Suppressors of tauopathies
Patent Information
- Application Number
- EP2024702539
- Authority / Receiving Office
- EP · EP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2023-01-30
- Filing Date
- 2024-01-30
- Publication Date
- 2025-12-10
AI Technical Summary
Current treatments for tauopathies, such as Alzheimer's disease, lack effective methods to inhibit the progression of tau-mediated neurotoxicity, as existing therapies fail to target the underlying tau pathology effectively.
Development of inhibitors that statistically significantly reduce the expression of specific genes, including MCTP1, SHANK1, SHANK2, PLOD1, and others, using antisense oligonucleotides, siRNA, or CRISPR-Cas technology to mitigate tau-induced effects in tauopathic disorders.
The proposed solution effectively reduces tau-induced stress and neurotoxicity, providing a potential therapeutic approach to inhibit the progression of tauopathies by targeting key genes associated with tau pathology.
Smart Images

Figure IMGF000013_0001 
Figure 00000063_0000 
Figure 00000063_0001
Abstract
Description
SUPPRESSORS OF TAUOPATHIESFIELD OF THE INVENTIONThe invention relates to field of neurodegeneration, more particularly to Tau neurotoxicity. The application identifies genes whose reduced expression suppresses pathological Tau mediated effects. These Tau suppressors are provided for use as a medicament in general, and for treating or inhibiting progression of tauopathies or symptoms of tauopathies in particular.BACKGROUND TO THE INVENTIONTau pathology is associated with more than twenty neurodegenerative diseases, including Alzheimer's disease (Wang & Mandelkow 2016 Nat Rev Neurosci 17:5-21). Hyperphosphorylation or mutation of the microtubule-associated protein Tau is common to all of these diseases, collectively termed Tauopathies, and filamentous inclusions of hyperphosphorylated Tau are hallmark pathologies of Alzheimer's disease and other Tauopathies (Ballatore et al 2007 Nature Reviews Neuroscience 8:663-672). Tau pathology is not merely a byproduct of other pathological pathways but is a key mediator of neurotoxicity itself (Roberson et al 2007 Science 316:750-754; Hutton et al 1998 Nature 393:702-705; Caffrey & Wade- Martins 2007 Neurobiol Dis 27:1-10; Le Guennec et al 2016 Molecular Psychiatry 1-7). Under physiological conditions, Tau is expressed in neurons and is bound to axonal microtubules. However, under pathological conditions, mutations in Tau (e.g. in FTDP-17) or abnormal phosphorylation of Tau (including sporadic Alzheimer's disease) decrease its microtubule binding affinity (Hong et al 1998 Science 282:1914-1917; Wang & Mandelkow 2016 Nat Rev Neurosci 17:5-21), leading to its dissociation from axonal microtubules and subsequent mislocalization to synapses (Spires-Jones & Hyman 2014 Neuron 82:756-771; Tai et al 2012 Am J Pathol 181:1426-1435; Tai et al 2014 Acta Neuropathol Commun 2:146). This mislocalisation of soluble Tau plays a key role in perturbing synaptic function in early disease stages, which may contribute to subsequent synapse loss and neurodegeneration.Interestingly, some cell types in the brain are more vulnerable towards Tau than others. Whether the underlying reason is a cell-type intrinsic property, or a consequence of increased expression levels of Tau is an open question.SUMMARY OF THE INVENTIONThe inventors of current application found that there is brain-wide expression of Tau without obvious correlation with regions known to be differentially vulnerable, suggesting that tau pathology is a celltype intrinsic phenomenon. Therefore, RNA expression data of all vulnerable cell types and of all resilient cell types were compared to uncover molecular signatures associated with pathological tau-inducedstress. A non-obvious list of candidates genes in a heterozygous loss-of-function condition was found to partially overcome tau-induced effects in a pathogenic tau expressing model.In one aspect, the invention relates to an inhibitor for use as a medicament, wherein the inhibitor statistically significantly reduces the functional expression of at least one gene of the list consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X and NLGN4Y. In a particular aspect, the inhibitor is provided for use in (a method for) treating or inhibiting progression of a tauopathic disorder or for use in (a method for) treating or inhibiting a symptom of a tauopathic disorder.In one embodiment, the inhibitor is a genetic inhibitor, an antisense inhibitor, a transcript inhibitor, an RNA interference compound or an inhibitor of the RNAi technology. In a particular embodiment, the inhibitor is selected from the group consisting of an antisense oligonucleotide, a gapmer, a siRNA, a shRNA, an antisense oligonucleotide, a zinc-finger nuclease, a meganuclease, a TAL effector nuclease, a CRISPR-Cas effector, an antibody or a fragment thereof binding to any of the targets identified herein, an alpha-body, a nanobody, an intrabody, an aptamer, a DARPin, an affibody, an affitin, an anticalin, and a monobody.In one embodiment, the inhibitors herein disclosed are oligonucleotides that specifically bind to one of the genes selected from the list consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X and NLGN4Y and reduce the expression of said one of the genes through antisense or RNAi technology. More particularly, an oligonucleotide of 10 to 50 nucleotides in length is provided comprising a contiguous nucleotide sequence of at least 10 contiguous nucleotides in length which are at least 90% complementary to an equal length portion of nucleotides comprised in or being part of SEQ ID No. 51-63, 64-68, 69-72, 73-81, 82-88, 96-98, 99-112, 89-95, 162- 170, 153-161, 171-176, 177-184, 211-215, 216-221, 222-229, 230-232, 233-243, 244-246, 320, 321-325, 326-336, 311-319, 303-310, 337-343, 365-372, 373-378 or 379-382. In one embodiment, said contiguous nucleotide sequence is at least 12, 14 or 16 nucleotides in length. In another embodiment, said contiguous nucleotide sequence is 100% complementary to a contiguous nucleotide sequence of equal length that is part of or comprised within the sequence set forth in any of SEQ. ID No. 51-63, 64-68, 69- 72, 73-81, 82-88, 96-98, 99-112, 89-95, 162-170, 153-161, 171-176, 177-184, 211-215, 216-221, 222-229, 230-232, 233-243, 244-246, 320, 321-325, 326-336, 311-319, 303-310, 337-343, 365-372, 373-378 or 379-382.In another embodiment, said oligonucleotide comprises one or more internucleoside linkage and / or one or more 2' sugar modified nucleosides. More particularly, the internucleoside linkage is aphosphorothioate internucleoside linkage and / or the 2' sugar modified nucleoside is selected from the group consisting of 2'-O-methyl-, 2'-O-methoxyethyl-, 2'-O-alkyl-, 2' -alkoxy, 2' -amino-, 2'-fluoro- and LNA nucleosides. In another embodiment, said oligonucleotide is a single stranded antisense oligonucleotide, an siRNA, a shRNA, a CRISPR gRNA or forms the guide strand of an siRNA or shRNA complex.In a particular embodiment, the oligonucleotide comprises a gapmer of formula 5'-F-G-F'-3', where region F and F' independently comprise between 1 and 8 nucleosides, of which 1 to 5 independently are 2' sugar modified nucleosides and define the 5' and 3' end of the F and F' region, and G is a region between 5 and 18 nucleosides for recruiting RNaseH. Even more particular, said oligonucleotide is provided wherein the internucleoside linkages between one or more nucleosides of region F and / or F' and / or between F and G and / or between F' and G are phosphorothioate internucleoside linkages.In another aspect, a pharmaceutical composition comprising the inhibitor according to the invention is provided.Regarding current application, the tauopathic disorder may be selected from the group consisting of Alzheimer's disease, progressive supranuclear palsy (PSP), progressive supranuclear palsy-parkinsonism (PSP-P), Richardson's syndrome, argyrophilic grain disease, corticobasal degeneration Pick's disease, frontotemporal dementia with parkinsonism associated with chromosome 17 (FTDP-17), postencephalitic parkinsonism, Parkinson's disease complex of Guam, Guadeloupean parkinsonism, Huntington disease, Down's syndrome, dementia pugilistica, familial British dementia, familial Danish dementia, myotonic dystrophy, Hallevorden-Spatz disease, Niemann Pick type C, chronic traumatic encephalopathy, tangle-only dementia, white matter tauopathy with globular glial inclusions, subacute sclerosing panencephalitis, SLC9A6-related mental retardation, non-Guamanian motor neuron disease with neurofibrillary tangles, neurodegeneration with brain iron accumulation, Gerstmann-Straussler- Scheinker