Antibodies targeting cd45

EP4637928A1Pending Publication Date: 2025-10-29CIMEIO THERAPEUTICS AG +1
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
EP2023838073
Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-07-28
Filing Date
2023-12-22
Publication Date
2025-10-29

AI Technical Summary

Technical Problem

Current anti-CD45 therapies face limitations in effectively targeting CD45 for the treatment of diseases associated with CD45, particularly in terms of specificity and efficacy, as existing antibodies may retain detrimental motifs that affect their performance.

Method used

Development of humanized antibodies and antibody fragments specifically designed for CD45, engineered to remove detrimental motifs within the CDR region while maintaining beneficial properties, including modifications such as replacing glycine with alanine, asparagine with lysine, and arginine with leucine, and incorporating mutations in the Fc region like PA-LALA, to enhance specificity and efficacy.

Benefits of technology

The humanized antibodies demonstrate improved potency and specificity for CD45, as shown by significant depletion of CD45+ cells and prevention of cell viability decrease in hematological cancer cell lines, with enhanced therapeutic potential for diseases like leukemia and autoimmune disorders.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000018_0001
    Figure IMGF000018_0001
  • Figure IMGF000046_0001
    Figure IMGF000046_0001
  • Figure IMGF000072_0001
    Figure IMGF000072_0001
Patent Text Reader

Abstract

The present disclosure relates to antibodies and antibody fragments that are specific for CD45. The antibodies are improved humanized versions of a murine antibody. In addition to a sophisticated humanization campaign, the antibodies were also engineered to remove several detrimental motifs within the CDR region without losing any beneficial properties. The antibodies are useful for the treatment of diseases associated with CD45.
Need to check novelty before this filing date? Find Prior Art

