while specifically retained at PSMA+ tumor, but not PSMA- tumor (Figure 18A - Figure 18C). Good signal / background ratio was observed 48 hours post-injection (Figure 18A - Figure 18C). Compared to scFv, full antibody has a longer circulation time and therefore a better signal / background ratio for optical imaging.Example 11: DM1 antibody drug conjugation

[0331] To develop PSMA targeted ADC, PSMAb was conjugated with DM1via a stable linker SMCC (Figure 19). Briefly, PSMAb was buffer exchanged to 50 mM Potassium Phosphate, 50 mM NaCl, 2 mM EDTA, pH7.2, and concentration was adjusted to 4 mg / ml. SMCC-DM1 (Concortis Biosystems) was dissolved in DMA to get a final concentration of 10 mM. Into each volume of antibody solution, add 0.43% volume DMA, mix, then add 2.67% volume 10 mM SMCC-DM1. The final concentration of DMA is 3% (v / v) and drug / Ab ratio is 10:1. The solution is allowed to proceed for three hours at room temperature with mixing and then buffer was exchanged to PBS by dialysis. The drug / Ab conjugation ratio was measured at 3.3 as described previously (US 20060088539 A1) based on the absorbance at 252 and 280 nm of the conjugate.Example 12: MMAE and MMAF antibody drug conjugation

[0332] To develop PSMA targeted ADC, PSMAb was conjugated with MMAE and MMAF respectively via a cleavable linker Mc-vc-PAB (Figure 20). Antibody concentration was adjusted to 8 mg / ml in 0.025 M sodium borate pH8, 0.025 M NaCl, 1 mM DTPA and was partially reduced by 2.75 molar equivalents of TCEP for 2 hours at 37 °C. The mixture was then cooled to 0 °C and the antibody concentration was adjusted to 5.625 mg / ml and was mixed with 0.25 volume 700 mM MC-vc-PAB-MMAE and MC-vc-PAB-MMAF dissolved in cold acetonitrile and the reaction was allowed to continue for 30 minutes on ice. The excess MC-vc-PAB-MMAE or MC-vc-PAB-MMAF was quenched with cysteine (1 mM final concentration). The antibody drug conjugate was purified using PD-10 column as described (Kevin J. Hamblett et al., 2004, Clin Cancer Res, 10; 7063). Drug loading is determined for MMAE and MMAF at 3.5 and 3.03 per antibody by measuring the ratio of the absorbance at 250 and 280 nM as described (Kevin J. Hamblett et al., 2004, Clin Cancer Res, 10; 7063).Example 13: PSMAb retains PSMA binding and internalizaton capability after drug conjugation

[0333] After conjugation with DM1, MMAE or MMAF, PSMA binding and internalization of PSMAb drug conjugate were evaluated by flow cytometry and confocal imaging respectively as described above. The results showed that antigen binding and internalization of PSMAb drug conjugate were well retained (Figure 21 and Figure 22).Example 14: PSMA specific cytotoxicity of PSMAb antibody drug conjugates

[0334] Cytotoxicity of PSMAb based ADCs were evaluated on PSMA- cell line PC-3 and PSMA+ cell line C4-2. Briefly, C4-2 and PC-3 cells were seeded in 96 well plates in DMEM medium with 10% FBS, 2000 cells / 200 mL / well. The next day, cell density was around 20-30% and medium was changed to fresh medium containing PSMAb-DM1, PSMAb-MMAE or PSMAb-MMAF at the concentrations of 333.33 nM, 133.33 nM, 66.67 nM, 33.33 nM, 6.67 nM, 3.33 nM, 0.67 nM, 0.33 nM, 0.067 nM, 0.0067 nM, 0.00067 nM and 0.000067 nM with triplications of each concentration. Medium was changed daily with the same drug concentrations for each well. After 4 day incubation, cell viability was evaluated using alamarBlue kit (Invitrogen) following manufacture's protocol. Results showed that PSMAb-DM1, PSMAb-MMAE and PSMAb-MMAF have no toxicity on PC-3 cells but a dose dependent toxicity on C4-2 cells, with IC50 at 0.12 nM, 0.59 nM and 0.92 nM respectively for PSMAb-DM1, PSMAb-MMAE and PSMAb-MMAF (Figure 23).Example 15: PSMA-ADC specifically induce apoptosis of in PSMA+ cells