disease, frontotemporal lobar degeneration, diffuse neurofibrillary tangles with calcification, chronic traumatic encephalopathy, amyotrophic lateral sclerosis of Guam, amyotrophic lateral sclerosis and parkinsonism-dementia complex, prion protein cerebral amyloid angiopathy, and progressive subcortical gliosis. In current application, the symptom of the tauopathic disorder may be selected from the group of mild cognitive impairment, dementia, cognitive decline, decline of motor function, oculomotor and bulbar dysfunction, synaptic dysfunction, neurotoxicity, neuronal degeneration, neuronal dysfunction, synapse loss, and amyloid deposition. The synaptic dysfunction may be further specified as pre-synaptic dysfunction.BRIEF DESCRIPTION OF THE FIGURESFigure 1A shows TAU expression levels across multiple regions and cell types of non-neurodegeneration human brains. ACC, anterior cingulate cortex. Arrowheads indicate vulnerable (dark red) and not reported as affected (green) example cell types from the text. Human brains are from non- neurodegeneration control donors not known to carry a-synuclein or tau mutations.Figure IB shows the percentile of mean TAU expression amongst the means of genes that are detected in at least 5% of a given cell type in the Allen Brain Map data (Allen Brain Map, 2021). MTG, middle temporal gyrus; CgG, anterior cingulate gyrus; VIC, primary visual cortex; A1C, primary auditory cortex; Mlul, upper limb region of primary motor cortex; Mllm, lower limb region of primary motor cortex; Slum, upper limb region of primary somatosensory cortex; Slim, lower limb region of primary somatosensory cortex.Figure 1C shows the percentile of mean TAU expression amongst the means of genes that are detected in at least 5% of a given cell type in the Agarwal et al. 2020 dataset. SN, substantia nigra; DaNs dopaminergic neurons; Ex, excitatory neurons; In, inhibitory neurons, ODC, oligodendrocytes, OPC, oligodendrocyte precursor cell.Figure 2A-B shows immuno-blots and quantification of tau expression in fly heads as compared to healthy human brains. Weaker expressing QF2w (middle lanes) was used as compared to the stronger Q.F2 (Riabinina et al., 2015). Only one tau splice isoform (0N4R) was expressed in the Drosophila models, which is contrasted by multiple tau bands in human brains. Replicate values, mean and standard deviation (SD) are shown. Figure 2C shows that the tau expression is maintained throughout the lifespan of the flies.Figure 2D shows the ERG traces of repeat experiments (gray) and mean (red) for 45 day old flies are shown. Arrowheads indicate the loss of light-on and off transients in P301L tau expressing flies.Figure 2E is a hierarchical clustering across scaled mean sleep and activity parameters at 5, 25 and 45 days of age. Z-scores of condition means are shown. N = 53-89 flies per genotype and age; 3 independent experiments each.Figure 2F shows the automated quantification of vacuole area across entire brains normalized for brain size. From left to right: mini-w+, smGdP, a-syn[A53T], a-syn[dNAC], tau[P301L], tau[dVQIVYK]. Replicate values, median, IQR and whiskers at 1.5xlQR are shown, ns, p > 0.05; *p < 0.05; **p < 0.01; ***p < 0.001; Two-sample t-test and Bonferroni correction. Male flies were used throughout.Figure 3A shows a scatter-plot and linear regression of mean normalized and log-transformed transgene levels across cell types of 5 day and 25 day old P301L tau vs. A53T a-synuclein models. Only cell types with a minimum of 50 cells and those that are not part of the large central clusters are shown.Figure 3B shows the expression percentiles of a-synuclein[A53T] and tau[P301L] in neurons of male nSyb-QF2w / QUAS Drosophila model single-cell sequencing data as well as expression percentiles of the human MAPT (tau) and SNCA (a-synuclein) genes in neurons of the human substantia nigra and frontal gyrus from the Agarwal et al. 2020 dataset.Figure 3C shows the quantification of optic lobes with dystrophic neuronal processes in C2 / 3 neurons co-expressing CD8::GFP and a-synuclein[A53T], tau[P301L] as well as smGdP control in 25 day old animals. N = number of optic lobes, noted at bottom of bars, ns, p > 0.05; ***p < 0.001; Fisher's exact test and Bonferroni correction.Figure 3D shows the C2 CD8::GFP lamina projection width as measured in mid-lamina confocal slices at three equally spaced locations by a blinded observer. Replicate values, median, IQR and whiskers at 1.5xlQR are shown. *p < 0.05; ***p < 0.001; one-way ANOVA with Dunnett's multiple comparison test.Figure 3E shows the quantification of Tml dendritic area. Replicate values, median, IQR and whiskers at 1.5xlQR are shown. *p < 0.05; ***p < 0.001; one-way ANOVA with Dunnett's multiple comparison test.Figure 3F shows the quantification of Tml dystrophic neurons. Fractions are shown. N = number of optic lobes, noted at bottom of bars, ns, p > 0.05; **p < 0.01; Fisher's exact test and Bonferroni correction.Figure 3G shows the maximum intensity projections of 25 day old a / p-Kenyon cell (KC) lobes which are the synaptic and dendritic areas of this cell-type. Replicate values, median, IQR and whiskers at 1.5xlQR are shown, ns, p > 0.05; **p < 0.01; one-way ANOVA with Dunnett's multiple comparison test.Figure 3H-I shows the CD8::GFP maximum intensity and synaptic area projections of 25 day old LClOa synaptic terminals. Replicate values, median, IQR and whiskers at 1.5xlQR are shown, ns, p > 0.05; *p < 0.05; one-way ANOVA with Dunnett's multiple comparison test.Figure 4A-B show the cell-type proportions of neurons aged 45 days predicted to be vulnerable or resilient in the 5 and 25 day model. Replicate values, median, IQR and whiskers at 1.5xlQR are shown. *p < 0.05; **p < 0.01; ***p < 0.001; Two-sample t-test and Bonferroni correction. Male flies of the genotypes as indicated were used.Figure 4C shows the number of significantly up- / downregulated DEGs per neuron type are shown for nSyb-QF2w > QUAS-tau[P301L] vs. nSyb-QF2w > mini-w+ flies at 45 days as calculated with DESeq2 and FDR < 0.05.Figure 4D shows the number of significantly up- / downregulated DEGs per neuron type are shown for nSyb-QF2w > QUAS- a-synuclein[A53T] / -tau[P301L] vs. nSyb-QF2w > mini-w+ flies at 25 days in Ll-4 and L5 neurons. DEG testing was performed with edgeR, with 5 days and 25 days combined and FDR < 0.05. Male flies of the indicated genotypes were used.Figure 5A-B shows the grouped GO terms enriched in P301L tau resilient neurons as compared to vulnerable ones (A) or enriched in P301L tau vulnerable neurons as compared to resilient ones (B). Number of GO terms grouped under each parent term are shown in brackets. Top 10 parent terms per ontology are shown. BP, biological process; CC, cellular component; MF, molecular function.Figure 6-7 show the ERG on-transient amplitude differences to P301L tau expression alone at 45 days (Figure 6) or 25 days (Figure 7), after heterozygous loss of function alleles of predicted vulnerability genes have been crossed in. Male flies of the indicated genotypes were used. Individual flies, median, IQR and whiskers at 1.5xlQR are shown. *p < 0.05; **p < 0.01; ***p < 0.001; one-way ANOVA with Dunnett's multiple comparison test.DETAILED DESCRIPTION OF THE INVENTIONDefinitionsIn order that the present description can be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description. The present invention is described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope. The drawings described are only schematic and are non-limiting. In the drawings, the size of some of the elements may be exaggerated and not drawn on scale for illustrative purposes. It is to be noted that the term "a" or "an" entity refers to one or more of that entity; for example, "a nucleotide sequence", is understood to represent one or more nucleotide sequences. As such, the terms "a" (or "an"), "one or more" and "at least one" can be used interchangeably herein. Furthermore, "and / or" where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term "and / or" as used in a phrase such as "A and / or B" herein is intended to include "A and B", "A or B", "A" (alone), and "B" (alone). Likewise, the term "and / or" as used in a phrase such as "A, B, and / or C" is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone). Where an indefinite or definite article is used when referring to a singular noun e.g. "a" or "an", "the", this includes a plural of that noun unless something else is specifically stated. Furthermore, the terms first, second, third and the like in the description and in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein.It is understood that wherever aspects or embodiments are described herein with the language "comprising", otherwise analogous aspects or embodiments described in terms of "consisting of" and / or "consisting essentially of" are also provided. Where the term "comprising" is used in the present description and claims, it does not exclude other elements or steps. Unless specifically defined herein, all terms used herein have the same meaning as they would to one skilled in the art of the present invention.Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary of Biochemistry and Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure. Practitioners are particularly directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Press, Plainsview, New York (2012); and Ausubel et al., current Protocols in Molecular Biology (Supplement 100), John Wiley & Sons, New York (2012), for definitions and terms of the art. The definitions provided herein should not be construed to have a scope less than understood by a person of ordinary skill in the art.Units, prefixes, and symbols are denoted in their Systeme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, nucleotide sequences are written left to right in 5' to 3' orientation. Amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects of the disclosure, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.The term "about" is used herein to mean approximately, roughly, around, or in the regions of. When the term "about" is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term "about" can modify a numerical value above and below the stated value by a variance of, e.g., 10 percent, up or down (higher or lower). For example, if it is stated that an inhibitor of MCTP1 reduces the expression of MCTP1 in a cell by at least about 60%, it is implied that the MCTP1 expression is reduced by a range of 50% to 70%.As used herein, the terms "nucleic acid", "nucleic acid sequence" or "nucleic acid molecule" are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Nucleic acids may have any three-dimensional structure, and may perform any function, known or unknown. Non-limiting examples of nucleic acids include a gene, a genefragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, control regions, isolated RNA of any sequence, nucleic acid probes, and primers. The nucleic acid molecule may be linear or circular. The nucleic acid may comprise single stranded or double stranded DNA or RNA. The nucleic acid may comprise any know type of modification, for example modified bases, a modified backbone, methylation, "caps" substitution of one or more of the naturally occurring nucleotides with an analogue. A nucleic acid can be up to about 100 nucleotides in length, in that case the nucleic acid is often referred to as an oligonucleotide, but can also be up to several 1000s of nucleotides in length. A nucleic acid may comprise a promoter, one or more introns, one or more exons, an enhancer region, a polyadenylation site, a translation initiation site, 5' or 3' untranslated regions, a reporter gene, a selectable marker or the like. The "coding sequence" is defined by the exons and is a nucleic acid sequence, which is transcribed into mRNA and / or translated into a polypeptide when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a translation start codon at the 5'-terminus and a translation stop codon at the 3'-terminus. A coding sequence can include, but is not limited to mRNA, cDNA, recombinant nucleotide sequences or genomic DNA, while introns may be present as well under certain circumstances."Nucleotides" as used herein refer to the building blocks of oligonucleotides and polynucleotides, and for the purposes of the present invention include both naturally occurring and non-naturally occurring nucleotides. In nature, nucleotides, such as DNA and RNA nucleotides comprise a ribose sugar moiety, a nucleobase moiety and one or more phosphate groups (which are absent in nucleosides). A nucleotide without a phosphate group is called a "nucleoside" and is thus a compound comprising a nucleobase moiety and a sugar moiety. As used herein, "nucleobase" means a group of atoms that can be linked to a sugar moiety to create a nucleoside that is capable of incorporation into an oligonucleotide, and wherein the group of atoms is capable of bonding with a complementary naturally occurring nucleobase of another oligonucleotide or nucleic acid. Naturally occurring nucleobases of RNA or DNA comprise the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U)."Contiguous" as used herein means next or together in sequence, hence the contiguous nucleotides or amino acids are linked nucleotides or amino acids (i.e. no additional nucleotides or amino acids are present between those that are linked).The term, "complementary" means that two sequences are complementary when the sequence of one can bind to the sequence of the other in an anti-parallel sense wherein the 3'-end of each sequencebinds to the 5'-end of the other sequence and each A, T(U), G, and C of one sequence is then aligned with a T(U), A, C, and G, respectively, of the other sequence. Normally, the complementary sequence of the oligonucleotide has at least 90%, preferably 95%, most preferably 100%, complementarity to a defined sequence.In determining the degree of "complementarity" between oligonucleotides of the disclosure (or regions thereof) and the target region, such as those disclosed herein, the degree of "complementarity" (also, "homology" or "identity") is expressed as the percentage identity (or percentage homology) between the sequence of the oligomer (or region thereof) and the sequence of the target region (or the reverse complement of the target region) that best aligns therewith. The percentage is calculated by counting the number of aligned bases that are identical between the two sequences, dividing by the total number of contiguous monomers in the oligomer, and multiplying by 100. In such a comparison, if gaps exist, it is preferable that such gaps are merely mismatches rather than areas where the number of monomers within the gap differs between the oligomer of the disclosure and the target region.The term "derivative" as used herein refers to a chemical compound related structurally to a compound disclosed herein (e.g., an oligonucleotide of the present disclosure), e.g., having the same carbon skeleton, but chemically modified to introduce, e.g., a side chain or group, in one or more positions, and wherein the derivative possesses a biological activity (e.g., the capacity to reduce Syngr3 expression) that is substantially similar to a biological activity of the entity or molecule it is a derivative.The term "defined by SEQ ID No. X" or "as depicted in SEQ ID No. X" as used herein refers to a biological sequence consisting of the sequence of amino acids or nucleotides given in the SEQ. ID No. X. For instance, a gene defined in / by SEQ ID No. X consists of the nucleic acid sequence given in SEQ ID No. X. A further example is nucleic acid sequence comprising SEQ ID No. X, which refers to a nucleic acid sequence longer than the nucleic acid sequence given in SEQ ID No. X but entirely comprising the nucleic acid sequence given in SEQ ID No. X (wherein the nucleic acid sequence given in SEQ ID No. X can be located N-terminally or C-terminally in the longer nucleic acid sequence, or can be embedded in the longer nucleic acid sequence), or to a nucleic acid sequence consisting of the nucleic acid sequence given in SEQ ID No. X.The term "wild-type" refers to a gene or gene product isolated from a naturally occurring source. A wildtype gene is that which is most frequently observed in a population and is thus arbitrarily designed the "normal" or "wild-type" form of the gene. In contrast, the term "modified", "mutant", "engineered" or "variant" refers to a gene or gene product that displays modifications in sequence, post-translational modifications and / or functional properties (i.e., altered characteristics) when compared to the wild-typegene or gene product. It is noted that naturally occurring mutants can be isolated; these are identified by the fact that they have altered characteristics when compared to the wild-type gene or gene product."Treatment" refers to any rate of reduction or retardation of the progress of the disease or disorder compared to the progress or expected progress of the disease or disorder when left untreated. More desirable, the treatment results in no or zero progress of the disease or disorder (i.e. "inhibition" or "inhibition of progression") or even in any rate of regression of the already developed disease or disorder."Reduction" or "reducing" as used herein refers to a statistically significant reduction, more