Description

[0001]Antibodies Targeting CD45 Field of the invention The present disclosure relates to antibodies and antibody fragments that are specific for CD45. The antibodies are improved humanized versions of a murine antibody. In addition to a sophisticated humanization campaign, the antibodies were also engineered to remove several detrimental motifs within the CDR region without losing any beneficial properties. The antibodies are useful for the treatment of diseases associated with CD45. STATEMENT REGARDING FUNDING The project leading to this application has received funding from the European Research Council (ERC) under the European Union’s Horizon 2020 research and innovation programme (grant agreement No 818806). Background CD45, also known as protein tyrosine phosphatase receptor type C (PTPRC), is an enzyme encoded by the PTPRC gene (Kaplan et al., PNAS 87:7000-7004 (1990)). CD45 is a member of the protein tyrosine phosphatase (PTP) family, which includes signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family. CD45 is a type I transmembrane protein that is present in various isoforms on differentiated hematopoietic cells (except e.g. erythrocytes) (Holmes, Immunology 7:145-55 (2006)). CD45 has been shown to be a regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain, or by activating various Src family kinases (SFK), such as Lck, required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and thus functions as a negative regulator of cytokine receptor signaling. CD45 is present on the surface of hematopoietic cells, including HSCs, leukocytes, and osteoclasts, which are of hematopoietic origin (Shivtiel et al., J Exp Med 205:2381 (2008)). Deletion mutations within CD45 in humans are associated with severe immunodeficiency. This is primarily due to the absence of CD45 on T cells, where it is typically abundant and required to modulate SFK activity during antigen responses. CD45- deficient (CD45- / -) mouse bone marrow contains normal numbers of hematopoietic cells, but the most primitive HSCs are reduced in number, and their mobilization in response to G-CSF is impaired. In part, this defect is intrinsic to the HSC; without CD45-mediated downregulation of SFK activity, integrin-mediated adhesion is high and HSCs are more likely to remain in the stem cell niche. CD45- / - HSCs are also deficient in G-CSF-stimulated mobilization and homing to the chemokine CXCL12 / SDF-1, which negatively affects cell engraftment following transplantation. These deficiencies can be restored by supplementation with SFK inhibitors, indicating that this role is usually performed by CD45. Likewise, CD45- / - recipients also show deficient engraftment and subsequent mobilization of normal HSCs, indicating a role for CD45 in the stem cell niche, as well as in the HSC (Shivtiel et al, J Exp Med 205:2381 (2008)). As CD45 is expressed, for example, on HSCs and leukocytes, it presents a target for therapies including conditioning therapies, immune reset, and treatment of diseases. Several anti-CD45 moieties are known in the art, some of which are currently in development. BC8 is a mouse hybridoma antibody commercially available from IchorBio (#ICH1155). The BC8 antibody is the basis for an anti-CD45 antibody-radioconjugate developed by Actinium Pharmaceuticals (WO2017155937, WO2019084258, WO2020159656). Other anti-CD45 antibodies and antibody-based moieties are disclosed in WO2016016442, WO2019115791 and WO2020058495, WO2017009473, WO2019129178, WO2020018580, WO2020170254 and WO2020219959. These and other anti-CD45 moieties may be used in the context of the present disclosure. Summary of the invention The present disclosure relates to humanized antibodies or antibody fragments specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the humanized antibody or antibody fragment comprises at least one of the following mutations: a) the glycine in the LCDR1 region (SEQ ID NO: 7) is replaced by alanine, b) the second asparagine in the LCDR1 region (SEQ ID NO: 7) is replaced by lysine, c) the arginine in the LCDR2 region (SEQ ID NO: 8) is replaced by leucine, or d) the phenylalanine in the LCDR2 region (SEQ ID NO: 8) is replaced by alanine. In certain embodiments, the present disclosure relates to a humanized antibodies or antibody fragments specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the humanized antibody or antibody fragment comprises at least one of the following mutations: a) the glycine in the LCDR1 region (SEQ ID NO: 7) is replaced by alanine, b) the second asparagine in the LCDR1 region (SEQ ID NO: 7) is replaced by lysine, or c) the arginine in the LCDR2 region (SEQ ID NO: 8) is replaced by leucine. The present disclosure also relates to humanized antibodies or antibody fragments specific for human CD45, wherein said antibody or antibody fragment comprises a) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9, b) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 8, and the LCDR3 region of SEQ ID NO: 9, c) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 96, and the LCDR3 region of SEQ ID NO: 9, d) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 110, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9, e) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9, f) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9, or g) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. The present disclosure also relates to aforementioned humanized antibodies or antibody fragments specific for human CD45, wherein said antibody or antibody fragment additionally comprises a mutation of the second glycine of the triple glycine motif of framework region 4 of the variable light chain to glutamine. The present disclosure also relates to humanized antibodies or antibody fragments specific for human CD45, wherein said humanized antibodies or antibody fragments comprise a) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 98, b) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 99, c) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 101, d) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 102, e) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 103, f) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104, or g) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 105. The present disclosure also relates to aforementioned humanized antibodies or antibody fragments specific for human CD45, wherein said humanized antibodies or antibody fragments comprise a mutation of a) the glycine in the LCDR1 region (SEQ ID NO: 7) is replaced by alanine, b) the second asparagine in the LCDR1 region (SEQ ID NO: 7) is replaced by lysine, and c) the arginine in the LCDR2 region (SEQ ID NO: 8) is replaced by leucine. The present disclosure also relates to humanized antibodies or antibody fragments specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104. The present disclosure also relates to aforementioned humanized antibodies or antibody fragments specific for human CD45, wherein said humanized antibody comprises a modification in the FC region, preferably wherein said Fc modification is a silencing mutation, more preferably wherein said mutation is a PA-LALA, a PG-LALA or an AEASS mutation. The present disclosure also relates to aforementioned humanized antibodies or antibody fragments specific for human CD45, wherein said humanized antibody or antibody fragment is a monoclonal antibody or antibody fragment. The present disclosure also relates to an antibody drug conjugate comprising aforementioned humanized antibodies or antibody fragments specific for human CD45and a cytotoxic drug. Prefreably, said cytotoxic moiety is a pyrrolobenzodiazepine (PBD). More preferably said pyrrolobenzodiazepine is tesirine. The present disclosure also relates to aforementioned humanized antibodies, antibody fragments and antibody drug conjugates comprising said humanized antibodies or antibody fragments for use in medicine. The present disclosure also relates to aforementioned humanized antibodies, antibody fragments and antibody drug conjugates comprising said humanized antibodies or antibody fragments for use in the treatment of a hematological cancer, such as a leukemia, myeloma or lymphoma. The present disclosure also relates to aforementioned humanized antibodies, antibody fragments and antibody drug conjugates comprising said humanized antibodies or antibody fragments for use in the treatment of an inflammatory or autoimmune disease such as multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, Crohn’s disease, Type 1 diabetes, rheumatoid arthritis or idiopathic arthritis The present disclosure also relates to nucleic acid compositions comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding aforementioned humanized antibodies and antibody fragments. The present disclosure also relates to vectors comprising said nucleic acid compositions. The present disclosure also relates to host cell comprising said vectors or nucleic acid compositions. The present disclosure also relates to pharmaceutical compositions comprising aforementioned humanized antibodies, antibody fragments or antibody drug conjugates comprising said humanized antibodies or antibody fragments, and a pharmaceutically acceptable carrier or excipient. Figure legends Figure 1 shows the alignment of five humanized variants to the original murine VH sequence of Ätti. VHO is the murine sequence and VH1-5 are the humanized variants. Key residues important for the VH / VL interface and canonical loop structure have been maintained as much as possible. Figure 2 shows the alignment of five humanized variants to the original murine VL sequence of antibody Ätti. VLO is the murine sequence and VL1-6 are the humanized variants. Key residues important for the VH / VL interface and canonical loop structure have been maintained as much as possible. Figure 3 shows complete depletion of all human CD45+ cells and LT-HSCs 3 weeks after single dose of 0.3 mg / kg with Kiebitz-Teserine compared to PBS control group, whereas BC8-Teserine treatment resulted only in partial depletion. Figure 4 shows that in both cell lines tested blocking with naked antibodies mimics shielding of the cells and is able to prevent cell viability decrease via the respective ADCs. BC08-Tesirine shows lower potency than Kiebitz-Tesirine. Panel A: MV4-11; panel B: Molm-13. Figure 5 shows that also in HSPC, blocking with naked Kiebitz antibody shields cells and is able to prevent cell viability decrease a respective ADC. shows that Jurkat CD45 knock-out cells have an IC50 for Kiebitz-Tesrine which is significantly higher than the IC50 in Jurkat wild-type cells (0.46 µg / ml vs.0.032 µg / ml). shows that antibodies Ätti, Amandine and Ballerina bind equally well to CD45 endogenously expressed on Jurkat cells. Definitions The disclosure pertains to antibodies, which specifically bind to CD45, and uses of such antibodies, in particular therapeutic uses. The term“CD45” refers to a protein also known as PTPRC, Leukocyte common antigen (L-CA) or T200. Human CD45 has the following amino acid sequence (UniProt P08575-3, defined as canonical sequence) MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFE RENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFS GSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITAN TSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNE NVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTT ICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKI IKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQN LKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRN GPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNS KALIAFLAFLIIVTSIALLVVLYKIYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLE TYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAG SNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPS MEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLL KLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMV QVEAQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQ HIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIM SYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEV DLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQVVKQKLPQKN SSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVKALRKARPGMVSTFE QYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCVNPLGAPEKLPEAKEQAEG SEPTSGTEGPEHSVNGPASPALNQGS (SEQ ID No. 1) The term “antibody” as used herein refers to a protein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, which interacts with an antigen. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FR’s arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system. The term “antibody” includes for example, monoclonal antibodies, human antibodies, humanized antibodies, camelised antibodies and chimeric antibodies. The antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., Igd , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass. Both the light and heavy chains are divided into regions of structural and functional homology. The term “antibody fragment”, as used herein, refers to one or more portions of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing spatial distribution) an antigen. Examples of binding fragments include, but are not limited to, a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., (1989) Nature 341 :544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., (1988) Science 242:423-426; and Huston et al., (1988) Proc. Natl. Acad. Sci. 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term “antibody fragment”. These antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies. Antibody fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, (2005) Nature Biotechnology 23:1126-1136). Antibody fragments can be grafted into scaffolds based on polypeptides such as Fibronectin type III (Fn3) (see U.S. Pat. No.6,703,199, which describes fibronectin polypeptide monobodies). Antibody fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1 -VH- CH1 ) which, together with complementary light chain polypeptides, form a pair of antigen- binding sites (Zapata et al., (1995) Protein Eng.8: 1057-1062; and U.S. Pat. No.5,641 ,870). The structures and locations of immunoglobulin variable domains, e.g., CDRs, may be defined using well known numbering schemes, e.g., the Kabat numbering scheme, the Chothia numbering scheme, or a combination of Kabat and Chothia (see, e.g. Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services (1991 ), eds. Kabat et al.; Lazikani et al., (1997) J. Mol. Bio. 273:927-948); Kabat et al., (1991) Sequences of Proteins of Immunological Interest, 5th edit., NIH Publication no. 91-3242 U.S. Department of Health and Human Services; Chothia et al., (1987) J. Mol. Biol. 196:901 -917; Chothia et al., (1989) Nature 342:877-883; and Al-Lazikani et al., (1997) J. Mol. Biol. 273:927-948; Annals of the New York Academy of Sciences, 764, 47-49 (1995); Nucleic Acids Research, 25, 206-211 (1997). A “human antibody” or “human antibody fragment”, as used herein, is an antibody and antibody fragment having variable regions in which both the framework and CDR regions are from sequences of human origin. Human antibodies can also be isolated from synthetic libraries or from transgenic mice (e.g. Xenomouse, OmniMouse, Harbour Mouse, ATX-Gx Mouse, Trianni Mouse) provided the respective system yield in antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such sequences. Human origin includes, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et al., (2000) J Mol Biol 296:57-86). A “humanized antibody” or “humanized antibody fragment” is defined herein as an antibody molecule, which has constant antibody regions derived from sequences of human origin and the variable antibody regions or parts thereof or only the CDRs are derived from another species. For example, a humanized antibody can be CDR-grafted, wherein the CDRs of the variable domain are from a non-human origin, while one or more frameworks of the variable domain are of human origin and the constant domain (if any) is of human origin. The term “chimeric antibody” or “chimeric antibody fragment” is defined herein as an antibody molecule, which has constant antibody regions derived from, or corresponding to, sequences found in one species and variable antibody regions derived from another species. Preferably, the constant antibody regions are derived from, or corresponding to, sequences found in humans, and the variable antibody regions (e.g. VH, VL, CDR or FR regions) are derived from sequences found in a non-human animal, e.g. a mouse, rat, rabbit or hamster. The term “isolated antibody” or “isolated antibody fragment” refers to an antibody or antibody fragment that is substantially free of other antibodies or antibody fragments having different antigenic specificities. Moreover, an isolated antibody or antibody fragment may be substantially free of other cellular material and / or chemicals. Thus, in some aspects, antibodies provided are isolated antibodies, which have been separated from antibodies with a different specificity. An isolated antibody may be a monoclonal antibody. An isolated antibody may be a recombinant monoclonal antibody. An isolated antibody that specifically binds to an epitope, isoform or variant of a target may, however, have cross-reactivity to other related antigens, e.g., from other species (e.g., species homologs). The term “recombinant antibody” or “recombinant antibody fragment”, as used herein, includes all antibodies or antibody fragment that are prepared, expressed, created or segregated by means not existing in nature. For example, antibodies isolated from a host cell transformed to express the antibody, antibodies selected and isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences or antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom. Preferably, such recombinant antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. A recombinant antibody may be a monoclonal antibody. The term "monoclonal" as used herein has the meaning typically ascribed to it in the art, namely an antibody or an antibody fragment (or its corresponding functional fragment) arising from a single clone of an antibody-producing cell, recognizing a single epitope on the antigen bound. As used herein, an antibody “binds specifically to”, “specifically binds to”, is “specific to / for” or “specifically recognizes” an antigen, such as human CD45, if such antibody is able to discriminate between such antigen and one or more reference antigen(s), since binding specificity is not an absolute, but a relative property. For example, a standard ELISA assay or standard flow cytometry assay can be carried out. The scoring may be carried out by standard color development (e.g. secondary antibody with horseradish peroxide and tetramethyl benzidine with hydrogen peroxide) or by binding of a secondary antibody labeled with PE or another dye or marker. The reaction in certain wells is scored by the optical density (OD), for example, at 450 nm or by mean or median fluorescence intensity (MFI) in flow cytometry. Typical background (=negative reaction) may be 0.1 OD; typical positive reaction may be 1 OD. Background and positive reaction MFI are highly dependent on instrument settings. The difference positive / negative can be more than 10-fold. Typically, determination of binding specificity is performed by using not a single reference antigen, but a set of about three to five unrelated antigens, such as milk powder, BSA, transferrin or the like. For flow cytometry various antigen-negative cells can be used. An antibody that specifically binds to an antigen may however have cross-reactivity to the respective orthologous antigen from other species (e.g., species homologs). In certain embodiments such cross-reactivity to an orthologous antigen is even preferred. As used herein, the term “affinity” refers to the strength of interaction between the polypeptide and its target at a single site. Within each site, the binding region of the polypeptide interacts through weak non-covalent forces with its target at numerous sites; the more interactions, the stronger the affinity. The term “epitope” includes any proteinaceous region which is specifically recognized by an antibody or antibody fragment thereof or otherwise interacts with a molecule. Generally, epitopes are of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally may have specific three-dimensional structural characteristics, as well as specific charge characteristics. As will be appreciated by one of skill in the art, practically anything to which an antibody can specifically bind could be an epitope. The term “domain” or “protein domain” refers to a region of a protein’s polypeptide chain that forms a functional unit and / or independently forms a three-dimensional structure. “Compositions” or of the present disclosure may be used for therapeutic or prophylactic applications. The present disclosure, therefore, includes a pharmaceutical composition containing an antibody or antibody fragment as disclosed herein and a pharmaceutically acceptable carrier or excipient therefore. In a related aspect, the present disclosure provides a method for treating inflammatory diseases, autoimmune diseases, hematologic malignancies and potentially other diseases. Such method contains the steps of administering to a subject in need thereof an effective amount of the pharmaceutical composition that contains an antibody or antibody fragment as described herein. The present disclosure provides therapeutic methods comprising the administration of a therapeutically effective amount of an antibody or antibody fragment as disclosed herein to a subject in need of such treatment. A “therapeutically effective amount” or “effective amount”, as used herein, refers to the amount of an anti-CD45 antibody necessary to elicit the desired biological response. In accordance with the subject disclosure, the therapeutic effective amount is the amount of an anti-CD45 antibody necessary to treat and / or prevent a disease. “Administered” or “administration” includes