[0335] To further investigate the mechanism of PSMAb ADC in PSMA specific cell killing, PSMAb ADC induced apoptosis was studied in PC-3 and C4-2 cells. Briefly, PC-3 and C4-2 cells were seeded in 6 well plates at the density of 2×10 5< / 2 ml medium / well and cultured overnight. The next day, medium was changed and cells were incubated with PSMAb-ADC at the concentrations of 50 µg / ml, 20 µg / ml, 10 µg / ml, 5 µg / ml, 1 µg / ml, 0.5 µg / ml, 0.01 µg / ml, and 0.001 µg / ml in 2 ml medium. Human IgG and PSMAb at the concentration of 50 mg / ml were used as controls. After 48 hour incubation, cells were trypsinized and washed twice with PBS, and stained with Annexin-V / PI (Roche) following the manufacture's instruction. Apoptosis was detected using flow cytometry, signals with Annexin- V(+) / PI (-) indicating early apoptosis and double positive staining, i.e., Annexin- V(+) / PI (+), indicating late apoptosis. Total apoptosis is the sum of early and late apoptosis. Results showed that all the three PSMAb based ADCS, i.e., PSMAb-DM1, PSMAb-MMAE, and PSMAb-MMAF, were capable of efficient induction of both early and late apoptosis, while PSMAb-DM1 mainly induced late apoptosis and PSMAb-MMAE and PSMAb-MMAF mainly induced early apoptosis (Figure 24).Example 16: Sequences