particularly said statistically significant reduction is an at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% reduction compared to the control situation."Increasing" or "increase" or "enhancing" or "promoting" or "stimulating" as used herein interchangeable and refer to a statistically significant increase, more particularly said statistically significant increase is an at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% increase compared to the control situation.The term "statistically significantly" different is well known by the person skilled in the art. Statistical significance plays a pivotal role in statistical hypothesis testing. It is used to determine whether the null hypothesis should be rejected or retained. The null hypothesis is the default assumption that nothing happened or changed, hence that there is no difference for example in expression of MCTP1 in the presence of an inhibitor compared to the expression of MCTP1 in the absence of said inhibitor. For the null hypothesis to be rejected, an observed result has to be statistically significant, i.e. the observed p- value is less than the pre-specified significance level a. The p-value of a result, p, is the probability of obtaining a result at least as extreme, given that the null hypothesis were true. In one embodiment, a is 0.05. In a more particular embodiment, a is 0.01. In an even more particular embodiment, a is 0.001.Suppressors of Tau pathologyThe human Tau protein (alternatively known as microtubule-associated protein tau or MART; HGNC: 6893, NCBI Entrez Gene: 4137, Ensembl: ENSG00000186868) in the brain is a collection of six isoforms generated through alternative splicing. The 6 isoforms lack or contain a different number of near-amino- terminal inserts ("N": ON, IN or 2N) and lack or contain "R2", one of the 4 repeats in the microtubulebinding domain. This yields the 6 variants, from the longest (splicing name 2N4R; 441 amino acids) to the shortest variant (splicing name 0N3R; 352 amino acids), with 4 intermediate variants (1N4R: 412 amino acids; 0N4R: 383 amino acids; 2N3R: 410 amino acids; 1N3R: 381 amino acids) (e.g. Wang &Mandelkow 2016). By way of example, the protein sequence of the 2N4R variant is shown in SEQ ID No. 383.SEQ ID No. 383 (Tau protein)MAEPRQEFEVM EDHAGTYGLGDRKDQGGYTM HQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDV TAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIA TPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRT PPKSPSSAKSRLQ.TAPVPMPDLKNVKSKIGSTENLKHQ.PGGGKVQ.IINKKLDLSNVQ.SKCGSKDNIKHVPGGGSVQ.lv YKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDH GAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGLIn current application it is disclosed how the inventors developed means and method to reduce Tau pathology. By using publicly available human brain mRNA sequencing datasets of non- neurodegeneration control individuals, the inventors could first show that there is brain-wide expression of tau without obvious correlation with regions known to be differentially vulnerable. Next, Drosophila models were generated expressing the pathogenic human tau (P301L) mutant in all neurons, wherein the relative expression level across cell types was genetically comparable and at levels comparable to those found in human brains. Deep phenotyping combined with brain-wide scRNA-seq in fruit flies revealed that specific and overlapping neuron types were impacted significantly stronger than expected upon tau mutant expression. Next, RNA expression data of all vulnerable cell types and of all resilient cell types were compared to uncover molecular signatures associated with P301L tau-induced stress. A non-obvious selection of the long list of 2000 candidate genes revealed a short list of 45 candidates of which heterozygous loss-of-function (LOF) effect in a pathogenic tau expressing fly model was tested. About 18 genes partially overcame the tau-induced effects. Among them, both genes that have (e.g. Syngr) or have not already been linked to tauopathies.Current application therefore provides inhibitors for use to treat tauopathies, wherein the inhibitors statistically significantly reduce the expression of at least one gene from Table 1 or from the list consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X, NLGN4Y, HSP90AB1, HSP90AA1, TRPM3, TRPM1, TRPM7, TRPM6, SLC8A1, SLC8A2, SLC8A3, DPP10, RYR1, RYR2, RYR3, GRIA1, GRIA2, GRIA3, GRIA4, CALM1, CALM2, CALM3, NLGN1, NLGN2 and NLGN3.From here on any of the genes listed in Table 1 can be referred to as any of the targets of the application.Table 1. List of genes that in a reduce of function suppresses pathological Tau effect in vivoHSP90AB1 or Heat Shock Protein 90 Alpha Family Class B Member 1 (HGNC: 5258; NCBI Entrez Gene: 3326; Ensembl: ENSG00000096384; UniProtKB / Swiss-Prot: P08238) encodes for the HSP90beta protein which is a molecular chaperone that aids protein folding and quality control for a large number of 'client' proteins. HSP90 operates as dimer and has intrinsic ATPase activity. The HSP90 dimer acts in concert with other chaperones (e.g. HSP70). HSP90AB1 has 4 isoforms. In one embodiment, HSP90AB1 refers to any of SEQ ID No. 1-4. In a particular embodiment, HSP90AB1 is SEQ ID No. 1.HSP90AA1 or Heat Shock Protein 90 Alpha Family Class A Member 1 (HGNC: 5253; NCBI Entrez Gene: 3320; Ensembl: ENSG00000080824; UniProtKB / Swiss-Prot: P07900) encodes the human stress-inducible 90-kDa heat shock protein alpha (HSP90A). HSP90AA1 has 6 isoforms. In one embodiment, HSP90AA1 refers to any of SEQ. ID No. 5-10. In a particular embodiment, HSP90AA1 is SEQ ID No. 5.TRPM3 or Transient Receptor Potential Cation Channel Subfamily M Member 3 (HGNC: 17992; NCBI Entrez Gene: 80036; Ensembl: ENSG00000083067; UniProtKB / Swiss-Prot: Q9HCF6) belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. TRPM3 has 23 isoforms. In one embodiment, TRPM3 refers to any of SEQ ID No. 11-33. In a particular embodiment, TRPM3 is SEQ ID No. 11. TRPM1 or Transient Receptor Potential Cation Channel Subfamily M Member 1 (HGNC: 7146; NCBI Entrez Gene: 4308; Ensembl: ENSG00000134160; UniProtKB / Swiss-Prot: Q7Z4N2) has 9 isoforms. In one embodiment, TRPM1 refers to any of SEQ ID No. 34-42. In a particular embodiment, TRPM1 is SEQ ID No. 34. TRPM7 or Transient Receptor Potential Cation Channel Subfamily M Member 7 (HGNC: 17994; NCBI Entrez Gene: 54822; Ensembl: ENSG00000092439; UniProtKB / Swiss-Prot: Q96QT4) has 4 isoforms. In one embodiment, TRPM7 refers to any of SEQ ID No. 43-46. In a particular embodiment, TRPM1 is SEQ ID No. 43. TRPM6 or Transient Receptor Potential Cation Channel Subfamily M Member 6 (HGNC: 17995; NCBI Entrez Gene: 140803; Ensembl: ENSG00000119121; UniProtKB / Swiss-Prot: Q9BX84) has 4 isoforms. In one embodiment, TRPM6 refers to any of SEQ ID No. 47-50. In a particular embodiment, TRPM1 is SEQ ID No. 47.MCTP1 or Multiple C2 And Transmembrane Domain Containing 1 (HGNC: 26183; NCBI Entrez Gene: 79772; Ensembl: ENSG00000175471; UniProtKB / Swiss-Prot: Q6DN14) encodes for a calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity. MCTP1 has 13 isoforms. In one embodiment, MCTP1 refers to any of SEQ ID No. 51-63. In a particular embodiment, MCTP1 is SEQ ID No. 51.MCTP2 or Multiple C2 And Transmembrane Domain Containing 2 (HGNC: 25636; NCBI Entrez Gene: 55784; Ensembl: ENSG00000140563; UniProtKB / Swiss-Prot: Q6DN12) has 5 isoforms. In one embodiment, MCTP2 refers to any of SEQ ID No. 64-68. In a particular embodiment, MCTP2 is SEQ ID No. 64.SHANK1 or SH3 And Multiple Ankyrin Repeat Domains 1 (HGNC: 15474; NCBI Entrez Gene: 50944; Ensembl: ENSG00000161681; UniProtKB / Swiss-Prot: Q9Y566) encodes a member of the SHANK family of synaptic proteins that may function as molecular scaffolds in the postsynaptic density of excitatory synapses. SHANK proteins contain multiple domains for protein-protein interaction, including ankyrin repeats, and an SH3 domain. SHANK1 has 4 isoforms. In one embodiment, SHANK1 refers to any of SEQ. ID No. 69-72. In a particular embodiment, SHANK1 is SEQ ID No. 69.SHANK2 or SH3 And Multiple Ankyrin Repeat Domains 2 (HGNC: 14295; NCBI Entrez Gene: 22941; Ensembl: ENSG00000162105; UniProtKB / Swiss-Prot: Q9UPX8) has 9 isoforms. In one embodiment, SHANK2 refers to any of SEQ ID No. 73-81. In a particular embodiment, SHANK2 is SEQ ID No. 73.SHANK3 or SH3 And Multiple Ankyrin Repeat Domains 3 (HGNC: 14294; NCBI Entrez Gene: 85358; Ensembl: ENSG00000251322; UniProtKB / Swiss-Prot: Q9BYB0) has 7 isoforms. In one embodiment, SHANK3 refers to any of SEQ ID No. 82-88. In a particular embodiment, SHANK3 is SEQ ID No. 82.PLOD1 or Procollagen-Lysine,2-Oxoglutarate 5-Dioxygenase 1 (HGNC: 