but is not limited to delivery of a drug by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestible solution, capsule or tablet. Preferably, the administration is by an injectable form. As used herein, “treatment”, “treat” or “treating” and the like refers to clinical intervention in an attempt to alter the natural course of a disease in the subject being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some embodiments, antibodies or antibody fragments according to the preset disclosure are used to delay development of a disease or to slow the progression of a disease. “Preventing” or “prevention” refers to a reduction in risk of acquiring or developing a disease (i.e., causing at least one of the clinical symptoms of the disease not to develop in a subject that may be exposed to a disease-causing agent, or predisposed to the disease in advance of disease onset). “Prevention” also refers to methods which aim to prevent the onset of a disease or its symptoms or which delay the onset of a disease or its symptoms. “Subject” or “species” or as used in this context refers to any mammal, including rodents, such as mouse or rat, and primates, such as cynomolgus monkey (Macaca fascicularis), Marmoset monkey (Callithrix jacchus), rhesus monkey (Macaca mulatta) or humans (Homo sapiens). Preferably, the subject is a primate, most preferably a human. The term “effector function” refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Non-limiting examples of antibody effector functions include C1 q binding and complement dependent cytotoxicity (CDC); Fc receptor binding and antibody-dependent cell-mediated cytotoxicity (ADCC) and / or antibody- dependent cellular phagocytosis (ADCP); down regulation of cell surface receptors (e.g. B cell receptor); and direct cell activation or direct cell inhibition. “Antibody-dependent cell-mediated cytotoxicity” or “ADCC” refers to a form of cytotoxicity in which antibodies bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g. NK cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes / macrophages express FcyRI, FcyRII, and FcyRIII. “Complement-dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass) of the present disclosure, which are bound to their cognate antigen. “Antibody-dependent cellular phagocytosis” or “ADCP” refers to a mechanism of elimination of antibody-coated target cells by internalization by phagocytic cells, such as macrophages or dendritic cells. As used herein, the term “antibody-drug conjugate” or “ADC” refers to an antibody or an antibody fragment that is chemically linked to a second chemical moiety, such as a therapeutic or cytotoxic agent. The term “cytotoxic drug” as use herein is art recognized and includes, but is not limited to, daunorubicin, mitoxantrone, doxorubicin, cucurbitacin, chaetocin, chaetoglobosin, chlamydocin, calicheamicin, mertansine, nemorubicin, cryptophyscin, mensacarcin, ansamitocin, mitomycin C, geldanamycin, mechercharmycin, rebeccamycin, safracin, okilactomycin, oligomycin, actinomycin, sandramycin, hypothemycin, polyketomycin, hydroxyellipticine, thiocolchicine, methotrexate, triptolide, taltobulin, lactacystin, dolastatin, auristatin, monomethyl auristatin E (MMAE), monomethyl auristatin F (MMAF), telomestatin, tubastatin A, combretastatin, maytansinoid, MMAD, MMAF, DM1, DM4, DTT, 16-GMB-APA-GA, 17- DMAP-GA, JW 55, a pyrrolobenzodiazepine, SN-38, Ro 5-3335, puwainaphycin, duocarmycin, bafilomycin, taxoid, tubulysin, ferulenol, lusiol A, fumagillin, hygrolidin, glucopiericidin, amanitin, ansatrienin, cinerubin, phallacidin, phalloidin, phytosphongosine, piericidin, poronetin, phodophyllotoxin, gramicidin A, sanguinarine, sinefungin, herboxidiene, microcolin B, microcystin, muscotoxin A, tolytoxin, tripolin A, myoseverin, mytoxin B, nocuolin A, psuedolaric acid B, pseurotin A, cy dopamine, curvulin, colchicine, aphidicolin, englerin, cordycepin, apoptolidin, epothilone A, limaquinone, isatropolone, isofistularin, quinaldopeptin, ixabepilone, aeroplysinin, arruginosin, agrochelin, or epothilone. An exemplary pyrrolobenzodiazepine is tesirine. Throughout this specification, unless the context requires otherwise, the words “comprise”, “have” and “include” and their respective variations such as “comprises”, “comprising”, “has”, “having”, “includes” and “including” will be understood to imply the inclusion of a stated element or integer or group of elements or integers but not the exclusion of any other element or integer or group of elements or integers. The terms “engineered” or “modified” as used herein includes manipulation of nucleic acids or polypeptides by synthetic means (e.g., by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques). Preferably, the antibodies or antibody fragments according to the present disclosure are engineered or modified to improve one or more properties, such as antigen binding, stability, half-life, effector function, immunogenicity, safety and the like. “Variant” as used herein refers to a polypeptide that differs from a reference polypeptide by one or more modifications for example amino acid substitutions, insertions or deletions. Variant polypeptides typically retain most of the properties of the reference polypeptide, e.g. binding to the target antigen, but introduce a novel, additional feature or property, e.g. the variant polypeptide has a higher affinity to the target antigen compared to the reference polypeptide or the variant polypeptide is a humanized version of the reference polypeptide. The term “amino acid mutation” as used herein is meant to encompass amino acid substitutions, deletions, insertions, and modifications. Any combination of substitution, deletion, insertion, and modification can be made as long as the final construct possesses the desired characteristics, e.g., reduced binding to an Fc receptor. Amino acid sequence deletions and insertions include N-and / or C-terminal deletions and insertions of amino acid residues. Particular amino acid mutations are amino acid substitutions. Amino acid substitutions include replacement by non-naturally occurring amino acids or by naturally occurring amino acid derivatives of the twenty standard amino acids. Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis and the like. It is contemplated that methods of altering the side chain group of an amino acid residue by methods other than genetic engineering, such as chemical modification, may also be useful. Various designations may be used herein to indicate the same amino acid mutation. For example, a substitution of glycine at position 237 of the antibody Fc region to alanine can be indicated as 237A, G237, G237A, or Gly237Ala. The term “EC50” as used herein, refers to the concentration of an antibody or antibody fragment, which induces a response in an assay half-way between the baseline and maximum. It therefore represents the antibody or ligand concentration at which 50% of the maximal effect is observed. The term "Ka", as used herein refers to the association rate of a particular antibody-antigen interaction The term "Kd" as used herein, refers to the dissociation rate of a particular antibody-antigen interaction. Kd values for antibodies can be determined using methods well established in the art. The term "KD" as used herein, refer to the dissociation constant of a particular antibody- antigen interaction, which is obtained from the ratio of Kd to Ka (i.e., Kd / Ka) and is expressed as a molar concentration. A preferred method for determining the Kd of an antibody is by using surface plasmon resonance, preferably using a biosensor system, such as a Biacore system, or by using biolayer interferometry with the Octet BLI instrument. The terms “inhibition” or “inhibit” or “reduction” or “reduce” or “neutralization” or “neutralize” refer to a decrease or cessation of any phenotypic characteristic (such as binding or a biological activity or function) or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. “Inhibition”, “reduction” or “neutralization” needs not to be complete as long as it is detectable using an appropriate assay. In some embodiments, by “reduce” or “inhibit” or “neutralize” is meant the ability to cause a decrease of 20% or greater. In another embodiment, by “reduce” or “inhibit” or “neutralize” is meant the ability to cause a decrease of 50% or greater. In yet another embodiment, by “reduce” or “inhibit” or “neutralize” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater. The term “antagonistic” antibody as used herein refers to an antibody or antibody fragment that interacts with an antigen and partially or fully inhibits or neutralizes a biological activity or function or any other phenotypic characteristic of a target antigen. A “wild-type” protein is a version or variant of the protein as it is found in nature. An amino acid sequence of a wildtype protein, e.g., a Fc region of a human lgG1 antibody, is the amino acid sequence of the protein as it occurs in nature. Due to allotypic differences, there can be more than one amino acid sequence for a wildtype protein. For example, there are several allotypes of naturally occurring human IGg1 heavy chain constant regions (see, e.g., Jeffries et al. (2009) mAbs 1 :1). The “Fc region” is used to define the C-terminal region of an immunoglobulin heavy chain. The Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain. Although the boundaries of the Fc region of an IgG heavy chain might vary slightly, the human IgG heavy chain Fc region is usually defined to extend from Cys226, or from Pro230, to the C-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991. Various Fc modifications are commonly used. For a review see for example Antibodies (2020) 9: 64. Silencing functions include (numbering according EU index) the LALA (L234A / L235A), the PA-LALA (L234A / L235A / P329A) and the PG-LALA (L234A / L235A / P329G) mutations, as well as the AEASS mutations (L234A / L235E / G237A / A330S / P331S). A preferred FC modification is PA-LALA. The mutation may also be a mutation which leads to a reduced binding to FcRn, thereby decreasing the in vivo half- life of the antibody. Such mutations include I253A, H310A, H435A and H435Q. Alternatively, the mutation may also a mutation which leads to an increased binding to FcRn, thereby increasing the in vivo half-life of the antibody. Such mutations include T250Q / M428L, M252Y / S254T / T256E (YTE), H433K / N434F and M252Y / S254T / T256E / H433K / N434F. Embodiments of the invention In certain embodiments, the present disclosure relates to antibodies or antibody fragments that are specific for CD45. In certain embodiments, the present disclosure relates to antibodies or antibody fragments that are specific for human CD45. In certain embodiments, the present disclosure relates to humanized antibodies or antibody fragments that are specific for CD45. In certain embodiments, the present disclosure relates to humanized antibodies or antibody fragments that are specific for human CD45. In certain embodiments, the present disclosure relates to humanized antibodies or antibody fragments that are specific for a polypeptide consisting of the amino acid sequence of SEQ ID No. 1. In certain embodiments, the present disclosure relates to humanized antibodies or antibody fragments that are specific for a polypeptide comprising the amino acid sequence of SEQ ID No. 1. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the glycine in the LCDR1 region (SEQ ID NO: 7) of said humanized antibody or antibody fragment is replaced by alanine. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the second asparagine in the LCDR1 region (SEQ ID NO: 7) of said humanized antibody or antibody fragment is replaced by lysine. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the arginine in the LCDR2 region (SEQ ID NO: 8) of said humanized antibody or antibody fragment is replaced by leucine. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the glycine in the LCDR1 region (SEQ ID NO: 7) of said humanized antibody or antibody fragment is replaced by alanine, wherein the second asparagine in the LCDR1 region (SEQ ID NO: 7) of said humanized antibody or antibody fragment is replaced by lysine, and wherein the arginine in the LCDR2 region (SEQ ID NO: 8) of said humanized antibody or antibody fragment is replaced by leucine. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein said humanized antibody or antibody fragment comprises a mutation of the second glycine of the triple glycine motif of framework region 4 of the variable light chain to glutamine. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the glycine in the LCDR1 region (SEQ ID NO: 7) of said humanized antibody or antibody fragment is replaced by alanine, wherein the second asparagine in the LCDR1 region (SEQ ID NO: 7) of said humanized antibody or antibody fragment is replaced by lysine, wherein the arginine in the LCDR2 region (SEQ ID NO: 8) of said humanized antibody or antibody fragment is replaced by leucine, and wherein said humanized antibody or antibody fragment comprises a mutation of the second glycine of the triple glycine motif of framework region 4 of the variable light chain to glutamine. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 63, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 65, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 71, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 73, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 77, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 79, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 81, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 83, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 85, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 87, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 89, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 91, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 95 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 97 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 110, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 34. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 22 and a variable light chain of SEQ ID NO: 34. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 23 and a variable light chain of SEQ ID NO: 34. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 38. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 39. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 40. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 41. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 42. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 43. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 44. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 45. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 46. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 47. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 48. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 49. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 50. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 51. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 52. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 53. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 54. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 55. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 56. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 57. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 58. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 60 and a variable light chain of SEQ ID NO: 58. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 60 and a variable light chain of SEQ ID NO: 59. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 98. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 99. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 100. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 101. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 102. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 103. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 105. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment comprises 6 six CDRs of one of the antibodies disclosed in Table 14. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment comprises 6 six CDRs as defined by Kabat of one of the antibodies disclosed in Table 14. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment comprises 6 six CDRs as defined by IMGT of one of the antibodies disclosed in Table 14. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment comprises a variable heavy chain and a variable light chain of one of the antibodies disclosed in Table 14. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment is a monoclonal antibody or antibody fragment. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment is a recombinant antibody or antibody fragment. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment is of the IgG isotype. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment is of the lgG1 class. In certain embodiments, the present disclosure relates to a humanized antibody or antibody fragment, wherein said humanized antibody or antibody fragment is of the human lgG1 class. In certain embodiments, the antigen-binding regions of the antibodies disclosed herein are used as scFv’s. Such antibodies are particular useful for certain purposes, for example the use in CARs or on LNPs. Not all antigen-binding regions are equally suited for use as scFv’s, primarily because of low expression levels. Antibodies that can be well expressed as scFv’s include the antibodies Jelly (VH2 / VL5.22), Lady Rosetta (VH2 / VL5.38), Levinata (VH2 / VL5.39), and Osira (VH2 / VL5.40). Therefore in certain embodiments, the present disclosure relates to a scFv comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising a LCDR1 region of SEQ ID NO: 67, a LCDR2 region of SEQ ID NO: 94 and a LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a scFv comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising a LCDR1 region of SEQ ID NO: 120, a LCDR2 region of SEQ ID NO: 94 and a LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to a scFv comprising a variable heavy chain comprising a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 58. In certain embodiments, the present disclosure relates to a scFv comprising a variable heavy chain comprising a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 121. In certain embodiments, the present disclosure relates to a scFv comprising a variable heavy chain comprising a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 122. In certain embodiments, the present disclosure relates to a scFv comprising a variable heavy chain comprising a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 123. The isolated antibody or antibody fragment according to the present disclosure may or may not be fused to one or more other amino acid residues, polypeptides or moieties. Such a fusion protein may be prepared in any suitable manner, including genetically or chemically approaches. Said linked moieties may contain secretory or leader sequences, sequences that aid detection, expression, separation or purification, or sequences that confer to increased protein stability, for example, during recombinant production. Non-limiting examples of potential moieties include beta-galactosidase, glutathione-S-transferase, luciferase, a T7 polymerase fragment, a secretion signal peptide, an antibody or antibody fragment, a toxin, a cytokine, a chemokine, a reporter enzyme, a moiety being capable of binding a metal ion like a poly-histidine tag, a tag suitable for detection and / or purification, a homo- or hetero-association domain, a moiety which increases solubility of a protein, or a moiety which comprises an enzymatic cleavage site. Accordingly, the isolated antibody or antibody fragment according to the present disclosure may optionally contain one or more moieties for binding to other targets or target proteins of interest. It should be clear that such further moieties may or may not provide further functionality to the antibody and may or may not modify the properties of the In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45 as disclosed herein, and (b) a cytotoxic drug. In certain embodiments said cytotoxic drug is selected from daunorubicin, mitoxantrone, doxorubicin, cucurbitacin, chaetocin, chaetoglobosin, chlamydocin, calicheamicin, mertansine, nemorubicin, cryptophyscin, mensacarcin, ansamitocin, mitomycin C, geldanamycin, mechercharmycin, rebeccamycin, safracin, okilactomycin, oligomycin, actinomycin, sandramycin, hypothemycin, polyketomycin, hydroxyellipticine, thiocolchicine, methotrexate, triptolide, taltobulin, lactacystin, dolastatin, auristatin, monomethyl auristatin E (MMAE), monomethyl auristatin F (MMAF), telomestatin, tubastatin A, combretastatin, maytansinoid, MMAD, MMAF, DM1, DM4, DTT, 16-GMB-APA-GA, 17- DMAP-GA, JW 55, a pyrrolobenzodiazepine, SN-38, Ro 5-3335, puwainaphycin, duocarmycin, bafilomycin, taxoid, tubulysin, ferulenol, lusiol A, fumagillin, hygrolidin, glucopiericidin, amanitin, ansatrienin, cinerubin, phallacidin, phalloidin, phytosphongosine, piericidin, poronetin, phodophyllotoxin, gramicidin A, sanguinarine, sinefungin, herboxidiene, microcolin B, microcystin, muscotoxin A, tolytoxin, tripolin A, myoseverin, mytoxin B, nocuolin A, psuedolaric acid B, pseurotin A, cy dopamine, curvulin, colchicine, aphidicolin, englerin, cordycepin, apoptolidin, epothilone A, limaquinone, isatropolone, isofistularin, quinaldopeptin, ixabepilone, aeroplysinin, arruginosin, agrochelin and epothilone. In certain embodiments said cytotoxic drug is a pyrrolobenzodiazepine. In other embodiments said pyrrolobenzodiazepine is tesirine. antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45 as disclosed herein, and (b) a cytotoxic drug In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug , wherein said humanized antibody or antibody fragment specific for human CD45 comprises i. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 63, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; ii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 65, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; iii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; iv. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; v. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 71, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; vi. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 73, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; vii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; viii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 77, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; ix. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 79, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; x. avariable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 81, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xi. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 83, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 85, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xiii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 87, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xiv. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 89, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xv. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 91, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xvi. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9; xvii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; xviii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 95 and the LCDR3 region of SEQ ID NO: 9; xix. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; xx. variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 97 and the LCDR3 region of SEQ ID NO: 9; xxi. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; xxii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; xxiii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; xxiv. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; xxv. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xxvi. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; xxvii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; xxviii. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 110, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; xxix. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; xxx. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9; or xxxi. a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. In preferred embodiments, said cytotoxic drug is a pyrrolobenzodiazepine. In other preferred embodiments, said pyrrolobenzodiazepine is tesirine. In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug, wherein said humanized antibody or antibody fragment specific for human CD45 comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug, wherein said humanized antibody or antibody fragment specific for human CD45 comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9, and wherein said cytotoxic drug is a pyrrolobenzodiazepine. In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug, wherein said humanized antibody or antibody fragment specific for human CD45 comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9, and wherein said cytotoxic drug is tesirine. In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug, wherein said humanized antibody or antibody fragment specific for human CD45 comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104. In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug, wherein said humanized antibody or antibody fragment specific for human CD45 comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104, and wherein said cytotoxic drug is a pyrrolobenzodiazepine. In certain embodiments, the present disclosure relates to an antibody-drug conjugate comprising (a) a humanized antibody or antibody fragment specific for human CD45, and (b) a cytotoxic drug, wherein said humanized antibody or antibody fragment specific for human CD45 comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104, and wherein said cytotoxic drug is tesirine. Nucleic acids In an embodiment, the present disclosure relates to a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an isolated antibody or antibody fragment specific for human CD45 of the present disclosure. In an embodiment, the present disclosure relates to a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an isolated antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 63, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; b) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 65, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; c) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; d) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; e) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 71, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; f) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 73, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; g) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; h) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 77, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; i) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 79, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; j) avariable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 81, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; k) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 83, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; l) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 85, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; m) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 87, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; n) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 89, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; o) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 91, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; p) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9; q) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; r) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 95 and the LCDR3 region of SEQ ID NO: 9; s) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; t) variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 97 and the LCDR3 region of SEQ ID NO: 9; u) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; v) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; w) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; x) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; y) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; z) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; aa) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; bb) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 110, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; cc) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; dd) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9; or ee) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an isolated antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 34; b) a variable heavy chain of SEQ ID NO: 22 and a variable light chain of SEQ ID NO: 34; c) a variable heavy chain of SEQ ID NO: 23 and a variable light chain of SEQ ID NO: 34; d) variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 38; e) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 39; f) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 40; g) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 41; h) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 42; i) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 43; j) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 44; k) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 45; l) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 46; m) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 47; n) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 48; o) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 49; p) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 50; q) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 51; r) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 52; s) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 53; t) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 54; u) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 55; v) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 56; w) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 57; x) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 58; y) a variable heavy chain of SEQ ID NO: 60 and a variable light chain of SEQ ID NO: 58; z) a variable heavy chain of SEQ ID NO: 60 and a variable light chain of SEQ ID NO: 59; aa) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 98; bb) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 99; cc) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 100; dd) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 101; ee) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 102; ff) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 103; gg) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104; or hh) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 105. In an embodiment, the present disclosure relates to a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an isolated antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises 6 six CDRs as defined by Kabat of one of the antibodies disclosed in Table 14. In an embodiment, the present disclosure relates to a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an isolated antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises 6 six CDRs as defined by IMGT of one of the antibodies disclosed in Table 14. In an embodiment, the present disclosure relates to a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an isolated antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain and a variable light chain of one of the antibodies disclosed in Table 13. In an embodiment, said nucleic acid composition and / or said nucleic acid sequence and / or said plurality of nucleic acid sequences are isolated. Vectors In an embodiment, the present disclosure provides a vector composition comprising a vector or a plurality of vectors comprising a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding humanized antibody or antibody fragment specific for human CD45 according to the present disclosure. In an embodiment, the present disclosure provides a vector composition comprising a vector or a plurality of vectors comprising a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding any one of the humanized antibody or antibody fragment specific for human CD45disclosed in Table 14. Host cells In an embodiment, the present disclosure provides a host cell comprising a vector composition comprising a vector or a plurality of vectors comprising a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding a humanized antibody or antibody fragment specific for human CD45 according to the present disclosure. In an embodiment, the present disclosure refers to a host cell comprising a vector composition comprising a vector or a plurality of vectors comprising a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding any one of the humanized antibody or antibody fragment specific for human CD45 disclosed in Table 14. In an embodiment, the host cell according to the present disclosure is able to express the humanized antibody or antibody fragment specific for human CD45 encoded by the vector composition or the nucleic acid composition. In a further embodiment, the host cell is an isolated host cell. In a further embodiment, said host cell is a mammalian cell. In an embodiment, said mammalian cell is a human cell. In another embodiment, said mammalian cell is a CHO cell. In an embodiment, said cell is a HEK cell. In another embodiment, said cell is a PERC.6 cell. In an embodiment, said cell is a HKB11 cell. The skilled artisan will realize that the nucleic acid sequence or the plurality of nucleic acid sequences encoding the heavy and / or light chain of an antibody or antibody fragment of the present disclosure can be cloned into different vectors or into the same vector. The vectors can be introduced into the appropriate host cells such as prokaryotic (e.g., bacterial) or eukaryotic (e.g., yeast or mammalian) cells by methods well known in the art (see e.g., “Current Protocol in Molecular Biology”, Ausubel et al. (eds.), Greene Publishing Assoc and John Wiley Interscience, New York, 1989 and 1992). Numerous cloning vectors are known to those of skill in the art, and the selection of an appropriate cloning vector is a matter of choice. The gene can be placed under the control of a promoter, ribosome binding site (for bacterial expression) and, optionally, an operator (collectively referred to herein as “control” elements), so that the nucleic acid sequence encoding the desired protein is transcribed into RNA in the host cell transformed by a vector containing this expression construction. The coding sequence may or may not contain a signal peptide or leader sequence. Upon expression in host cells, the antibodies or antibody fragments of the present disclosure are obtained. These steps can be achieved in different ways, as will be known by the person skilled in the art. In general, such steps typically include transforming or transfecting a suitable host cell with a nucleic acid composition or vector composition or an infectious particle, which encodes the antibody, or antibody fragments. Further, such steps typically include culturing said host cells under conditions suitable for the proliferation (multiplication, growth) of said host cells and a culturing step under conditions suitable for the production (expression, synthesis) of the encoded antibody or antibody fragment. The culturing of host cells under conditions suitable for proliferation or expression is typically accomplished in the presence of media comprising components suitable for cell growth or induction of expression. In particular, embodiments, the methods for the production of the antibodies or antibody fragments of the present disclosure further comprise the step of isolating and purifying the produced antibody or antibody fragment from the host cells or medium. If the expression system secretes the protein into growth media, the protein can be purified directly from the media. If the protein is not secreted, it is isolated from cell lysates or recovered from the cell membrane fraction. The selection of the appropriate growth conditions and recovery methods are within the skill of the art. The antibody or antibody fragment of the present disclosure can then be purified by a number of techniques as known to the person skilled in the art. In an embodiment, the present disclosure refers to a method of producing a humanized antibody or antibody fragment specific for human CD45 of any of the antibodies disclosed in Table 14. In an embodiment, a method of producing an isolated antibody or antibody fragment according to the present disclosure is provided, wherein the method comprises culturing a host cell comprising a vector composition comprising a vector or a plurality of vectors comprising a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an antibody or antibody fragment according to the present disclosure, under conditions suitable for expression of the antibody or antibody fragment, and isolating the antibody or antibody fragment from the host cell or host cell culture medium. An antibody or antibody fragment isolated as described herein may be purified techniques know in the art, such as high performance liquid chromatography (HPLC), ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like. The conditions used to purify a particular antibody or antibody fragment will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art. For affinity chromatography purification an antibody, ligand, receptor or antigen can be used to which the antibody or antibody fragment binds. For example, for affinity chromatography purification of antibody or antibody fragment according to the present disclosure, a matrix with protein A or protein G may be used. The purity of an antibody or antibody fragment can be determined by any of a variety of well-known analytical methods including gel electrophoresis, high-pressure liquid chromatography, and the like. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for human CD45 disclosed in Table 14. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for a polypeptide encoded by the amino acid sequence of SEQ ID NO: 1. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for a polypeptide comprising the amino acid sequence of SEQ ID NO: 1. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment cross-competes with antibody Ätti for binding to CD45. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9 for binding to CD45. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to the same epitope on CD45 as antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to the same epitope on CD45 as an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment retains the binding specificity of antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment retains the binding specificity of an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to CD45 with about the same affinity as antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to CD45 with about the same affinity as an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to CD45 with a higher affinity than antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to CD45 with a higher affinity than an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment binds to CD45 with an at least two-fold higher affinity than an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, and wherein the humanized antibody or antibody fragment comprises at least one of the following mutations: a) the first asparagine in the LCDR1 region (SEQ ID NO: 7) is replaced by arginine, or b) the arginine in the LCDR2 region (SEQ ID NO: 8) is replaced by leucine. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment has a lower number of critical deamidation sequence motifs than antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment has a lower number of critical deamidation sequence motifs than an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment has a lower number of critical sequence motifs for T cell epitopes than antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment has a lower number of critical sequence motifs for T cell epitopes than an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. Biological function In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment is functionally equivalent to antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment is functionally equivalent to an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In an embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment inhibits the biological function of CD45 to at least the same degree as antibody Ätti. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment inhibits the biological function of CD45 to at least to the same degree as an antibody or antibody fragment comprising a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9. In another embodiment, the present disclosure relates to a humanized antibody or antibody fragment specific for CD45 as disclosed herein, wherein said antibody or antibody fragment is coupled to a toxin and thereby inhibits proliferation of CD45-positive cells. Effector function The Fc region of an immunoglobulin generally confers to the favorable pharmacokinetic properties of antibodies, such as prolonged half-life in serum and to the ability to induce effector function via binding to Fc receptors expressed on cells. On the other hand, binding to Fc receptors might also results in an undesirable activation of certain cell surface receptors leading to unwanted cytokine release and severe side effects upon systemic administration. Accordingly, for certain therapeutic situations, it is desirable to reduce or abolish the normal binding of the wild-type Fc region of an antibody, such as of an wild-type IgG Fc region to one or more or all of Fc receptors and / or binding to a complement component, such as C1q in order to reduce or abolish the ability of the antibody to induce effector function. For instance, it may be desirable to reduce or abolish the binding of the Fc region of an antibody to one or more or all of the Fcy receptors, such as: FcyRI, FcyRIla, FcyRIIb, FcyRIIIa. Effector function can include, but is not limited to, one or more of the following: complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen- presenting cells, binding to NK cells, binding to macrophages, binding to monocytes, binding to polymorphonuclear cells, direct signaling inducing apoptosis, crosslinking of target-bound antibodies, dendritic cell maturation, or T cell priming. A reduced or abolished binding of an Fc region to an Fc receptor and / or to C1q is typically achieved by mutating a wild-type Fc region, such as of an lgG1 Fc region, more particular a human lgG1 Fc region, resulting in a variant or engineered Fc region of said wild-type Fc region, e.g., a variant human lgG1 Fc region. Substitutions that result in reduced binding can be useful. For reducing or abolishing the binding properties of an Fc region to an Fc receptor, non-conservative amino acid substitutions, i.e., replacing one amino acid with another amino acid having different structural and / or chemical properties, are preferred. Accordingly, in an embodiment, the isolated antibody or antibody fragment specific for human CD45 according to the present disclosure comprises a variant Fc region having a reduced or abolished binding to an Fc receptor and / or to C1q when compared to the wild-type Fc region. In one such embodiment, the isolated antibody or antibody fragment according to the present disclosure comprises a variant Fc region that reduces or abolishes the ability of the antibody to induce effector function. In a further embodiment, the isolated antibody or antibody fragment according to the present disclosure does not substantially induce effector function. In certain embodiments, the effector function is one or more selected from the group consisting of CDC, ADCC and ADCP. In an embodiment, the effector function is ADCC. In an embodiment, the effector function is CDC. In an embodiment, the effector function is ADCP. In an embodiment, the isolated antibody or antibody fragment according to the present disclosure does not substantially induce ADCC and / or CDC and / or ADCP. In an embodiment, the isolated antibody or antibody fragment according to the present disclosure does not induce ADCC or ADCP in vitro. In an embodiment, the variant Fc region of the isolated antibody or antibody fragment according to the present disclosure comprises one or more amino acid substitutions that reduce or abolish the binding of the variant Fc region to one or more Fc receptors and / or to C1 q when compared to the wild-type Fc region. In an embodiment, the variant Fc region of the isolated antibody or antibody fragment according to the present disclosure comprises one or more amino acid substitutions that reduce or abolish the ability of the antibody to induce effector function when compared to the wild-type Fc region. In a particular embodiment, the one or more amino acid substitutions may reduce the binding affinity of the variant Fc region for one or more Fc receptors and / or to C1q by at least 2-fold, at least 5-fold, at least 10-fold, at least 20-fold or even at least 50-fold when compared to the wild-type Fc region. In alternative embodiments, the one or more amino acid substitutions may reduce the ability of the isolated antibody or antibody fragment according to the present disclosure to induce effector function by at least 2-fold, at least 5-fold, at least 10- fold, at least 20-fold or even at least 50-fold when compared to the wild-type Fc region. In an embodiment, the variant Fc region of the isolated antibody or antibody fragment according to the present disclosure does not substantially bind to one or more Fc receptors and / or C1q. In an embodiment, the variant Fc region of the antibody according to the present disclosure does substantially abolish the ability of said antibody to induce effector function. In an embodiment, the antibody or antibody fragment according to the present disclosure does not substantially induce effector function. In an embodiment, said effect function is ADCC and / or ADCP and / or CDC. In an embodiment, the antibody or antibody fragment according to the present disclosure does not substantially induce effector function meaning that the level of induced effector function is not significantly above the background as measured in the absence of said antibody. In an embodiment, the Fc receptor is a human Fc receptor. In an embodiment, the Fc receptor is an Fcy receptor. In an embodiment, the Fc receptor is a human FcyRIIIa, FcyRI, FcyRIla and / or FcyRIlb. In an embodiment, the isolated antibody or antibody fragment according to the present disclosure comprises a variant human lgG1 Fc region, which comprises one or more amino acid substitutions compared to the wild-type human lgG1 Fc region. In an embodiment, that one or more amino acid substitutions reduce or abolish the binding of the variant Fc region to an Fc receptor and / or to C1q and / or reduces the ability of said antibody to induce effector function when compared to the wild-type Fc region. Various Fc modifications are commonly used. For a review see for example Antibodies (2020) 9: 64. Silencing functions include (numbering according EU index) the LALA (L234A / L235A), the PA-LALA (L234A / L235A / P329A) and the PG-LALA (L234A / L235A / P329G) mutations, as well as the AEASS mutations (L234A / L235E / G237A / A330S / P331S). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies have a silenced Fc region. In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies or antibody fragments are in the AEASS format. In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region in which at least the following modifications are present: L234A, L235E, G237A, A330S, P331S (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region in which the following modifications are present: L234A, L235E, G237A, A330S, P331S (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies or antibody fragments are in the PA-LALA format. In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region in which at least the following modifications are present: L234A, L235A, P329A (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region in which the following modifications are present: L234A, L235A, P329A (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies or antibody fragments are in the PG-LALA format. In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region in which at least the following modifications are present: L234A, L235A, P329G (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region in which the following modifications are present: L234A, L235A, P329G (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies or antibody fragments have mutations that leads to a reduced binding to FcRn, thereby decreasing the in vivo half-life of the antibody. In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region with a I253A mutation (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region with a H310A mutation (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region with a H435A mutation (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a Fc region with a H435Q mutation (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies or antibody fragments have mutations that leads to a increased binding to FcRn, thereby increasing the in vivo half-life of the antibody. In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a T250Q / M428L mutation in the Fc region (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a M252Y / S254T / T256E (YTE) mutation in the Fc region (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a H433K / N434F mutation in the Fc region (numbering according EU index). In certain embodiments, the present disclosure relates to humanized antibodies that are specific for CD45, wherein said humanized antibodies comprise a M252Y / S254T / T256E / H433K / N434F mutation in the Fc region (numbering according EU index). In certain embodiments, the present disclosure relates to a humanized antibody, wherein said humanized antibody comprises a) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 63, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; b) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 65, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; c) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; d) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; e) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 71, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; f) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 73, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; g) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; h) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 77, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; i) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 79, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; j) avariable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 81, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; k) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 83, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; l) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 85, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; m) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 87, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; n) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 89, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; o) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 91, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; p) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9; q) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; r) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 95 and the LCDR3 region of SEQ ID NO: 9; s) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; t) variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 97 and the LCDR3 region of SEQ ID NO: 9; u) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; v) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 67, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; w) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 61 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 69, the LCDR2 region of SEQ ID NO: 94 and the LCDR3 region of SEQ ID NO: 9; x) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; y) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; z) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9; aa) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; bb) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 110, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; cc) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9; dd) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9; or ee) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9. wherein the Fc region of said humanized antibodies comprises the modifications L234A, L235A and P329A (numbering according EU index). Therapeutic methods The antibodies and antibody fragments of the present disclosure, or pharmaceutical compositions incorporating the same, can be used for the treatment of various conditions. For example, such antibodies can be used in ablation of endogenous hematopoietic stem and progenitor cells (HSPCs) in a subject in need thereof. Ablation of endogenous HSPCs is an initial step in stem cell replacement therapy. Stem cell replacement therapy generally involves reducing or eliminating endogenous HSPCs, which are defective in some respect, and replacing them with replacement HSPCs. The replacement HSPCs can be autologous, allogenic or xenogenic. Endogenous HSPCs may be defective as a result of hereditary mutation impairing function or expression (e.g., sickle cell anemia or thalassemia), as a result of a hematologic cancer, or as a result of damage from chemotherapy used in treating a cancer. Endogenous HSPCs may also be replaced in conjunction with an organ transplant because the endogenous HSPCs would result in immune attack of the transplant. Antibodies against CD45 can also be used in treatment of cancers expressing CD45. Such cancers include hematological cancer, such as a leukemia, myeloma or lymphoma. Antibodies against CD45 can also be used in treatment of an inflammatory or autoimmune disease such as multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, Crohn’s disease, Type 1 diabetes, rheumatoid arthritis or idiopathic arthritis. In certain embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in medicine. In other embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of cancer. In other embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of a hematological cancer. In other embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of leukemia, myeloma or lymphoma. In other embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of an inflammatory or autoimmune disease. In other embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, Crohn’s disease, Type 1 diabetes, rheumatoid arthritis or idiopathic arthritis. In certain embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of a disease associated with the undesired presence of CD45. In certain embodiments, the present disclosure relates to the use of the humanized antibodies or antibody fragments of the present disclosure for use in the treatment of a disease associated with the undesired presence of CD45-positive cells. In an embodiment, the present disclosure provides a method for the treatment of a disease. In an embodiment, the present disclosure provides a method for the treatment of a disease comprising administering to a patient an antibody or antibody fragment of the present disclosure. In an embodiment, the present disclosure provides a method for the treatment of a disease comprising administering to a subject in need there of an antibody or antibody fragment of the present disclosure. In an embodiment, the present disclosure provides a method for the prevention of a disease. In an embodiment, the present disclosure provides a method for the prevention of a disease comprising administering to a subject an antibody or antibody fragment of the present disclosure. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment according to the present disclosure for the treatment of a disease. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment according to the present disclosure for use in the treatment of a disease. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment according to the present disclosure for use in the treatment of a disease in a subject in need thereof. In an embodiment, the present disclosure provides the use of an isolated antibody or antibody fragment according to the present disclosure for the manufacture of a medicament. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment according to the present disclosure for use as a medicament. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment according to the present disclosure for use in medicine. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment according to the present disclosure for use as a medicament for the treatment of a subject in need thereof. In an embodiment, the present disclosure provides an isolated antibody or antibody fragment specific for human CD45 according to the present disclosure for use in a method of treating a subject having a disease comprising administering to the subject a therapeutically effective amount of an antibody or antibody fragment according to the present disclosure. In an embodiment, the method further comprises administering to the subject a therapeutically effective amount of at least one additional therapeutic agent. The subject in need of treatment is typically a mammal, more specifically a human. For use in therapeutic methods, an isolated antibody or antibody fragment according to the present disclosure would be formulated, dosed, and administered in a way consistent with good medical practice. Pharmaceutical compositions In an embodiment, the present disclosure provides a pharmaceutical composition comprising an isolated antibody or antibody fragment according to the present disclosure and a pharmaceutically acceptable carrier or excipient. Antibodies are administered in an effective regime meaning a dosage, route of administration and frequency of administration that achieves the intended purpose, such as reduction of endogenous HSPCs, tissue resident or circulating immune cells or of cancer cells expressing CD45. In some instances, efficacy can be observed in an individual patient relative to historical controls or past experience in the same patient. In other instances, efficacy can be demonstrated in a preclinical or clinical trial in a population of treated patients relative to a control population of untreated patients. The pharmaceutical compositions may further comprise at least one other pharmaceutically active compound. The pharmaceutical composition according to the present disclosure can be used in the diagnosis, prevention and / or treatment of diseases associated with the undesired presence of CD45, in particular human CD45. The pharmaceutical composition according to the present disclosure can be used in the diagnosis, prevention and / or treatment of diseases associated with the undesired presence of CD45-positive cells, in particular CD45-positive human cells. In particular, the present disclosure provides a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure that is suitable for prophylactic, therapeutic and / or diagnostic use in a mammal, more particular in a human. In general, an antibody or antibody fragment according to the present disclosure may be formulated as a pharmaceutical composition comprising at least one antibody or antibody fragment according to the present disclosure and at least one pharmaceutically acceptable carrier or excipient, and optionally one or more further pharmaceutically active compounds. Such a formulation may be suitable for oral, parenteral, topical administration or for administration by inhalation. Accordingly, a pharmaceutical composition comprising at least one antibody or antibody fragment according to the present disclosure may be administered parenterally, such as intravenously, or intramuscularly, or subcutaneously. Alternatively, an antibody of the invention may be administered via a non-parenteral route, such as per-orally or topically. In a preferred embodiment, a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure is administered intravenously or subcutaneously. In particular, an antibody or antibody fragment according to the present disclosure may be used in combination with one or more pharmaceutically active compounds that are or can be used for the prevention and / or treatment of the diseases in which a target antigen of interest is involved, as a result of which a synergistic effect may or may not be obtained. Examples of such compounds, as well as routes, methods and pharmaceutical formulations or compositions for administering them will be clear to the clinician. In an embodiment, the present disclosure provides a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure for use in the prevention and / or treatment of a disease associated with the undesired presence of CD45, in particular human CD45. In an embodiment, the present disclosure provides a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure for use in the prevention and / or treatment of a disease associated with the undesired presence of CD45- positive cells, in particular CD45-positive human cells. In an embodiment, the present disclosure provides a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure for the use as a medicament. In an embodiment, the present disclosure provides a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure for use in the prevention and / or treatment of an autoimmune disease and / or inflammatory disease and / or cancer. In an embodiment, the present disclosure provides a method for the treatment of an autoimmune disease and / or inflammatory disease and / or cancer in a subject in need thereof using a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure. Further provided is a method of producing an antibody or antibody fragment according to the present disclosure in a form suitable for administration in vivo, the method comprising (a) obtaining an antibody or antibody fragment by a method according to the present disclosure, and (b) formulating said antibody or antibody fragment with at least one pharmaceutically acceptable carrier or excipient, whereby a preparation of antibody or antibody fragment is formulated for administration in vivo. Pharmaceutical compositions according to the present disclosure comprise a therapeutically effective amount of one or more antibodies or antibody fragments according to the present disclosure dissolved in a pharmaceutically acceptable carrier or excipient. Diagnostic use In an embodiment, the present disclosure provides the use of an isolated antibody or antibody fragment specific for human CD45 according to the present disclosure for the diagnosis of a disease. In an embodiment, the present disclosure provides the use of an antibody or antibody fragment according to the present disclosure for the detection of CD45, in particular human CD45. In an embodiment, the present disclosure provides a method for detecting CD145 in a subject or a sample, comprising the step of contacting said subject or sample with an isolated antibody or antibody fragment specific for human CD45 of the present disclosure. In an embodiment, the present disclosure provides a method for diagnosing a disease in a subject, comprising the step of contacting said subject or sample with an isolated antibody or antibody fragment according to the present disclosure. The antibodies may also be used to determine CD45 expression levels in cells from patients. The CD45 expressions levels may serve as therapeutic biomarkers, for example for patient stratification. Examples Example 1: Anti-CD45 antibodies of the present invention Antibody Ätti is a mouse anti-CD45 antibody. The sequence of the variable chains and the CDRs of antibody Ätti are shown in the following table: Table 1: Ätti SEQ ID Comment Sequence No. 2 VH EVQLVESGGDLVKPGGSLKLSCAASGFAFSNYDMSWVRQTPEKRLE WVAYISSGGVSTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAM YYCARRYDVWWYFDVWGAGTTVTVSS 3 VL DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQ SPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG SHVPMYTFGGGTKLEIK 4 HCDR1 (Kabat) NYDMS 5 HCDR2 (Kabat) YISSGGVSTYYPDTVKG 6 HCDR3 (Kabat) RYDVWWYFDV 7 LCDR1 (Kabat) RSSQSIVHSNGNTYLE 8 LCDR2(Kabat) KVSNRFS 9 LCDR3 (Kabat) FQGSHVPMYT 10 HCDR1 (IMGT) GFAFSNYD 11 HCDR2 (IMGT) ISSGGVST 12 HCDR3 (IMGT) ARRYDVWWYFDV 13 LCDR1 (IMGT) QSIVHSNGNTY 14 LCDR2 (IMGT) KVS 9 LCDR3 (IMGT) FQGSHVPMYT By a sophisticated approach, the inventors of the present application succeeded to humanize antibody Ätti, while at the same time unwanted post-translational modification and fragmentation sites were removed. Surprisingly the antibodies generated also did not compromise on the affinity and the activity of the antibodies. This was achieved by a stepwise approach as further detailed in the following examples. Example 2: Humanization of murine antibody Ätti The humanization process relied on a combination of CDR-grafting technologies coupled with the latest research on antibody structure and up-date database of mature human lgG sequences. A number of human framework sequences were identified that were used as “acceptor” frameworks for the target CDR