[0336] SEQ ID NO: 1 Extracellular domain of PSMA: SEQ ID NO: 2 gy1 scFv nucleic acid sequence: SEQ ID NO: 3 gy1 scFv amino acid sequence: SEQ ID NO: 4 gy1 VL nucleic acid sequence: SEQ ID NO: 5 gy1 VL amino acid sequence: SEQ ID NO: 6 gy1 VL frame region 1 (FR1) nucleic acid sequence: SEQ ID NO: 7 gy1 VL frame region 1 (FR1) amino acid sequence: QSVLTQPPSVSGAPGQSVIISCTGS SEQ ID NO: 8 gy1 VL CDR1 nucleic acid sequence: AGCTCCAACATCGGGGCAGGTTCTCAT SEQ ID NO: 9 gy1 VL CDR1 amino acid sequence: SSNIGAGSH SEQ ID NO: 10 gy1 VL frame region 2 (FR2) nucleic acid sequence: GTACACTGGTACCAGCAGGTTCCAGGAACAGCCCCCAAACTCCTCATCTAT SEQ ID NO: 11 gy1 VL frame region 2 (FR2) amino acid sequence: VHWYQQVPGTAPKLLIY SEQ ID NO: 12 gy1 VL CDR2 nucleic acid sequence: GGAAACACC SEQ ID NO: 13 gy1 VL CDR2 amino acid sequence: GNT SEQ ID NO: 14 gy1 VL frame region 3 (FR3) nucleic acid sequence: SEQ ID NO: 15 gy1 VL frame region 3 (FR3) amino acid sequence: NRPSGVPDRFSGSKSGTSGSLAITGLQPEDEADYYC SEQ ID NO: 16 gy1 VL CDR3 region nucleic acid sequence: GCAACATGGGATGACAGTCTGAATGGTGTAATA SEQ ID NO: 17: ATWDDSLNGVI SEQ ID NO: 18: TTCGGCGGAGGGACCAAGGTCACCGTCCTA SEQ ID NO: 19 gy1 VL frame region 4 (FR4) amino acid sequence: FGGGTKVTVL SEQ ID NO: 20 gy1 VH nucleic acid sequence: SEQ ID NO: 21 gy1 VH amino acid sequence: SEQ ID NO: 22 gy1 VH frame region 1 (FR1) nucleic acid sequence: SEQ ID NO: 23 gy1 VH frame region 1 (FR1) amino acid sequence: EVQLVESGGALAKPGGSLRLSCAAS SEQ ID NO: 24 gy1 VH CDR1 nucleic acid sequence: GGATCCACCCTCAGTGGCTATGCT SEQ ID NO: 25 gy1 VH CDR1 amino acid sequence: GSTLSGYA SEQ ID NO: 26 gy1 VH frame region 2 (FR2) nucleic acid sequence: ATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTT SEQ ID NO: 27 gy1 VH frame region 2 (FR2) amino acid sequence: MHWVRQAPGKGLEWVAV SEQ ID NO: 28 gy1 VH CDR2 region nucleic acid sequence: ATATCATATGATGGAAGCAATAAA SEQ ID NO: 29 gy1 VH CDR2 region amino acid sequence: ISYDGSNK SEQ ID NO: 30 gy1 VH frame region 3 (FR3) nucleic acid sequence: SEQ ID NO: 31 gy1 VH frame region 3 (FR3) amino acid sequence: YYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAVYYC SEQ ID NO 32 gy1 VH CDR3 region nucleic acid sequence: GCTAAAGGCCTTACTTGGGGACTCGGTGACAATGATGCTCTCGATATC SEQ ID NO: 33 gy1 VH CDR3 region amino acid sequence: AKGLTWGLGDNDALDI SEQ ID NO: 34 gy1 VH frame region 4 (FR4) nucleic acid sequence: TGGGGCCCCGGGACCACGGTCACCGTCTCCTCA SEQ ID NO: 35 gy1 VH frame region 4 (FR4) amino acid sequence: WGPGTTVTVSS SEQ ID NO: 36 gy1 scFv Linker nucleic acid sequence: GGCGGATCCTCTAGGTCAAGTTCCAGCGGCGGCGGTGGCAGCGGAGGCGGCGGT SEQ ID NO: 37 gy1 scFv Linker amino acid sequence: GGSSRSSSSGGGGSGGGG SEQ ID NO: 38 gy1 VL frame region 2 (FR2) nucleic acid sequence with point mutation: GTACACTGGTACCAGCAGGCTCCAGGAACAGCCCCCAAACTCCTCATCTAT SEQ ID NO: 39 gy1 VL frame region 2 (FR2) amino acid sequence with point mutation: VHWYQQAPGTAPKLLIY (V=>A) SEQ ID NO: 40 gy1 VL CDR2 nucleic acid sequence with point mutation: GAAAACACC SEQ ID NO: 41 gy1 VL CDR2 amino acid sequence with point mutation: E N T (G=>E) SEQ ID NO: 42 gy1 VL frame region 4 (FR4) nucleic acid sequence with point mutation: TTCGGCGGAGGGACCAAGGCCACCGTCCTA SEQ ID NO: 43 gy1 VL frame region 4 (FR4) amino acid sequence with point mutation: F G G G T K A T V L (V=>A) SEQ ID NO: 44 GGATTCACCCTCAGTGGCTATGCT SEQ ID NO: 45 gy1 VH CDR1 amino sequence with point mutation: G F T L S G Y A (S=>F) SEQ ID NO: 46: SEQ ID NO: 47 gy1 VH frame region 3 (FR3) amino acid sequence with point mutation SEQ ID NO: 48 gy1 VH CDR3 region nucleic acid sequence with point mutation: GCTAAAGGCCTTACTTGGGGACTCGGTGACAATGATGCTCTCGGTATC SEQ ID NO: 49 gy1 VH CDR3 region amino acid sequence with point mutation: A K G L T W G L G D N D A L G I (D=>G) SEQ ID NO: 50: TGGGGCCCCGAGACCACGGTCACCGTCTCCTCA SEQ ID NO: 51 gy1 VH frame region 4 (FR4) amino acid sequence with point mutation: W G P E T T V T V S S (G=>E) SEQ ID NO: 52 PSMAb heavy chain nucleic acid sequence: SEQ ID NO: 53 PSMAb heavy chain amino acid sequence: SEQ ID