9081; NCBI Entrez Gene: 5351; Ensembl: ENSG00000083444; UniProtKB / Swiss-Prot: Q02809) has 3 isoforms. In one embodiment, PLOD1 refers to any of SEQ ID No. 96-98. In a particular embodiment, PLOD1 is SEQ ID No. 96.PLOD2 (HGNC: 9082; NCBI Entrez Gene: 5352; Ensembl: ENSG00000152952; UniProtKB / Swiss-Prot: 000469) has 14 isoforms. In one embodiment, PLOD2 refers to any of SEQ ID No. 99-112. In a particular embodiment, PLOD2 is SEQ ID No. 99. PLOD3 (HGNC: 9083; NCBI Entrez Gene: 8985; Ensembl: ENSG00000106397; UniProtKB / Swiss-Prot: 060568) has 7 isoforms. In one embodiment, PLOD3 refers to any of SEQ ID No. 89-95. In a particular embodiment, PLOD3 is SEQ ID No. 89.SLC8A1-3 are members of the Solute Carrier Family 8 that mediate the exchange of one Ca2+ion against three to four Na+ions across the cell membrane, and thereby contribute to the regulation of cytoplasmic Ca2+levels and Ca2+-dependent cellular processes. SLC8A1 or Solute Carrier Family 8 member Al (HGNC: 11068; NCBI Entrez Gene: 6546; Ensembl: ENSG00000183023; UniProtKB / Swiss-Prot: P32418) has 19 isoforms. In one embodiment, SLC8A1 refers to any of SEQ ID No. 122-140. In a particular embodiment, SLC8A1 is SEQ ID No. 122.SLC8A2 or Solute Carrier Family 8 member A2 (HGNC: 11069; NCBI Entrez Gene: 6543; Ensembl: ENSG00000118160; UniProtKB / Swiss-Prot: Q9UPR5) has 4 isoforms. In one embodiment, SLC8A2 refers to any of SEQ ID No. 141-144. In a particular embodiment, SLC8A2 is SEQ ID No. 141.SLC8A3 or Solute Carrier Family 8 member A3 (HGNC: 11070; NCBI Entrez Gene: 6547; Ensembl: ENSG00000100678; UniProtKB / Swiss-Prot: P57103) has 9 isoforms. In one embodiment, SLC8A3 refers to any of SEQ. ID No. 113-121. In a particular embodiment, SLC8A3 is SEQ ID No. 113.DPP10 or Dipeptidyl Peptidase Like 10 (HGNC: 20823; NCBI Entrez Gene: 57628; Ensembl: ENSG00000175497; UniProtKB / Swiss-Prot: Q8N608) encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. DPP10 has 8 isoforms. In one embodiment, DPP10 refers to any of SEQ ID No. 145-152. In a particular embodiment, DPP10 is SEQ ID No. 145.FARP1 or FERM, ARH / RhoGEF And Pleckstrin Domain Protein 1 (HGNC: 3591; NCBI Entrez Gene: 10160; Ensembl: ENSG00000152767; UniProtKB / Swiss-Prot: Q9Y4F1) encodes a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the cell membrane. The encoded protein functions in neurons to promote dendritic growth. FARP1 has 9 isoforms. In one embodiment, FARP1 refers to any of SEQ ID No. 162-170. In a particular embodiment, FARP1 is SEQ ID No. 162.FARP2 or FERM, ARH / RhoGEF And Pleckstrin Domain Protein 2 (HGNC: 16460: NCBI Entrez Gene: 9855; Ensembl: ENSG00000006607; UniProtKB / Swiss-Prot: 094887) enables guanyl-nucleotide exchange factor activity. Acts upstream of or within Rac protein signal transduction and neuron remodeling. FARP2 has 9 isoforms. In one embodiment, FARP2 refers to any of SEQ ID No. 153-161. In a particular embodiment, FARP1 is SEQ ID No. 153.POSTN or Periostin (HGNC: 16953; NCBI Entrez Gene: 10631; Ensembl: ENSG00000133110; UniProtKB / Swiss-Prot: Q15063) encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results inmultiple transcript variants encoding different isoforms. POSTN has 6 isoforms. In one embodiment, POSTN refers to any of SEQ ID No. 171-176. In a particular embodiment, POSTN is SEQ ID No. 171.TGFBI or Transforming Growth Factor Beta Induced (HGNC: 11771; NCBI Entrez Gene: 7045; Ensembl: ENSG00000120708; UniProtKB / Swiss-Prot: Q15582) encodes an RGD-containing protein that binds to type I, II and IV collagens. TGFBI plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. TGFBI has 8 isoforms. In one embodiment, TGFBI refers to any of SEQ. ID No. 177-184. In a particular embodiment, TGFBI is SEQ ID No. 177.RYR1 or Ryanodine Receptor 1 (HGNC: 10483; NCBI Entrez Gene: 6261; Ensembl: ENSG00000196218; UniProtKB / Swiss-Prot: P21817) encodes a ryanodine receptor found in skeletal muscle. The encoded protein functions as a calcium release channel in the sarcoplasmic reticulum but also serves to connect the sarcoplasmic reticulum and transverse tubule. Alternatively spliced transcripts encoding 8 different isoforms. In one embodiment, RYR1 refers to any of SEQ ID No. 190-197. In a particular embodiment, RYR1 is SEQ ID No. 190.RYR2 or Ryanodine Receptor 2 (HGNC: 10484; NCBI Entrez Gene: 6262; Ensembl: ENSG00000198626; UniProtKB / Swiss-Prot: Q92736) encodes a ryanodine receptor found in cardiac muscle sarcoplasmic reticulum. The encoded protein is one of the components of a calcium channel, composed of a tetramer of the ryanodine receptor proteins and a tetramer of FK506 binding protein IB proteins, that supplies calcium to cardiac muscle. RYR2 has 5 isoforms. In one embodiment, RYR2 refers to any of SEQ ID No. 185-189. In a particular embodiment, RYR2 is SEQ ID No. 185.RYR3 or Ryanodine Receptor 3 (HGNC: 10485; NCBI Entrez Gene: 6263; Ensembl: ENSG00000198838; UniProtKB / Swiss-Prot: Q15413) encodes a ryanodine receptor, which functions to release calcium from intracellular storage for use in many cellular processes. For example, the encoded protein is involved in skeletal muscle contraction by releasing calcium from the sarcoplasmic reticulum followed by depolarization of T-tubules. RYR3 has 13 isoforms. In one embodiment, RYR3 refers to any of SEQ ID No. 198-210. In a particular embodiment, RYR3 is SEQ ID No. 198.TRMT9B or TRNA Methyltransferase 9B (HGNC: 26725; NCBI Entrez Gene: 57604; Ensembl: ENSG00000250305; UniProtKB / Swiss-Prot: Q9P272) encodes a tRNA methyltransferase predicted to be involved in tRNA wobble uridine modification. TRMT9B has 5 isoforms. In one embodiment, TRMT9B refers to any of SEQ ID No. 211-215. In a particular embodiment, TRMT9B is SEQ ID No. 211.ALKBH8 or AlkB Homolog 8, TRNA Methyltransferase also known as TRMT9A (HGNC: 25189; NCBI Entrez Gene: 91801; Ensembl: ENSG00000137760; UniProtKB / Swiss-Prot: Q96BT7) enables tRNA (uracil)methyltransferase activity. ALKBH8 has 6 isoforms. In one embodiment, ALKBH8 / TRMT9A refers to any of SEQ ID No. 216-221. In a particular embodiment, ALKBH8 / TRMT9A is SEQ ID No. 216.ADCY4, ADCY2, ADCY7 and ADCY8 are members of the family of adenylate cyclases, which encode membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). ADCY4 or Adenylate Cyclase 4 (HGNC: 235; NCBI Entrez Gene: 196883; Ensembl: ENSG00000129467; UniProtKB / Swiss-Prot: Q8NFM4) has 8 isoforms. In one embodiment, ADCY4 refers to any of SEQ. ID No. 222-229. In a particular embodiment, ADCY4 is SEQ ID No. 222. ADCY2 or Adenylate Cyclase 2 (HGNC: 233; NCBI Entrez Gene: 108; Ensembl: ENSG00000078295; UniProtKB / Swiss-Prot: Q08462) has 3 isoforms. In one embodiment, ADCY2 refers to any of SEQ ID No. 230-232. In a particular embodiment, ADCY2 is SEQ ID No. 230. ADCY7 or Adenylate Cyclase 7 (HGNC: 238; NCBI Entrez Gene: 113; Ensembl: ENSG00000121281; UniProtKB / Swiss-Prot: P51828) has 11 isoforms. In one embodiment, ADCY7 refers to any of SEQ ID No. 233-243. In a particular embodiment, ADCY7 is SEQ ID No. 233. ADCY8 or Adenylate Cyclase 8 (HGNC: 239; NCBI Entrez Gene: 114; Ensembl: ENSG00000155897; UniProtKB / Swiss-Prot: P40145) has 3 isoforms. In one embodiment, ADCY8 refers to any of SEQ ID No. 244-246. In a particular embodiment, ADCY8 is SEQ ID No. 244.GRIA1-4 stands for Glutamate Ionotropic Receptor AMPA Type Subunit 1-4 are AMPA receptors and members of the ionotropic class of glutamate receptors. Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for these genes. GRIA1 (HGNC: 4571; NCBI Entrez Gene: 2890; Ensembl: ENSG00000155511; UniProtKB / Swiss-Prot: P42261) has 6 isoforms. In one embodiment, GRIA1 refers to any of SEQ ID No. 284-289. In a particular embodiment, GRIA1 is SEQ ID No. 284. GRIA2 (HGNC: 4572; NCBI Entrez Gene: 2891; Ensembl: ENSG00000120251; UniProtKB / Swiss-Prot: P42262) has 32 isoforms. In one embodiment, GRIA2 refers to any of SEQ ID No. 252-283. In a particular embodiment, GRIA2 is SEQ ID No. 252. GRIA3 (HGNC: 4573; NCBI Entrez Gene: 2892; Ensembl: ENSG00000125675; UniProtKB / Swiss- Prot: P42263) has 5 isoforms. In one embodiment, GRIA3 refers to any of SEQ ID No. 247-251. In a particular embodiment, GRIA3 is SEQ ID No. 247. GRIA4 (HGNC: 4574; NCBI Entrez Gene: 2893; Ensembl: ENSG00000152578; UniProtKB / Swiss-Prot: P48058) has 13 isoforms. In one embodiment, GRIA4 refers to any of SEQ ID No. 290-302. In a particular embodiment, GRIA4 is SEQ ID No. 290.CALM1 and CALMS are members of the EF-hand calcium-binding protein family. Calcium-induced activation of calmodulin regulates and modulates the function of cardiac ion channels. CALM1 or Calmodulinl (HGNC: 1442; NCBI Entrez Gene: 801; Ensembl: ENSG00000198668; UniProtKB / Swiss-Prot: P0DP23) has 9 isoforms. In one embodiment, CALM1 refers to any of SEQ ID No. 311-319. In a particular embodiment, CALM1 is SEQ. ID No. 311. CALMS or Calmodulin3 (HGNC: 1449; NCBI Entrez Gene: 808; Ensembl: ENSG00000160014; UniProtKB / Swiss-Prot: P0DP25) has 8 isoforms. In one embodiment, CALMS refers to any of SEQ ID No. 303-310. In a particular embodiment, CALMS is SEQ ID No. 303.IGLON5 or IgLON Family Member 5 (HGNC: 34550; NCBI Entrez Gene: 402665; Ensembl: ENSG00000142549; UniProtKB / Swiss-Prot: A6NGN9) encodes for Ig-Like Domain-Containing Protein 5 and refers to SEQ ID No. 320.OPCML or Opioid Binding Protein / Cell Adhesion Molecule Like (HGNC: 8143; NCBI Entrez Gene: 4978; Ensembl: ENSG00000183715; UniProtKB / Swiss-Prot: Q14982) encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily of proteins. OPCML binds opioids in the presence of acidic lipids and is probably involved in cell contact. OPCML has 5 isoforms. In one embodiment, OPCML refers to any of SEQ ID No. 321-325. In a particular embodiment, OPCML is SEQ ID No. 321.NTM or Neurotrimin (HGNC: 17941; NCBI Entrez Gene: 50863; Ensembl: ENSG00000182667; UniProtKB / Swiss-Prot: Q9P121) encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. NTM has 11 isoforms. In one embodiment, NTM refers to any of SEQ ID No. 326-336. In a particular embodiment, NTM is SEQ ID No. 326.NLGN1-3 or Neuroligin 1-3 encode members of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. Alternatively spliced transcript variants have been found for these genes. NLGN1 (HGNC: 14291; NCBI Entrez Gene: 22871; Ensembl: ENSG00000169760; UniProtKB / Swiss-Prot: Q8N2Q7) has 6 isoforms. In one embodiment, NLGN1 refers to any of SEQ ID No. 344-349. In a particular embodiment, NLGN1 is SEQ ID No. 344. NLGN3 (HGNC: 14289; NCBI Entrez Gene: 54413; Ensembl: ENSG00000196338; UniProtKB / Swiss-Prot: Q9NZ94) has 15 isoforms. In one embodiment, NLGN3 refers to any of SEQ ID No. 350-364. In a particular embodiment, NLGN3 is SEQ ID No. 350.NLGN4X or Neuroligin 4 X-Linked (HGNC: 14287; NCBI Entrez Gene: 57502; Ensembl: ENSG00000146938; UniProtKB / Swiss-Prot: Q8N0W4) encodes a member of the type-B carboxylesterase / lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. NLGN4X has 7 isoforms. In one embodiment, NLGN4X refers to any of SEQ ID No. 337-343. In a particular embodiment, NLGN4X is SEQ ID No. 337.NLGN4Y or Neuroligin 4 Y-Linked (HGNC: 15529; NCBI Entrez Gene: 22829; Ensembl: ENSG00000165246; UniProtKB / Swiss-Prot: Q8NFZ3) encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene. NLGN4Y has 8 isoforms. In one embodiment, NLGN4Y refers to any of SEQ. ID No. 365-372. In a particular embodiment, NLGN4Y is SEQ ID No. 365.SLC38A11 or Solute Carrier Family 38 Member 11 (HGNC: 26836; NCBI Entrez Gene: 151258; Ensembl: ENSG00000169507; UniProtKB / Swiss-Prot: Q08AI6) is predicted to be involved in amino acid transmembrane transport. SLC38A11 has 6 isoforms. In one embodiment, SLC38A11 refers to any of SEQ ID No. 373-378. In a particular embodiment, SLC38A11 is SEQ ID No. 373.SLC38A2 or Solute Carrier Family 38 Member 2 (HGNC: 13448; NCBI Entrez Gene: 54407; Ensembl: ENSG00000134294; UniProtKB / Swiss-Prot: Q96QD8) is a symporter that cotransports neutral amino acids and sodium ions from the extracellular to the intracellular side of the cell membrane. SLC38A2 has 4 isoforms. In one embodiment, SLC38A2 refers to any of SEQ ID No. 379-382. In a particular embodiment, SLC38A2 is SEQ ID No. 379.Inhibitors of the applicationThe skilled person is aware of several means and methods to reduce the expression of target genes or the level of the proteins for which they code. The nature of the inhibitor is not relevant for the invention as long as the transcript level of at least one of the genes selected from Table 1 or the level of one of the proteins for which said genes encode is statistically significantly reduced compared to a situation where the inhibitor is not present. For example, the concept of designing oligonucleotides to bind to specific sequences in target RNAs via Watson-Crick hydrogen bonding is well established as said antisense technique has been introduced already in the late 1970s. The term "antisense" included at that time oligonucleotides of any structure, with any chemical modification and designed to work through any post-RNA hybridization mechanism. However, nowadays and in practice the term "antisense" is used to describe single stranded antisense oligonucleotides (ss ASOs) designed to hybridize to RNAs, while RNAi (RNA interference) mediating agents such as "siRNAs" have come to mean double strandedoligonucleotides designed to activate Argonaute2 (Ago2). Thus, in some aspects, an oligonucleotide of the present disclosure comprises an antisense oligonucleotide (ASO), e.g., an unconjugated or conjugated ASO. In some aspects, an oligonucleotide of the present disclosure comprises a siRNA, e.g., an unconjugated or conjugated siRNA.In one embodiment, the inhibitors are genetic inhibitors or inhibitors of the inhibitory RNA technology or antisense inhibitors or inhibitors of the antisense technology. In another embodiment, the inhibitors are nucleic acid molecules that comprise a sequence complementary to a region in one of the sequences listed in SEQ ID No. 1-372, particularly SEQ ID No. SEQ ID No. 51-63, 64-68, 69-72, 73-81, 82-88, 96-98, 99-112, 89-95, 162-170, 153-161, 171-176, 177-184, 211-215, 216-221, 222-229, 230-232, 233-243, 244- 246, 320, 321-325, 326-336, 311-319, 303-310, 337-343, 365-372, 373-378 or 379-382 or allelic variants thereof. The term "allelic variants" refer to one of several alternate forms of a gene occupying a given locus on a chromosome of an organism (Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985)). These allelic variants can vary at either the polynucleotide and / or polypeptide level and are included in the present disclosure. Alternatively, non-naturally occurring variants can be produced by mutagenesis techniques or by direct synthesis.In a particular embodiment, the inhibitors are selected from the list consisting of an antisense oligonucleotide, a gapmer, an siRNA, a shRNA and a Crispr gRNA.In yet another embodiment, the application also provides inhibitors that reduce the protein level or the activity of one of the targets herein disclosed. The generation of antibodies or fragments thereof that bind specific targets is a well-established method to reduce the protein level and / or activity of proteins.Antisense oligonucleotidesIn some aspects, the inhibitor of the present disclosure is an oligonucleotide, more particularly an ASO. Antisense oligonucleotides or ASOs are small (generally, "'18-30 nucleotides or shorter, e.g. 12 to 20 nucleotides), synthetic, single-stranded nucleic acid polymers of diverse chemistries, which can be employed to modulate gene expression via various mechanisms. ASOs can be subdivided into two major categories: RNase H competent and steric block ASOs. In some aspects, the oligonucleotide of the present disclosure is RNase H competent. In some aspects, the oligonucleotide of the present disclosure is a steric block ASO.RNases H are a family of endonucleases that hydrolyze RNA residues in various nucleic acids, such as RNA-DNA-like duplexes. In human cells, there are two canonical RNase H enzymes: RNA Hl and H2. RNase Hl is present in the nucleus, cytoplasm and in mitochondria. The main function of RNase Hl is the clearance of R-Loops, particularly in GC rich genomic regions. The endogenous RNase H enzymeRNaseHl also recognizes RNA-DNA heteroduplex substrates that are formed when DNA-based oligonucleotides are taken up by the cell and bind to complementary mRNA transcripts and subsequently catalyses the degradation of targeted RNA. Cleavage at the site of ASO binding results in destruction of the target RNA, thereby silencing target gene expression. To create a heteroduplex substrate for RNase Hl, an ASO must contain at least 5 contiguous deoxynucleotide units, with optimal enzyme activity achieved with 8-10 contiguous deoxynucleotides. This approach has been widely used as a means of downregulating disease-causing or disease-modifying genes (Roberts et al 2020 Nature Reviews 19:673- 694). In a particular embodiments, the antisense oligonucleotide of the invention or the contiguous nucleotide sequence thereof is a gapmer. A gapmer or gapmer oligonucleotide comprises at least three distinct structural regions: a 5'-flank, a gap and a 3'-flank or F-G-F' in the'5 -> 3' orientation. The "gap" region (G) comprises a stretch of contiguous DNA nucleotides which enable the oligonucleotide to recruit RNase H. The gap region is flanked by a 5' flanking region (F) comprising