sequences. All acceptor sequences come from mature human IgG. As a result, the humanized sequences are expected not to be immunogenic and retain the canonical structure of the CDR loops. Example 2.1: Design of humanized variants of the variable heavy chain The closest human germline gene V-region that was identified in Homo sapiens was IGHV3-23: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVIYSGGSSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK (SEQ ID NO.15). Databases of human lgG sequences were searched for comparison to the murine VH domain using BLAST search algorithms, and candidate human variable domains were selected from the top 200 BLAST results. These were reduced to four candidates based on a combination of framework homology, maintaining key framework residues and canonical loop structure. The four acceptor frameworks are: >QDF60926 EVQLVESGGGLVQPGGSLRLSCAASGFTLSNYDMNWVRQAPGKRLEWVSYISSSGSTTYYVDSVKG RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGHNNWFLYFDSWGQGTLVTVSS (SEQ ID NO.16) >ABF83355 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYYADSVKGRF TISRDNAKNSLYLQMNSLRAEDTAVYYCARDGSWYFDLWGRGTLVTVSS (SEQ ID NO.17) >QAV55037 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEMSWVRQAPGKGLEWVSYISSSANTIYYADSVKGR FTISRDNAKKSLFLQMNSLRAEDTAVYYCARVVLGYWYFDLWGRGTLVTVSS (SEQ ID NO.18) >AMK70661 EVQLVESGGDLVQPGGSLRLSCAASGFSFSSYSMNWVRQAPEKGLEWVSYISSSSRTIYYAD SVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCARGNGDERAVYYYYGMDVWGQGTTVT VSS (SEQ ID NO.19) As a 5th acceptor sequence, the closest human germline IGHV3-23 (SEQ ID NO. 15) was selected. With the CDRs of the murine VH of Ätti grafted into aforementioned acceptor frameworks, the following humanized variants were selected and synthesized: >VH1 EVQLVESGGGLVQPGGSLRLSCAASGFAFSNYDMSWVRQAPGKRLEWVSYISSGGVSTYYP DTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRYDVWWYFDVWGQGTLVTVSS (SEQ ID NO.20) >VH2 QVQLVESGGGLVKPGGSLRLSCAASGFAFSNYDMSWIRQAPGKGLEWVSYISSGGVSTYYP DTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRYDVWWYFDVWGRGTLVTVSS (SEQ ID NO.21) >VH3* EVQLVESGGGLVQPGGSLRLSCAASGFAFSNYDMSWVRQAPGKGLEWVSYISSGGVSTYYP DTVKGRFTISRDNAKKSLFLQMNSLRAEDTAVYYCARRYDVWWYFDVWGAGTLVTVSS (SEQ ID NO.22) >VH4* EVQLVESGGDLVQPGGSLRLSCAASGFAFSNYDMSWVRQAPEKGLEWVSYISSGGVSTYYP DTVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCARRYDVWWYFDVWGAGTTVTVSS (SEQ ID NO.23) >VH5* EVQLLESGGGLVQPGGSLRLSCAASGFAFSNYDMSWVRQAPEKGLEWVAYISSGGVSTYYP DTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRYDVWWYFDVWGAGTTVTVSS (SEQ ID NO.24) An alignment of the humanized variants to the original murine Ätti sequence is shown in Figure 1. The homology of the humanized variants to original murine VH sequence is shown in the following table. Table 2: Identical amino acids Consensus amino acids VH1 89.1% 94.1% VH2 87.4% 93.3% VH3 87.4% 93.3% VH4 91.6% 95.8% VH5 90.8% 95.8% Example 2.2: Design of humanized variants of the variable light chain The closest human germline gene V-region that was identified in Homo sapiens was IGKV2-30: DVVMTQSPLSLPVTLGQPASISCRSSQSLVHSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSG SGSGTDFTLKISRVEAEDVGVYYCMQGTHWP (SEQ ID NO.25) Databases of human lgK sequences were searched for comparison to the murine VL domain using BLAST search algorithms, and candidate human variable domains were selected from the top 200 BLAST results. These were reduced to four candidates based on a combination of framework homology, maintaining key framework residues and canonical loop structure. The four acceptor frameworks are: >QEP26792 DIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSG SGAGTDFTLKISRVEAEDVGVYYCMQATHFPPYTFGQGTKLEIK (SEQ ID NO.26) >BAH04700 EIVLTQSPLSLPVTLGQPASISCRPSQSLVHSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFS GSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPWTFGQGTKVEIK (SEQ ID NO.27) >ABA26062 DIVMTQTPLSLPVTLGQPASISCRSSQSLLYSDGNTYLNWFHQRPGQSPRRLIYRVSNRDSGIPDRFSG SGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTTFGQGTRLEIK (SEQ ID NO.28) >BAH04694 DVVMTQSPLSLPVTLGQPASISCRSSQSLVHTDGNTYLNWFLQRPGQSPRRLIYKVSDRDSGVPDRFS GSGSGTDFTLKISRVEAEDVGVYYCMQNTHWPLTFGQGTKVEIK (SEQ ID NO.29) As a 5th acceptor sequence, the closest human germline IGKV2-30 (SEQ ID NO. 25) was selected. With the CDRs of the murine VL of Ätti grafted into aforementioned acceptor frameworks, the following humanized variants were selected and synthesized: >VL1 DIVMTQTPLSSPVTLGQPASISCRSSQSIVHSNGNTYLEWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGS GAGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.30) >VL2* DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWFQQRPGQSPRRLIYKVSNRFSGVPDRFSG SGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKVEIK (SEQ ID NO.31) >VL3* DIVMTQTPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWFHQRPGQSPRRLIYKVSNRFSGIPDRFSGS GSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTRLEIK (SEQ ID NO.32) >VL4* DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWFLQRPGQSPRRLIYKVSNRFSGVPDRFSGS GSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKVEIK (SEQ ID NO.33) >VL5* DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYQQRPGQSPRLLIYKVSNRFSGVPDRFSGS GSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.34) *VL2 - VL5 have mutations introduced to make the antibody more similar to the parental antibody while maintaining the humanized nomenclature. An alignment of the humanized variants to the original murine Ätti sequence is shown in Figure 2. The homology of the humanized variants to original murine VL sequence is shown in the following table. Table 3: Identical amino acids Consensus amino acids VL1 87.6% 93.8% VL2 89.4% 96.5% VL3 88.5% 96.5% VL4 90.3% 97.3% VL5 92.0% 97.3% Example 2.3: Expression and purification of the humanized variants DNA coding for the amino acid sequence of each antibody was synthesized and cloned into the mammalian transient expression plasmid pETE V2 (Fusion Antibodies, Northern Ireland)). Antibodies were expressed using a CHO based transient expression system and the resulting antibody containing cell culture supernatants were clarified by centrifugation and filtration. Antibodies were purified using a state-of-the-art chromatography equipment from cell culture supernatants via affinity chromatography. Purified antibodies were buffer exchanged into phosphate buffered saline solution. The purity of these antibodies was determined to be >95%, as judged by reducing and denaturing Sodium Dodecyl Sulfate Polyacrylamide gels. Antibody concentration was determined by measuring absorbance at 280 nm. The five humanized variable heavy chains were tested in combination with five of the humanized variable light chains, leading to a total of twenty-five (25) combinations. Of these 25 combinations, six could be successfully produced. These six combinations all include the humanized light chain VL5, independently of the humanized heavy chain used. In addition, VH2 in combination with VL3 could be successfully produced. These six combinations could be produced in sufficient quantity for further characterization. Example 2.4: Affinity determination of the humanized variants lgG antibodies were immobilized on biosensors using suitable capture surfaces and binding of soluble antigen to immobilized antibodies was monitored by BLI (Octet). The resulting sensorgrams were analyzed using the supplied software (Fortebio). As antigen human recombinant CD45 from R&D Systems was used (Catalog No.1430-CD-050; Lot# NUZ142001). As a pre-experiment a series of experiments was performed to optimize assay parameters. The following parameters were selected: Table 4: Antibody loading concentration 0.15 ug / ml Antigen stability @ 25°C, shaking >4hrs @1000rpm Running Buffer HBS-P+ with 10uM DTT Time for association 1200 sec Time for dissociation 1800 sec Kinetic screening protocol required Modified Antigen screening range (seven 10 — 0.1563nM concentrations, dilute 3-fold) Interaction / fitting model 1:1 In the main experiment kinetic assays were performed by first capturing lgG using anti-human Fc biosensors. The mAb capture biosensors were then submerged in wells containing different concentrations of antigen (association stage) followed by a dissociation step in running buffer. To allow for double reference correction, lgG-captured sensors were dipped into wells containing only buffer and blank sensors were also dipped into wells containing the antigen. This referencing provided a means of compensating for both the natural dissociation of the capture lgG and non-specific binding of the antigen to the sensor surface. Steps were performed at 25°C at a constant shaking of 1000 rpm. New sensors were used for each sample. Dissociation rate constants (KD) were calculated using the ForteBio Data Analysis software. All consumables used were those recommended by ForteBio. All samples were diluted in freshly prepared running buffer. Antibody variants were immobilized onto the surface of a series of biosensors using the capture methods described. Antigen was passed over the surface to generate a binding response. Binding data for the IgG:antigen interactions were collected at 25°C on the biosensors. A dilution series of the antigen was used in the association step, in order to fit results globally and get the best values for ka, kd, and KD. The response data for the binding of antigen to the surface immobilized lgG were fitted to a 1:1 binding model. Kinetic parameters are summarized in the table below. HC0 LC0 refers to murine Ätti. Table 5: NF: does not fit to 1:1 binding model Five of the antibodies showed a dissociation constant KD that is within the range of that of the original antibody Ätti (HC0 LC0). Of these five antibodies, four had a KD that was superior to that of Ätti, namely combinations VH1 / VL5, VH2 / VL5, VH3 / VL5 and VH4 / VL5. The combination VH2 / VL3 did not fit to a 1:1 binding model and was therefore not explored any further. characterization of the three antibodies It is accepted that protein aggregation, along the non-native pathway, is caused by protein conformational instability, or partial unfolding of a protein. The unfolding of the protein exposes the hydrophobic core residues, which then come together with other partially unfolded monomers to form dimers, and ultimately act as a nucleation point for mass aggregation. Thus, conformational stability is indicative of a protein’s propensity for non-native aggregation. Thermal stability is accepted as being a viable method to monitor a protein’s conformational stability, through the determination of its melting point (Tm). Differential scanning fluorimetry (DSF) allows for monitoring of conformational stability. Multiple studies have found highly correlative data between differential scanning calorimetry (DSC) and DSF, suggesting that DSF can successfully monitor protein thermal stability, and ultimately non-native aggregation propensity. DSF uses a fluorescent dye, which is quenched in aqueous environments, but fluoresces under hydrophobic conditions. As such, under heat exposure, antibodies begin to lose conformational stability and unfold, exposing hydrophobic core residues, which can be measured as an increase in fluorescent signal. Temperature vs fluorescence (melting profile) plots can then be used to determine the melting temperature (dF / dT curve) of a protein of interest. Many antibody molecules exhibit a two-phase melting profile. Published studies have shown mAbs display distinctive unfolding profiles as a result of melting transitions of their individual domains: CH2, CH3, and Fab. The thermal stability of lgG molecules is affected by all these domains. DSF curves reported for antibodies display two clearly discernible transitions: a lower temperature representing unfolding of the CH2 domain (Tm1), and a higher temperature representing melting of CH3—Fab domains (Tm2). Fab melting transition is generally well defined with a peak up to 2-3 times greater than that of CH2 or CH3. For DSF analysis, solutions of 5 µl of Sypro Orange (diluted 1 / 200 in water; Sigma) and 45 ul of 0.3 mg / ml of the antibody to be tested were added to a tube (Bio-Rad; TLS0831). The tubes were sealed with optical flat cap (Bio-Rad; TCS0803) and heated in an i-Cycler iQ5 real-time PCR detection system (Bio-Rad) from 20 to 95 °C in increments of 0.5°C. Fluorescence changes in the wells of the plate were monitored simultaneously with a charge-coupled (CCD) camera. The wavelengths for excitation and emission were 485 and 575 nm, respectively. The temperature midpoint for the protein unfolding transition, Tm, was calculated using the Bio-Rad iQ5 software. For size exclusion chromatography (SEC), samples were diluted to a final concentration of 0.1 mg / ml using phosphate buffered saline (PBS). Highly purified samples of antibodies were loaded independently onto a Superdex 200 increase 10 / 300 GL gel-filtration column.50 µl samples were injected and the column flow rate was maintained at 0.75 ml / min. Separations and equilibration steps were performed in phosphate buffered saline at 19°C. Protein peaks were monitored using absorbance at 214 nm and spectra were analyzed using the Unicorn evaluation software package (Cytiva). Melting curves were successfully generated for all samples. All antibodies tested display single-phase transition melting profiles. VH2 / VL5 exhibited the highest TM1 melting temperature, indicating that this IgG is the most conformation stable of the molecules tested. Tm values are summarized in the table below. Also SEC analysis has been performed successfully for all samples. The peak quality for SEC analysis was good for all samples. All antibodies eluted as one major peak. From the column calibration, the major peak corresponds to monomeric lgG. Table 6: Antibody Tm1 [°C] Tm2 [°C] % Monomer Comment VH0 / VL0 67.0 N / A >97 Good peak quality VH2 / VL5 76.0 N / A >97 Good peak quality VH3 / VL5 70.5 N / A >98 Good peak quality VH4 / VL5 66.5 N / A >97 Good peak quality Example 2.6: Summary and selection of the final candidate for further engineering All combinations which contain VL5 could be successfully expressed and purified. Additionally combination VH2 / VL3 could also be successfully expressed and purified. From the SDS-PAGE analysis, all antibodies exhibit adequate levels of purity. Under reducing conditions, both heavy and the light chains of the antibody are visible and are observed at the expected molecular weight of ~50 and 25kDa, respectively. Under non-reducing conditions, a single major band and several minor bands are observed. The additional bands (impurities) are likely the result of non- glycosylated lgG and lgG degradation products (e.g. a single [partial]light chain, a combination of two heavy and one light chain, two heavy chains, two heavy and one light chain). In the kinetic (Octet) analysis, all combinations with VL5 (VH1 / VL5, VH2 / VL5, VH3 / VL5, VH4 / VL5, VH5 / VL5) show binding characteristics similar to that of the control antibody VH0 / VL0, exhibiting dissociation constants within 2-fold of the control antibody. The biophysical properties of all antibodies were as good as that as of the original Ätti antibody. For further engineering antibody VH2 / VL5 was selected which showed an affinity of 162 pM, which is more than 2-fold higher than that of the original Ätti antibody (354 pM) and exhibited the highest melting temperature (TM1), indicating that this IgG is the most conformational stable of the molecules tested. Example 3: Removal of critical sites that are prone to PTM, immunogenicity, increased flexibility or hydrophobicity Example 3.1: Design of the engineered, humanized variants In the next engineering step, antibodies were screened for sites that are prone to Fv glycosylation, deamidation, isomerization, fragmentation, other kinds of post-translational modification (PTM) sequence hot spots, increased flexibility or hydrophobicity. Several such sites were identified in the CDRs of the antibodies. See the following table. Table 7: Motif Type Occurrence CDR NG deamidation RSSQSIVHSNGNTYLE (SEQ ID No.35) LCDR1 NT deamidationRSSQSIVHSNGNTYLE (SEQ ID No.35) LCDR1 RF T-cell epitope LLIYKVSNRFSGVPD (SEQ ID No.36) LCDR2 GGG flexible site FGGGTKLEIK (SEQ ID No.37) LC framework WWY Hydrophobic HCDR3 site To remove these detrimental amino acid motifs, variants of antibody VH2 / VL5 were generated. The approach for the respective changes were rationalized by analyses as described in the following. Sequence and structure-based descriptors were computed in silico to identify suitable variants that would preserve the structural integrity and bioactivity of the antibody while enhancing developability, binding affinity, solubility. To this aim, physicochemical descriptors were assessed against a dataset of therapeutic antibodies retrieved from the TABS database (https: / / tabs.craic.com / ) and a second dataset consisting of paired antibody repertoires from the Observed Antibody Space database (http: / / opig.stats.ox.ac.uk / webapps / oas / ). Sequence alignments, antibody numbering and CDR canonical structures were annotated upon alignment of the variable domain sequences to isotype specific Hidden Markov Models (HMMs) built as described in Nat Protoc (2014) 9: 2771-83. Three-dimensional models were built based on methods described in Nucleic Acid Res (2017) 45: W17-W23 and Bioinformatics (2014) 30: 2733-40, using a template-based approach for the frameworks, canonical structure modelling for the CDRs and a random-forest machine learning modelling approach for the heavy chain loop H3. For the VH / VL packing, a template based approach based on global similarity and identity at residue position L44 as described in FEBS J. (2011) 278: 2858-66 was used. Among the sequence descriptors, the antibody solubility profile was computed as a linear combination of different physicochemical properties such as hydrophobicity, electrostatic charge at neutral pH, α-helix and β-strand propensity of each amino acid (Nat Struct Biol (1996) 3: 842-8, J Mol Biol (1994) 238: 693-708). In order to account for the effect of neighboring amino acids, we employed a sliding window approach where the per-residue solubility descriptor is averaged over a window of seven consecutive amino acids and corrected for the occurrence of polar / non-polar aggregation prone patterns J Mol Biol (2000) 296: 961-8; Methods Mol Biol (2022) 2313: 57-113. While during the engineering step we did not impose a specific target value on local and global solubility, we excluded variants that would lead to the formation of covalent aggregates (cysteines) and solvent-exposed hydrophobic patches, as assessed by per-residue relative solvent accessibility computed on the 3D model of the paired VH / VL domain (F1000Res (2016) 5:189). Additionally, variants that would impact the conformations of the CDRs and consequently the antibody binding mode, were also excluded. This was performed by assessing the contribution of the engineered site to any of the established canonical structures (Nat Protocol (2014) 9: 2771-83) as well as by the evaluation of the expected binding mode of the native and engineered molecule using a per-residue probability score (Bioinformatics (2013) 29: 2285-91). Additionally, we excluded / prioritised variants that would lead to increased / reduced immunogenicity risk, as assessed by comparing the immunogenicity profile computed in silico against that of a large dataset of natural human repertoires and therapeutic antibodies of known immunogenicity (ADA frequency). To this aim we employed a readaptation of the NetMHCIIpan neural-network algorithm to screen the native and variant antibody sequences for the presence of class II restricted HLA ligands and putative T cell epitopes (Nucl Acids Res (2020) 48: W449- W454). We computed a global and local immunogenicity profile, corrected by the presence of shared HLA ligands to human germlines, which are likely tolerated or tolerogenic. Higher priority was given to variants that do not carry neo-epitopes (new HLA binders vs native) or cross-reactive epitopes (ligands recognized by multiple HLA alleles), and lower priority to variants that show high epitope content in regions of the antibody that show low immunogenicity scores in the reference antibody datasets. Sequences of the new VH and VL chains are shown in the following. >VL5.2 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSRGNTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.38) >VL5.3 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSKGNTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.39) >VL5.4 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSQGNTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.40) >VL5.5 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSSGNTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.41) >VL5.6 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNANTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.42) >VL5.7 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGQTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.43) >VL5.8 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGKTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.44) >VL5.9 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGETYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.45) >VL5.10 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGHTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.46) >VL5.11 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNKYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.47) >VL5.12 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSQGQTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.48) >VL5.13 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSQGKTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.49) >VL5.14 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSSGQTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.50) >VL5.15 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSKGQTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.51) >VL5.16 