NO:54 PSMAb heavy chain signal peptide nucleic acid sequence: ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGT SEQ ID NO: 55 PSMAb heavy chain signal peptide amino acid sequence: M E F G L S W V F L V A L L R G V Q C SEQ ID NO: 56 PSMAb heavy chain variable region nucleic acid sequence: SEQ ID NO: 57 PSMAb heavy chain variable region amino acid sequence: SEQ ID NO: 58 PSMAb heavy chain constant region nucleic acid sequence: SEQ ID NO: 59 PSMAb heavy chain constant region amino acid sequence: SEQ ID NO: 60 PSMAb light chain nucleic acid sequence: SEQ ID NO: 61 PSMAb light chain amino acid sequence: SEQ ID NO: 62 PSMAb light chain signal peptide nucleic acid sequence: ATGGCCTGGTCTCCTCTCCTCCTCACTCTCCTCGCTCACTGCACAGGGTCCTGGGCC SEQ ID NO: 63 PSMAb light chain signal peptide amino acid sequence: M A W S P L L L T L L A H C T G S W A SEQ ID NO: 64 PSMAb light chain variable region nucleic acid sequence: SEQ ID NO: 65 PSMAb light chain variable region amino acid sequence: SEQ ID NO: 66 PSMAb light chain constant region nucleic acid sequence: SEQ ID NO: 67 PSMAb light chain constant region amino acid sequence: SEQ ID NO: 68 PSMAb heavy chain amino acid sequence without signal peptide: SEQ ID NO: 69 PSMAb light chain amino acid sequence without signal peptide: SEQ ID NO: 70 CD8a leader nucleic acid sequence: SEQ ID NO: 71 CD8a leader amino acid sequence: MALPVTALLLPLALLLHAARP SEQ ID NO: 72 CD8a hinge nucleic acid sequence: SEQ ID NO: 73 CD8a hinge amino acid sequence: TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD SEQ ID NO: 74 CD8a transmembrane domain nucleic acid sequence SEQ ID NO: 75 CD8a transmembrane domain amino acid sequence: IYIWAPLAGTCGVLLLSLVITLYC SEQ ID NO: 76 4-1 BB intracellular domain (ICD) nucleic acid sequence: SEQ ID NO: 77 4-1 BB intracellular domain (ICD) amino sequence: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL SEQ ID NO: 78 CD3 zeta nucleic acid sequence SEQ ID NO: 79 CD3 zeta amino acid sequence: SEQ ID NO: 80 gy1-2 CAR construct nucleic acid sequence: SEQ ID NO: 81 gy1-2 CAR construct amino acid sequence SEQ ID NO: 82 mOKT3 Murine scFv nucleic acid sequence: SEQ ID NO: 83 mOKT3 Murine scFv amino acid sequence: SEQ ID NO: 84 mOKT3 VH nucleic acid sequence: SEQ ID NO: 85 mOKT3 VH amino acid sequence: SEQ ID NO: 86 mOKT3 VL nucleic acid sequence: SEQ ID NO: 87 mOKT3 VL amino acid sequence: SEQ ID NO: 88 hOKT3 humanized scFv nucleic acid sequence: SEQ ID NO: 89 hOKT3 humanized scFv amino acid sequence: SEQ ID NO: 90 hOKT3 VH nucleic acid sequence: SEQ ID NO: 91 hOKT3 VH amino acid sequence: SEQ ID NO: 92 hOKT3 VL nucleic acid sequence: SEQ ID NO: 93 hOKT3 VL amino acid sequence: SEQ ID NO: 94 MUTATED IGG1 HINGE NUCLEIC ACID SEQUENCE: GAGCCCAAATCTGCTGACAAAACTCACACATGCCCACCGTGCCCA SEQ ID NO: 95 mutated IgG1 hinge amino acid sequence: EPKSADKTHTCPPCP SEQ ID NO: 96 mutated IgG4 Fc (N297A) nucleic acid sequence: SEQ ID NO: 97 mutated IgG4 Fc (N297A) amino acid sequence: SEQ ID NO: 98 mutated IgG1 Hinge-IgG4 Fc nucleic acid sequence: SEQ ID NO: 99 mutated IgG1 Hinge-IgG4 Fc amino acid sequence: SEQ ID NO: 100 scFv1 MCS-G4S-hOKT3 scFv-IgG1 hinge - IgG4 Fc expression cassette nucleic acid sequence: SEQ ID NO: 101 scFv1 MCS-G4S-hOKT3 scFv-IgG1 hinge - IgG4 Fc expression cassette amino acid sequence: SEQ ID NO: 102 scFv1 MCS-G4S-mOKT3 scFv-IgG1 hinge - IgG4 Fc expression cassette nucleic acid sequence: SEQ ID NO: 103 scFv1 MCS-G4S-mOKT3 scFv-IgG1 hinge - IgG4 Fc expression cassette amino acid sequence: SEQ ID NO: 104 anti-PSMA & hOKT3 bispecific Ab nucleic acid sequence (gy1-2): SEQ ID NO: 105 anti-PSMA & hOKT3 bispecific Ab amino acid sequence (gy1-2): SEQ ID NO: 106 anti-PSMA & hOKT3 bispecific Ab amino acid sequence (gy1-2) without signal peptide: SEQ ID NO: 107 anti-PSMA & mOKT3 bispecific Ab nucleic acid sequence (gy1-2): SEQ ID NO: 108 anti-PSMA & mOKT3 bispecific Ab amino acid sequence (gy1-2): SEQ ID NO: 109 anti-PSMA & mOKT3 bispecific Ab amino acid sequence (gy1-2): SEQ ID NO: 110 EFla promoter sequence:

Claims

1. An antibody or antigen-binding fragment thereof that specifically binds to prostate specific membrane antigen (PSMA), the antibody or antigen-binding fragment comprising a light chain region and a heavy chain region that comprise the respective sequences of SEQ ID NOs: 5 and 21.

2. The antibody or fragment of claim 1, comprising amino acid sequence SEQ ID NO: 3.

3. An antibody that specifically binds to prostate specific membrane antigen (PSMA), wherein the antibody comprises (i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 68 and a light chain comprising the amino acid sequence of SEQ ID NO: 69, or (ii) a heavy chain comprising the amino acid sequence of SEQ ID NO: 53 and a light chain comprising the amino acid sequence of SEQ ID NO: 61.

4. The antibody or fragment of any of claims 1 or 2, wherein said antibody or fragment thereof is selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgAsec, IgD, IgE or has immunoglobulin constant and / or variable domain of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgAsec, IgA or IgE.

5. The antibody or fragment of any of claims 1-4 wherein the antibody or fragment is conjugated to a cytotoxic agent, a drug, a growth inhibitory agent, a toxin, a radioactive isotope or a nanoparticle.

6. A multispecific antibody that binds two or more different epitopes on the same or different antigens, wherein one of the epitopes is on human prostate specific membrane antigen (PSMA) and the multispecific antibody comprises the antibody fragment as defined in any of claims 1-5.

7. An isolated chimeric antigen receptor (CAR), wherein the CAR comprises the antibody or fragment of any of claims 1-6, a transmembrane domain, and an intracellular signaling domain comprising one or more stimulatory domains.

8. An isolated nucleic acid molecule encoding the antibody or fragment or CAR of any of claims 1-7.

9. A vector comprising the nucleic acid molecule of claim 8.

10. A cultured host cell comprising the vector of claim 9.

11. A composition comprising the antibody, fragment, CAR, nucleic acid molecule, vector, or host cell of any of claims 1-10, wherein the composition is preferably a pharmaceutical composition further comprising a pharmaceutically acceptable carrier.

12. The composition of claim 11, for use in treating prostate cancer.

13. An in vitro method of diagnosing the presence of prostate cancer, said method comprising sampling a tissue sample isolated from said mammal with an antibody or an antigen-binding fragment thereof as defined in any of claims 1-5, whereby specific binding of the antibody or antibody fragment to said tissue sample is indicative of the presence of a prostate cancer in said mammal.