one or more sugar modified nucleosides, and by a 3' flanking region (F') comprising one or more sugar modified nucleosides. The one or more sugar modified nucleosides in region F and F' enhance the affinity of the oligonucleotide for the target nucleic acid (i.e. are affinity enhancing sugar modified nucleosides). In some embodiments, the one or more sugar modified nucleosides in region F and F' are 2' sugar modified nucleosides, such as independently selected from LNA and 2'-MOE. In a gapmer design, the 5' and 3' most nucleosides of the gap region are DNA nucleosides, and are positioned adjacent to a sugar modified nucleoside of the 5' (F) or 3' (F') region respectively. The flanks may further be defined by having at least one sugar modified nucleoside at the end most distant from the gap region, i.e. at the 5' end of the 5' flank and at the 3' end of the 3' flank. Regions F-G-F' form a contiguous nucleotide sequence. Antisense oligonucleotides of the invention, or the contiguous nucleotide sequence thereof, may comprise a gapmer region of formula F- G-F'.ASOs can also modulate gene expression by steric hindrance or occupancy-only mechanisms. Steric block oligonucleotides are designed to bind to target transcripts with high affinity but do not induce target transcript degradation as they lack RNase H competence. Such oligonucleotides therefore comprise either nucleotides that do not form RNase H substrates when paired with RNA or a mixture of nucleotide chemistries such that runs of consecutive DNA-like bases are avoided. Steric block oligonucleotides can mask specific sequences within a target transcript and thereby interfere with transcript RNA-RNA and / or RNA-protein interactions. The most widely used application of steric block ASOs is in the modulation of alternative splicing in order to selectively exclude or retain a specific exon(s) in order to disrupt the translation of the target gene. ASOs can also be designed to interfere with maturation and stability of the RNA transcript or to block its interaction with the translation apparatus.In case the ASO can enter the nucleus, mRNA maturation can be modulated by inhibition of 5' cap formation, inhibition of mRNA splicing or activation of RNaseH (Chan et al 2006 Clin Exp Pharmacol Physiol 33:533-540; this reference also describes some of the software available for assisting in design of ASOs).RNAi using duplex silencersIn some aspects, the inhibitor of the present disclosure is an oligonucleotide, more particularly the antisense portion of an RNAi duplex (double stranded RNA). RNA interference (RNAi) is a mechanism by which double-stranded RNA triggers the loss of a homologous RNA molecule. Short interfering RNA (siRNA) molecules are the effector molecules of RNAi and classically consist of a duplex of RNA molecules with a length of 21 nucleotides, i.e. 19 complementary bases and 2 terminal 3' overhangs. One of the strands of the siRNA (the guide or antisense strand) is complementary to a target transcript, whereas the other strand is designated the passenger or sense strand. siRNAs act to guide the Argonaute2 protein (AGO2), as part of the RNA-induced silencing complex (RISC), to complementary target transcripts. Complete complementarity between the siRNA and the target transcript results in cleavage of the target opposite position of the guide strand, catalysed by AGO2, leading to gene silencing.In an siRNA, the sense strand meets the formal definition of a drug delivery device: it is non-covalently bound, enhances the stability of the antisense strand and must be removed by the Ago2 loading complex before the pharmacophore, the antisense strand, is active.Numerous variations of the archetypal siRNA design have been developed in terms of reduced passenger strand activity and / or improved potency. These include Dicer substrate siRNAs, small internally segmented siRNAs, self-delivering siRNAs (asymmetric and hydrophobic), single-stranded siRNAs and divalent siRNAs.In some aspects, the inhibitor of the present disclosure is the antisense portion of a shRNA. Short hairpin RNAs (shRNAs) are artificial RNA molecules that are transcribed as a single stranded RNA but because of internal complementarity form a loop or hairpin-like structure. The hairpin is subsequently processed to an siRNA and also leads to the degradation of mRNAs in a sequence-specific manner dependent upon complementary binding of the target mRNA. shRNAs are slightly larger than siRNA molecules and, unlike siRNAs, are produced inside the cell in the nucleus.Other non-limiting examples of RNAi-mediated duplex silencers are miRNAs and di-siRNAs. microRNAs (miRNAs) are endogenous non-coding RNA molecules that trigger RNAi and that have been implicated in a multitude of physiological and pathophysiological processes. miRNA hairpins embedded within long primary miRNA transcripts are sequentially processed by two RNase III family enzymes, DICER1 (Dicer) and DROSHA, which liberate the hairpin and then cleave the loop sequence, respectively. The resultingduplex RNA is analogous to an siRNA and is then loaded into an Argonaute protein (for example, AG02) while one strand is discarded to generate the mature, single-stranded miRNA species. As with siRNAs, miRNAs guide RISC to target sequences where they initiate gene silencing. In contrast with siRNAs, miRNAs typically bind with partial complementarity and induce silencing via slicer-independent mechanisms.In some aspects, the inhibitor of the present disclosure is a di-siRNA. Divalent siRNAs (di-siRNAs) are recently developed RNA silencing agent alternatives and have been shown to support a potent, sustained gene silencing in the central nervous system of mice and non-human primates following a single injection into the cerebrospinal fluid (Alterman et al 2019 Nature Biotech 37, 884-894). Di-siRNAs are composed of two fully chemically modified, phosphorothioate-containing siRNAs connected by a linker.Nucleic acid molecules inhibiting the expression of one or more targets of the applicationIn one embodiment, the inhibitors herein disclosed are oligonucleotides of between 10 and 50 nucleotides in length and composed of 1 or 2 oligonucleotides.In some embodiments, the nucleic acid molecules of the invention comprise or consist of 8 to 70 nucleotides in length, 10 to 60 nucleotides in length, 12 to 50 nucleotides in length, 8 to 40 nucleotides in length, or from 9 to 35, from 10 to 30, from 11 to 22, from 12 to 20, from 13 to 18 or from 14 to 16 contiguous nucleotides in length. In some aspects, the nucleic acid molecule of the invention is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 nucleotides in length.The term "contiguous nucleotides" or "contiguous nucleotide sequence" as used herein refers to the uninterrupted region of the oligonucleotide which is complementary to the target nucleic acid.In some embodiments, the nucleic acid molecule described herein or the contiguous nucleotide sequence thereof comprises or consists of 24 or less nucleotides, such as 22 or less nucleotides, such as 20 or less nucleotides, such as 18 or less nucleotides, such as 14, 15, 16 or 17 nucleotides. It is to be understood that any range given herein includes the range endpoints. Accordingly, if a nucleic acid molecule is said to include from 10 to 30 nucleotides, both 10 and 30 nucleotides are included. In some embodiments, the contiguous nucleotide sequence comprises or consists of 8, 9, 10, 11, 12, 13, 14, 15,16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 contiguous nucleotides in length. In some embodiments, the nucleic acid molecule of the invention is 14 nucleotides in length. In some embodiments, the nucleic acid molecule of the invention is 15 nucleotides in length. In some embodiments, the nucleic acid molecule of the invention is 16 nucleotides in length. In some embodiments, the nucleic acid molecule of the invention is 17 nucleotides in length. In someembodiments, the nucleic acid molecule of the invention is 18 nucleotides in length. In some embodiments, the nucleic acid molecule of the invention is 19 nucleotides in length. In some embodiments, the nucleic acid molecule of the invention is 20 nucleotides in length.The nucleic acid molecule(s) is typically for modulating the expression of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLODS, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X or NLGN4Y as target nucleic acid in a mammal. In some embodiments the nucleic acid molecule(s), such as siRNAs, shRNAs or antisense oligonucleotides, is typically for inhibiting the expression of a target nucleic acid.In one embodiment, the nucleic acid molecule(s) or the oligonucleotide(s) of the