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNANKYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.52) >VL5.17 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYQQRPGQSPRLLIYKVSNLFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.53) >VL5.18 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYQQRPGQSPRLLIYKVSNRASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.54) >VL5.19 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYQQRPGQSPRLLIYKVSNRESGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.55) >VL5.20 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYQQRPGQSPRLLIYKVSNLASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.56) >VL5.21 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYQQRPGQSPRLLIYKVSNLESGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGGGTKLEIK (SEQ ID NO.57) >VL5.22 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSQGNTYLEWYQQRPGQSPRLLIYKVSNRASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.58) >VL5.23 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSSGNTYLEWYQQRPGQSPRLLIYKVSNRASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.59) >VH2.2 QVQLVESGGGLVKPGGSLRLSCAASGFAFSNYDMSWIRQAPGKGLEWVSYISSGGVSTYYPDT VKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRYDVWYYFDVWGRGTLVTVSS (SEQ ID NO.60) SEQ ID No.s of the variable light chains including their CDR are shown in the following table. Table 9: LCDR1 LCDR2 LCDR3 VL Kabat IMGT Kabat IMGT Kabat IMGT VL5.2 38 63 64 8 14 9 9 VL5.3 39 65 66 8 14 9 9 VL5.4 40 67 68 8 14 9 9 VL5.5 41 69 70 8 14 9 9 VL5.6 42 71 72 8 14 9 9 VL5.7 43 73 74 8 14 9 9 VL5.8 44 75 76 8 14 9 9 VL5.9 45 77 78 8 14 9 9 VL5.10 46 79 80 8 14 9 9 VL5.11 47 81 82 8 14 9 9 VL5.12 48 83 84 8 14 9 9 VL5.13 49 85 86 8 14 9 9 VL5.14 50 87 88 8 14 9 9 VL5.15 51 89 90 8 14 9 9 VL5.16 52 91 92 8 14 9 9 VL5.17 53 7 13 93 14 9 9 VL5.18 54 7 13 94 14 9 9 VL5.19 55 7 13 95 14 9 9 VL5.20 56 7 13 96 14 9 9 VL5.21 57 7 13 97 14 9 9 VL5.22 58 67 68 94 14 9 9 VL5.23 59 69 70 94 14 9 9 HCDR1 HCDR2 HCDR3 VH Kabat IMGT Kabat IMGT Kabat IMGT VH2.260 4 10 5 11 61 62 SEQ ID No.61: RYDVWYYFDV SEQ ID No.62: ARRYDVWYYFDV SEQ ID No.63: RSSQSIVHSRGNTYLE SEQ ID No.64: QSIVHSRGNTY SEQ ID No.65: RSSQSIVHSKGNTYLE SEQ ID No.66: QSIVHSKGNTY SEQ ID No.67: RSSQSIVHSQGNTYLE SEQ ID No.68: QSIVHSQGNTY SEQ ID No.69: RSSQSIVHSSGNTYLE SEQ ID No.70: QSIVHSSGNTY SEQ ID No.71: RSSQSIVHSNANTYLE SEQ ID No.72: QSIVHSNANTY SEQ ID No.73: RSSQSIVHSNGQTYLE SEQ ID No.74: QSIVHSNGQTY SEQ ID No.75: RSSQSIVHSNGKTYLE SEQ ID No.76: QSIVHSNGKTY SEQ ID No.77: RSSQSIVHSNGETYLE SEQ ID No.78: QSIVHSNGETY SEQ ID No.79: RSSQSIVHSNGHTYLE SEQ ID No.80: QSIVHSNGHTY SEQ ID No.81: RSSQSIVHSNGNKYLE SEQ ID No.82: QSIVHSNGNKY SEQ ID No.83: RSSQSIVHSQGQTYLE SEQ ID No.84: QSIVHSQGQTY SEQ ID No.85: RSSQSIVHSQGKTYLE SEQ ID No.86: QSIVHSQGKTY SEQ ID No.87: RSSQSIVHSSGQTYLE SEQ ID No.88: QSIVHSSGQTY SEQ ID No.89: RSSQSIVHSKGQTYLE SEQ ID No.90: QSIVHSKGQTY SEQ ID No.91: RSSQSIVHSNANKYLE SEQ ID No.92: QSIVHSNANKY SEQ ID No.93: KVSNLFS SEQ ID No.94: KVSNRAS SEQ ID No.95: KVSNRES SEQ ID No.96: KVSNLAS SEQ ID No.97: KVSNLES Example 3.2: Testing of the engineered, humanized variants The engineered variant were subjected to the same type of analysis and characterization as the initially humanized variants. For the experimental set up similar conditions were used as in Example 2 with the following differences. Binding affinities were determined using an Octet system Red96e or R8 at 25 °C and 1000 rpm using 1x kinetic buffer (Sartorius, PN: 18-1105). The antibodies were captured on antihuman capturing biosensors (Sartorius, PN_ 18-5060) at 0.5-1 ug / mL for 300-600 s. The antigen were titrated at different concentrations ranging from 200 nM to 0.5 nM and association / dissociation were monitored for 300-600 s and 1000-2000 s. Reference subtraction was performed against buffer only wells. AHC tips were regenerated using 10 mM Gly-HCl pH 1.7. Data were analyzed using the Octet Data Analysis software HT 12.0. Data were fitted to a 1:1 binding model. Kinetic rates ka and kd were globally fitted. Conformational stability was assessed by DSF as in Example 2 using Sypro Orange (Sigma) and an RT-PCR machine (C1000 Thermal Cycler, Biorad). The samples were measured at 0.25- 1.0 mg / mL in PBS buffer in duplicates and Sypro Orange was added at a final concentration of 5x. The same gradient as in Example 2 was used. All variants could be expressed and purified. The dissociation constant KD of most antibodies was comparable to that of the original Ätti. Two variants had a monomer content of below 85 % (VH2 / VL5.22 and VH2.2 / VL5.22). Results are summarized in the following table. Table 10: Antibody KD [nM] Tm1 [°C] Tm2 [°C] % Monomer Ätti 0.5(s.d.=0.13)67.3 (s.d=0.75) N / D>97VH2 / VL5 0.6 (s.d.=0.05) N / AN / D>97 VH2 / VL5.20.8 70.50 75.00 97.4VH2 / VL5.30.8 70.00 76.50 96.3VH2 / VL5.40.9 70.50 75.50 97.8VH2 / VL5.51.0 70.00 77.00 97.8VH2 / VL5.61.1 70.50 75.00 97.6VH2 / VL5.70.7 70.00 78.00 97.3VH2 / VL5.80.6 70.00 76.5098.9VH2 / VL5.91.3 70.00 77.50 98.0VH2 / VL5.101.1 70.50 77.00 98.6VH2 / VL5.110.9 70.50 75.50 98.0VH2 / VL5.121.0 70.00 75.50 97.8VH2 / VL5.130.9 70.00 76.0096.6VH2 / VL5.141.9 70.00 77.5098.4VH2 / VL5.150.9 70.50 75.50 98.1VH2 / VL5.161.4 70.00 75.50 96.7VH2 / VL5.170.7 70.00 75.0099.3VH2 / VL5.180.4 70.50 75.5095.8VH2 / VL5.190.9 69.00 N / D 99.1VH2 / VL5.200.4 70.50 75.00 96.6VH2 / VL5.210.8 66.00 N / D 99.0VH2 / VL5.22 0.670.00 74.00 73.9VH2.2 / VL5.221.869.50 76.00 71.5VH2.2 / VL5.233.469.50 77.50 88.5Example 3.3: Summary and selection of the candidates for further engineering In summary, it was possible to remove unwanted motifs from the sequence of the parental antibody Ätti without affecting the binding behaviour of the binder . This was in particular surprising since the sequence motif were located within the CDRs regions. The new variants nevertheless retained their ability to bind the target antigen with about the same, and some variants even with increase affinity. At the same time the biophysical properties of the binders remained in an acceptable range. For further engineering, six antibodies were selected (VH2 / VL5.2, VH2 / VL5.6, VH2 / VL5.7, VH2 / VL5.8, VH2 / VL5.17, and VH2 / VL5.20), which overall showed the most promising properties for further derivatization. Example 4: Removal of multiple sites that are prone to PTM or fragmentation Example 4.1: Design of the further engineered, humanized variants Encouraged by the successful removal of detrimental sequences motifs from the CDRs of antibody Ätti, the inventors next investigated if it would even be possible to remove multiple such motifs without losing affinity or functionality of the binders. The following variants were generated. Table 11 (“---" indicates that the site was not changed): Antibody NG in NT LCDR1 RF in LCDR2 GGG in VL LCDR1 VH2 / VL5.24 NG KT LA GQG VH2 / VL5.25 NA KT --- GQG VH2 / VL5.26 RG QT --- GQG VH2 / VL5.27 RG QT LA GQG VH2 / VL5.28 RG KT LA GQG VH2 / VL5.29 NA KT LA GQG VH2 / VL5.30 NA KT LF GQG VH2 / VL5.31 RG QT LF GQG Sequences of the new VL chains are shown in the following. >VL5.24 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGKTYLEWYQQRPGQSPRLLIYKVSNLASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.98) >VL5.25 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNAKTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.99) >VL5.26 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSRGQTYLEWYQQRPGQSPRLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.100) >VL5.27 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSRGQTYLEWYQQRPGQSPRLLIYKVSNLASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.101) >VL5.28 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSRGKTYLEWYQQRPGQSPRLLIYKVSNLASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.102) >VL5.29 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNAKTYLEWYQQRPGQSPRLLIYKVSNLASGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.103) >VL5.30 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNAKTYLEWYQQRPGQSPRLLIYKVSNLFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.104) >VL5.31 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSRGQTYLEWYQQRPGQSPRLLIYKVSNLFSGVP DRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK (SEQ ID NO.105) SEQ ID No.s of the variable light chains including their CDR are shown in the following table. Table 12: LCDR1 LCDR2 LCDR3 VL Kabat IMGT Kabat IMGT Kabat IMGT VL5.2498 75 76 96 14 9 9VL5.2599 106 107 8 14 9 9VL5.26100 108 109 8 14 9 9VL5.27101 108 109 96 14 9 9 VL5.28102 110 111 96 14 9 9VL5.29103 106 107 96 14 9 9 VL5.30104 106 107 93 14 9 9VL5.31105 108 109 93 14 9 9 SEQ ID No.106: RSSQSIVHSNAKTYLE SEQ ID No.107: QSIVHSNAKTY SEQ ID No.108: RSSQSIVHSRGQTYLE SEQ ID No.109: QSIVHSRGQTY SEQ ID No.110: RSSQSIVHSRGKTYLE SEQ ID No.111: QSIVHSRGKTY Example 4.2: Testing of the further engineered, humanized variants The engineered variant were subjected to the same type of analysis and characterization as the initially humanized variants. For the experimental set up see Example 2. All variants could be expressed and purified in with sufficient yield. All antibodies showed a dissociation constant KDwithin the range to the original Ätti antibody. Results are summarized in the following table. Table 13: Antibody KD[nM] Tm1 [°C] Tm2 [°C] % Monomer Ätti 0.5 (s.d. = 0.1) 67.3 (s.d.=0.8) N / D >97 VH2 / VL5.24 0.7 63.0 74.0 92 VH2 / VL5.25 0.6 63.0 75.5 >95 VH2 / VL5.26 1.7 63.0 76.0 N / D VH2 / VL5.27 1.2 63.0 73.0 87 VH2 / VL5.28 0.6 63.0 72.0 N / D VH2 / VL5.29 0.4 63.0 72.0 89 VH2 / VL5.30 0.4 63.0 73.0 >97 VH2 / VL5.31 1.1 63.0 74.0 97 Example 4.3: Summary and selection of the candidates for further engineering In summary, it was even possible to remove several unwanted motifs from the sequence of humanized variants of Ätti. At the same time the affinity of some variants was even higher than that of the original Ätti antibody, and the biophysical properties of the binders remained in the range of that of Ätti. Example 5: Summary of the sequences of the antibodies disclosed in the present patent The following table summarizes the key antibodies produced and tested in the present disclosure. Indicated are the VH and the VL sequences of the antibodies. The respective VH sequences, the VL sequences, and the CDR sequences can be found in the preceding Examples. Table 14: Antibody VH VL Ätti VH0 VL0 Amandine VH2 VL5 Annabelle VH3 VL5 Ballerina VH4 VL5 Celtiane VH2 VL5.2 Charlotte VH2 VL5.3 Cheyenne VH2 VL5.4 Ditta VH2 VL5.5 Erika VH2 VL5.6 Gwenne VH2 VL5.7 Jazzy VH2 VL5.8 Lady Christl VH2 VL5.9 Lucera VH2 VL5.10 Lutine VH2 VL5.11 Maldive VH2 VL5.12 Queen Anne VH2 VL5.13 Sunshine VH2 VL5.14 Venezia VH2 VL5.15 Vitabella VH2 VL5.16 Agata VH2 VL5.17 Belmonda VH2 VL5.18 Bintje VH2 VL5.19 Concordia VH2 VL5.20 Désirée VH2 VL5.21 Jelly VH2 VL5.22 Laura VH2.2 VL5.22 Victoria VH2.2 VL5.23 Agria VH2 VL5.24 Fontane VH2 VL5.25 Innovator VH2 VL5.26 Ivory Russet VH2 VL5.27 Markies VH2 VL5.28 Hermes VH2 VL5.29 Kiebitz VH2 VL5.30 Lady Claire VH2 VL5.31 Example 6: Specificity profiling the humanized antibodies The humanized antibodies generated in the preceding examples were tested for their specificity for the target antigen. For this experiment a Membrane Proteome Array (MPA) was used (Integral Molecular). The MPA is a protein library composed of 6,000 distinct human membrane protein clones, each overexpressed in live HEK-293T cells from expression plasmids. Each clone was individually transfected in separate wells of a 384-well plate followed by a 24h incubation (Proc Natl Acad Sci USA (2018) 115:eE4990-9). Cells expressing each individual MPA protein clone were arrayed in duplicate in a matrix format for high-throughput screening. Before screening on the MPA, the optimal concentration of the antibody to be tested for screening (antibody Kiebitz) was determined on cells expressing positive (membrane-tethered Protein A) and negative (mock-transfected) binding controls, followed by detection by flow cytometry using a fluorescently-labeled secondary antibody (Jackson ImmunoResearch, Cat#109-606-008). The optimal screening concentration of antibody Kiebitz was determined to be 20 µg / ml. Kiebitz was added to the MPA at 20µg / mL, and binding across the protein library was measured on an Intellicyt iQue using a fluorescently labeled secondary antibody (see above). Each array plate contains both positive (Fc-binding) and negative (empty vector) controls to ensure plate- by-plate reproducibility. Interactions of antibody Kiebitz above background was observed for five targets. Binding to these five targets (NOX5, CPOX, FRFL2, PHKG1 and LYSMD4) was evaluated in more details in a second flow cytometry experiment using serial dilutions of Kiebitz antibody (0.3, 1.3, 5, and 20 µg / mL). Binding to the five antigens identified in the large scale MPA assay could not be confirmed. Binding was less than 2-fold above background levels on the two highest concentrations tested The Kiebitz antibody is highly specific for CD45. Example 7: Depletion of CD45+ cells and LT-HSCs in humanized mice NSG mice were humanized by transplantation of human cord blood derived CD34+ HSPCs by The Jackson Laboratory.18 weeks after HSPC injection humanized mice were i.v. injected with Kiebitz-Teserine or BC8-Teserine conjugates at a single dose of 0.3mg / kg. Control animals were treated with phosphate-buffered saline (PBS) solution. 21 days after treatment the mice were euthanized and blood, spleen and bone marrow were analysed by FACS. The VH, the VL and the CDR sequences of antibody BC8 according to Kabat are shown in the following table. Table 15: BC8 Amino acid sequence SEQ ID No. VHEVKLLESGGGLVQPGGSLKLSCAASGFDFSRYWMSWVRQAPGKGL 112 EWIGEINPTSSTINFTPSLKDKVFISRDNAKNTLYLQMSKVRSED TALYYCARGNYYRYGDAMDYWGQGTSVTVSSAK VLDIALTQSPASLAVSLGQRATISCRASKSVSTSGYSYLHWYQQKPG 113 QPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATY YCQHSRELPFTFGSGTKLEIK HCDR1RYWMS114HCDR2EINPTSSTINFTPSLKD115HCDR3GNYYRYGDAMDY116LCDR1RASKSVSTSGYSYLH117LCDR2LASNLES118LCDR3QHSRELPFT119Results for depletion of human CD45+ cells (Gated as live / hCD45+) and Long-Term (LT)-HSCs in bone marrow are shown in Figure 3. LT-HSCs were gated as live / hCD45+ / CD34+ / CD38- / CD90+ / CD45RA-. Results show a complete depletion of all human CD45+ cells and LT-HSCs 3 weeks after a single dose of 0.3 mg / kg with the ADC Kiebitz-Teserine compared to PBS control group, whereas BC8-Teserine treatment resulted only in partial depletion. Example 8: Blocking with a naked antibody mimics shielding of cells and is able to prevent a decrease of cell viability of cell lines by subsequent treatment with an ADC In this experiment various human cell lines were with a Teserine conjugate of selected naked anti-CD45 antibodies. Certain samples were pre-incubated with the same anti-CD45 antibodies in naked (unconjugated) form). To do so MV4-11 cells were seeded at a concentration of 75000 cells / mL in 135ul of medium (IMDM supplemented with GlutaMAX + 10% heat inactivated FBS) in a 96-well plate. Some wells were pre-treated with 50ug / mL naked antibody (Kiebitz or Ref043) or PBS as a control for 1h, before adding various concentrations of Kiebitz-Tesrine or BC08-Tesirine (starting concentration for naked antibody pre-treated wells was 10 ug / ml and, starting concentrations for PBS pre- treated wells was 1 ug / ml for both cell lines) for 72h. Cell viability measurement was performed by adding 50ul CTG2.0 (CellTiter-Glo® 2.0 Cell Viability Assay #G9241, Promega) per well, incubating plates 10 minutes at room temperature on a shaker and reading luminescence (EnVision, Perkin Elmer). Also, Molm-13 cells were analyzed according to the same protocol as described. Cells were seeded at a concentration of 75000 cells / mL in 135ul of medium (RPMI1640 supplemented with GlutaMAX + 20% heat inactivated FBS) in a 96-well plate. Starting concentration for naked antibody pre-treatment was 3 ug / ml. Results are shown in Figure 4. It can be seen that in both cell lines tested blocking with naked antibodies mimics shielding of the cells and is able to prevent cell viability decrease via the respective ADCs. BC08-Tesirine shows lower potency than Kiebitz-Tesirine. Example 9: Blocking with a naked antibody can also be observed with HSPCs The experiment of Example 8 was repeated with HSPCs. CD34-positive HSPC’s were isolated from peripheral blood (CliniMACS Prodigy, Miltenyi Biotech). Cells were seeded at a concentration of 75000 cells / ml in 135ul of either low or high cytokine medium in a 96-well plate. Low cytokine medium consists of StemPro media (Gibco), StemPro nutrients (Gibco), 50 ng / ml LDL (STEMcell Technologies), 1% Penicillin / Streptomycin (Thermo Fisher), 1% glutamine (Thermo Fisher), 20 ng / ml Flt3 (Miltenyi Biotec), 50 ng / ml TPO (Milteny Biotec ) and 100 ng / ml SCF (Milteny Biotec). High cytokine medium consists of the same ingredients plus 50 ng / ml IL6 (Milteny Biotec), 10 ng / ml IL3 (Milteny Biotec), 10 ng / ml IL2 (Milteny Biotec), 20 ng / ml IL7 (Milteny Biotec), 50 ng / ml IL11 (Milteny Biotec), 3 ng / ml EPO (STEMcell Technologies) and 20 ng / ml GM- CSF (Milteny Biotec). Wells were pre-treated with 50ug / mL naked antibody (Kiebitz) or PBS as a control for 1h, before adding various concentrations of Kiebitz-Tesrine (starting concentration for naked antibody pre-treated wells was 10 ug / ml and, starting concentrations for PBS pre-treated wells was 1 ug / ml for both cell lines) for 72h. Cell viability measurement was performed by adding 50ul CTG2.0 (CellTiter-Glo® 2.0 Cell Viability Assay #G9241, Promega) per well, incubating plates 10 minutes at room temperature on a shaker and reading luminescence (EnVision, Perkin Elmer). Results are shown in Figure 5. Also in HSPC, blocking with naked Kiebitz antibody shields cells and is able to prevent cell viability decrease a respective ADC. The IC 50s increased 58- fold in the low cytokine medium (0.0029 µg / ml vs. 0.17 µg / ml) and 38-fold in the high cytokine medium( 0.0059 µg / ml vs.0.23 µg / ml). Example 10: Blocking can seen in wild type cell, but not in CD45 knock out cells A similar experiment was performed with wild-type and CD45 knock-out Jurkat cells. Jurkat or Jurkat cells engineered for CD45 KO were seeded at a concentration of 75,000 cells / mL in 135ul of medium (RPMI1640 (ATCC modification) + 10% heat inactivated FBS) in a 96-well plate. Various concentrations of Kiebitz-Tesrine were added. Starting concentration was 100 ug / ml. Cells were incubated for 72h. Cell viability measurement was performed by adding 50ul CTG2.0 (CellTiter- Glo® 2.0 Cell Viability Assay #G9241, Promega) per well, incubating plates 10 minutes at room temperature on a shaker and reading luminescence (EnVision, Perkin Elmer). Results are shown in Figure 6. Jurkat CD45 knock-out cells have an IC50 for Kiebitz-Tesrine which is significantly higher than the IC50 in Jurkat wild-type cells (0.46 µg / ml vs.0.032 µg / ml). Example 11: Antibodies bind to CD45 endogenously expressed on cells KASUMI-1 cells (ATCC No. CRL-2724) were stained with different concentrations of antibody Ätti or the humanized derivatives Amandine or Ballerina, using an IgG Goat anti-Human AF488 secondary antibody. Cells stained with a human IgG1 isotype control were used to determine background staining. Results are shown in Figure 7. All three antibodies tested bind equally well to CD45 endogenously expressed on Jurkat cells. In a similar experiment Jurkat cells or Jurkat CD45 knock-out (KO) cells were stained with different dilutions of antibody Kiebitz-AF647. Unstained Jurkat cells and an anti-human Ig-AF647 were used to determine background staining levels. AF647-labeled Kiebitz recognizes CD45 endogenously expressed on Jurkat cells in a concentration-dependent manner. Kiebitz does not bind to CD45 KO Jurkat cells. Example 12: Antibody expression as scFv-Fc’s Not all antibodies could well be expressed in scFv-Fc format. One antibody that could well be expressed in this format is antibody Jelly (VH2 / VL5.22). Such antibodies are particular useful for certain purposes, for example the use in CARs or on LNPs. Certain additional antibodies were generated that all could be well expressed as scFv-Fc’s. These antibodies are shown in Table 16. Table 16: Lady Rosetta SEQ ID Comment Sequence No. 21 VH2QVQLVESGGGLVKPGGSLRLSCAASGFAFSNYDMSWIRQAP GKGLEWVSYISSGGVSTYYPDTVKGRFTISRDNAKNSLYLQ MNSLRAEDTAVYYCARRYDVWWYFDVWGRGTLVTVSS 121 VL5.38DIQMTQSPLSLPVTLGQPASISCRSSQSIVHSQGNTYLEWYQQRPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLKISR VEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK 4HCDR1 (Kabat)NYDMS5HCDR2 (Kabat)YISSGGVSTYYPDTVKG6HCDR3 (Kabat)RYDVWWYFDV67 LCDR1 (Kabat)RSSQSIVHSQGNTYLE94 LCDR2(Kabat)KVSNRAS9LCDR3 (Kabat)FQGSHVPMYT10 HCDR1 (IMGT)GFAFSNYD11 HCDR2 (IMGT)ISSGGVST12 HCDR3 (IMGT)ARRYDVWWYFDV68 LCDR1 (IMGT)QSIVHSQGNTY14 LCDR2 (IMGT)KVS9 LCDR3 (IMGT)FQGSHVPMYTLevinata SEQ ID Comment Sequence No.21 VH2QVQLVESGGGLVKPGGSLRLSCAASGFAFSNYDMSWIRQAP GKGLEWVSYISSGGVSTYYPDTVKGRFTISRDNAKNSLYLQ MNSLRAEDTAVYYCARRYDVWWYFDVWGRGTLVTVSS122 VL5.39DVVMTQSPLSLPVTLGQPASISCQASQSIVHSQGNTYLEWYQQRPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLKISR VEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK4 HCDR1 (Kabat)NYDMS5 HCDR2 (Kabat)YISSGGVSTYYPDTVKG6 HCDR3 (Kabat)RYDVWWYFDV120 LCDR1 (Kabat)QASQSIVHSQGNTYLE94 LCDR2(Kabat)KVSNRAS9 LCDR3 (Kabat)FQGSHVPMYT10 HCDR1 (IMGT)GFAFSNYD11 HCDR2 (IMGT)ISSGGVST12 HCDR3 (IMGT)ARRYDVWWYFDV68 LCDR1 (IMGT)QSIVHSQGNTY14 LCDR2 (IMGT)KVS9 LCDR3 (IMGT)FQGSHVPMYTOsira SEQ ID Comment Sequence No.21 VH2QVQLVESGGGLVKPGGSLRLSCAASGFAFSNYDMSWIRQAP GKGLEWVSYISSGGVSTYYPDTVKGRFTISRDNAKNSLYLQ MNSLRAEDTAVYYCARRYDVWWYFDVWGRGTLVTVSSVL5.40DIQMTQSPLSLPVTLGQPASISCQASQSIVHSQGNTYLEWYQQRPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLKISR VEAEDVGVYYCFQGSHVPMYTFGQGTKLEIK HCDR1 (Kabat)NYDMSHCDR2 (Kabat)YISSGGVSTYYPDTVKGHCDR3 (Kabat)RYDVWWYFDVLCDR1 (Kabat)QASQSIVHSQGNTYLELCDR2(Kabat)KVSNRASLCDR3 (Kabat)FQGSHVPMYTHCDR1 (IMGT)GFAFSNYDHCDR2 (IMGT)ISSGGVSTHCDR3 (IMGT)ARRYDVWWYFDVLCDR1 (IMGT)QSIVHSQGNTYLCDR2 (IMGT)KVSLCDR3 (IMGT)FQGSHVPMYT

Claims

Claims 1. A humanized antibody or antibody fragment specific for human CD45, wherein said antibody or antibody fragment comprises a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable heavy chain comprising, the LCDR1 region of SEQ ID NO: 7, the LCDR2 region of SEQ ID NO: 8 and the LCDR3 region of SEQ ID NO: 9, wherein the humanized antibody or antibody fragment comprises at least one of the following mutations: a) the glycine in the LCDR1 region (SEQ ID NO: 7) is replaced by alanine, b) the second asparagine in the LCDR1 region (SEQ ID NO: 7) is replaced by lysine, c) the arginine in the LCDR2 region (SEQ ID NO: 8) is replaced by leucine, or d) the phenylalanine in the LCDR2 region (SEQ ID NO: 8) is replaced by alanine.

2. The humanized antibody or antibody fragment according to claim 1, wherein said humanized antibody or antibody fragment comprises a) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 75, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9, b) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 8, and the LCDR3 region of SEQ ID NO: 9, c) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 96, and the LCDR3 region of SEQ ID NO: 9, d) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 110, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9,e) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 96 and the LCDR3 region of SEQ ID NO: 9, f) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 106, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO: 9, or g) a variable heavy chain comprising a HCDR1 region of SEQ ID NO: 4, a HCDR2 region of SEQ ID NO: 5, a HCDR3 region of SEQ ID NO: 6 and a variable light chain comprising, the LCDR1 region of SEQ ID NO: 108, the LCDR2 region of SEQ ID NO: 93 and the LCDR3 region of SEQ ID NO:

9.

3. The humanized antibody or antibody fragment according to claim 1 or 2, wherein said humanized antibody or antibody fragment comprises a mutation of the second glycine of the triple glycine motif of framework region 4 of the variable light chain to glutamine.

4. The humanized antibody or antibody fragment according to anyone of the preceding claims, wherein said humanized antibody or antibody fragment comprises a) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 98, b) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 99, c) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 101, d) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 102, e) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 103, f) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO: 104, or g) a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO:

105.

5. The humanized antibody or antibody fragment according to any one of the preceding claims, wherein said humanized antibody or antibody fragment comprises the following mutations a) the glycine in the LCDR1 region (SEQ ID NO: 7) is replaced by alanine, b) the second asparagine in the LCDR1 region (SEQ ID NO: 7) is replaced by lysine, and c) the arginine in the LCDR2 region (SEQ ID NO: 8) is replaced by leucine.

6. The humanized antibody or antibody fragment according to claim 5, wherein said humanized antibody or antibody fragment comprises a variable heavy chain of SEQ ID NO: 21 and a variable light chain of SEQ ID NO:

104.

7. The humanized antibody according to any one of the preceding claims, wherein said humanized antibody comprises a modification in the FC region, preferably wherein said Fc modification is a silencing mutation selected from (numbering according EU index ) PA-LALA (L234A / L235A / P329A), PG-LALA (L234A / L235A / P329G) and AEASS (L234A / L235E / G237A / A330S / P331S).

8. The humanized antibody or antibody fragment according to any one of the preceding claims, wherein said humanized antibody or antibody fragment is a monoclonal antibody or antibody fragment.

9. An antibody drug conjugate comprising a humanized antibody or antibody fragment according to any one of the preceding claims and a cytotoxic drug.

10. The antibody drug conjugate according to claim 9, wherein said cytotoxic drug is a pyrrolobenzodiazepine (PBD), preferably tesirine.

11. The humanized antibody or antibody fragment according to any one of claims 1-8 or the antibody drug conjugate of claim 9 or 10 for use in medicine, preferably wherein said use in medicine is the treatment of a hematological cancer, such as a leukemia, myeloma or lymphoma, or the treatment of an inflammatory or autoimmune disease such as multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, Crohn’s disease, Type 1 diabetes, rheumatoid arthritis or idiopathic arthritis 12. A nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding the humanized antibody or antibody fragment according to any one of claims 1-8 or the antibody drug conjugate of claim 9 or 10.

13. A vector comprising the nucleic acid composition of claim 12.

14. A host cell comprising the vector of claim 13 or the nucleic acid composition of claim 12.

15. A pharmaceutical composition comprising the humanized antibody or antibody fragment according to any one of claims 1-8 or the antibody drug conjugate of claim 9 or 10 and a pharmaceutically acceptable carrier or excipient.