invention is man-made and / or is chemically synthesized and / or is typically purified or isolated. Accordingly, the present disclosure provides a method of manufacturing the nucleic acid molecule(s) or the oligonucleotide(s) of the invention comprising chemically synthesizing the nucleic acid molecule(s) or the oligonucleotide(s) of the invention. In some aspects, the method comprises the conjugation of a delivery moiety, e.g., a GalNAc moiety.The skilled person is aware of how to design the oligonucleotides disclosed herein. siRNA and shRNA design programs are publicly available. Non-limiting examples are siDESIGN from ThermoScientific, siDirect (Naito et al), BLOCK-IT RNAi Designer from Invitrogen, siRNA Wizard from InvivoGen, shRNA design tool from Gene Link and shRNA design tool from transomic. Manufacturers of RNAi products also provide guidelines for designing siRNA / shRNA. siRNA sequences between 19-29 nucleotides (nt) are generally the most effective. Sequences longer than 30 nt can result in nonspecific silencing. Ideal sites to target include AA dinucleotides and the 19 nt 3' of them in the target mRNA sequence. Typically, siRNAs with 3' dlldll or dTdT dinucleotide overhangs are more effective. Other dinucleotide overhangs could maintain activity but GG overhangs should be avoided. Also to be avoided are siRNA designs with a 4-6 poly(T) tract (acting as a termination signal for RNA pol III), and the G / C content is advised to be between 35-55%. shRNAs should comprise sense and antisense sequences (advised to each be 19-21 nt in length) separated by loop structure, and a 3' AAAA overhang. Effective loop structures are suggested to be 3-9 nt in length. It is suggested to follow the sense-loop-antisense order in designing the shRNA cassette and to avoid 5' overhangs in the shRNA construct. Finally, several companies commercially offer premade siRNAs and shRNAs.Chemical modificationsIn some aspects, the inhibitor of the present disclosure is an oligonucleotide comprising non-naturally occurring nucleotide analogues, e.g., nucleotides which have modified sugar moieties, such as bicyclic nucleotides or 2' modified nucleotides, such as 2' substituted nucleotides. An essential step in the evolution of the antisense technology was the creation, innovation and evaluation of the medicinal chemistry of oligonucleotides. The goals were to enhance the affinity for the target sequence (thereby increasing potency), assure effective distribution to peripheral tissues, enhance the duration of action by increasing resistance to degradation by nucleases, improve pharmacokinetic characteristics, reduce the class generic (chemically based) toxicities of the chemical classes widely used for therapeutics, and create designs that support multiple post-binding mechanisms, thereby broadening the utility of the technology.Within the antisense field a broad effort was initiated to modify essentially every position in a dinucleotide except those required for Watson-Crick base pairing. Thousands of analogues have been synthesized and evaluated so far, and novel analogues continue to be investigated. Three major classes of modifications can be distinguished: modifications of the internucleotide linkage, alterations of the ribose sugar and bioconjugations with for example GalNAc.PhosphorothioatesIn some embodiments, the oligonucleotides of the present disclosure comprise one or more non- cleavable internucleotide linkages, e.g., phosphorothioate linkages. The phosphodiester backbone of unmodified DNA and RNA oligonucleotides is highly susceptible to degradation by nucleases in vivo. So, to develop oligonucleotides for therapeutic applications, it was necessary to identify backbone modifications that reduce their susceptibility to nuclease degradation while not compromising other key characteristics such as RNase Hl activation and RNA binding too much.In phosphorothioate (PS) linkages, a non-bridging oxygen in the phosphate group is substituted by sulfur. The PS moiety provides significant protection against nucleases. Importantly, because of the impact of the greater size of sulfur compared with oxygen, the negative charge of the PS moiety at physiological pH is more widely distributed than in a phosphodiester (PO) moiety. This increases the lipophilicity of oligonucleotides that contain PS moieties, facilitating binding to proteins and thereby preventing rapid excretion of the oligonucleotides by the kidney and facilitating uptake of oligonucleotides into cells and tissues. The PS moiety is the most widely used backbone modification in ASOs and siRNAs.Ribose sugar modificationsIn some embodiments, the oligonucleotides of the present disclosure comprise non-naturally occurring nucleotide analogues, e.g., nucleotides which have modified sugar moieties, such as bicyclic nucleotidesor 2' modified nucleotides, such as 2' substituted nucleotides. Oligonucleotides are frequently modified at the ribose sugar, primarily with the aim of improving properties such as affinity and / or nuclease resistance. Such modifications include those where the ribose ring structure is modified (e.g. locked nucleic acids or LNAs), where the sugar moiety is replaced by a non-sugar moiety (e.g. peptide nucleic acids or PNAs) or where the substituent groups on the ribose ring are altered to groups other than the hydrogen or 2' -OH group naturally found in DNA and RNA nucleosides.Non-limiting examples of ring structure modifications are HNAs where ribose ring is replaced with a hexose ring, an UNA (unlocked nucleic acid) where an unlinked ribose ring lacks a bond between the C2 and C3 carbons or a Locked Nucleic Acid (LNA) where the C2' and C4' of the ribose sugar ring are linked by a methylene bridge (also referred to as a"2'-4' bridge"), which restricts or locks the conformation of the ribose ring. The locking of the conformation of the ribose (also referred to as Bridged Nucleic Acids or BNAs) is associated with an enhanced affinity of hybridization (duplex stabilization) when the LNA is incorporated into an oligonucleotide for a complementary RNA or DNA molecule. Non limiting examples of LNA nucleosides are beta-D-oxy-LNA, 6'-methyl-beta-D-oxy LNA such as (S)-6'- methyl-beta-D-oxy- LNA (ScET) and 2'-O,4'-C-ethylene-bridged nucleic acid (ENA) or those disclosed in WO 1999 / 014226, WO 2000 / 66604, WO 1998 / 039352, WO 2004 / 046160, WO 2000 / 047599, WO 2007 / 134181 , WO 2010 / 077578, WO 2010 / 036698, WO 2007 / 090071 , WO 2009 / 006478, WO 2011 / 156202, WO 2008 / 154401 , WO 2009 / 067647, WO 2008 / 150729.Since BN A modifications enhance both nuclease stability and the affinity of the oligonucleotide for target RNA, they have been incorporated into the flanking regions of gapmers to improve target binding. As such, cEt-flanking 3-10-3 gapmers are more efficacious than the MOE 5-10-5 equivalents. Importantly, BNAs are excluded from the DNA gap region because they are not compatible with RNase H-mediated cleavage. LNA modifications have also been utilized in steric block ASOs, such as miRNA inhibitors.Non-limiting examples of 2' substituted modified nucleosides are 2'-O-alkyl-RNA, 2'-O-methyl-RNA (2'- OMe), 2'-alkoxy-RNA, 2'-O-methoxyethyl- RNA (MOE), 2'-amino-DNA, 2'-Fluoro-RNA (2'-F), and 2'-F-ANA nucleoside. These modifications increase oligonucleotide nuclease resistance by replacing the nucleophilic 2'-hydroxyl group of unmodified RNA, leading to improved stability in plasma, increased tissue half-lives and consequently prolonged drug effects. These modifications also enhance the binding affinity of the oligonucleotide for complementary RNA and some 2' modifications reduce pro- inflammatory effects. The 2'-ribose modifications are not compatible with RNase H activity, meaning they are typically used for steric block oligonucleotides, or for the flanking sequences in gapmer ASOs. Although most effort was done in modifying the 2' position, substituents can be introduced at the 3', 4' or 5' positions as well.The present disclosure provides oligonucleotides comprising or consisting of a simple sequence of natural occurring nucleotides - preferably 2'-deoxynucleotides (referred here generally as "DNA"), butalso possibly ribonucleotides (referred here generally as "RNA"), or a combination of such naturally occurring nucleotides and one or more non-naturally occurring nucleotides, i.e., "nucleotide analogues", such as nucleotides having the ribose sugar modifications disclosed above.In some embodiments, the oligonucleotide of the present disclosure comprises at least two nucleotide analogues. In some embodiments, the oligonucleotide of the present disclosure comprises from 3, 4, 5, 6, 7, or 8 nucleotide analogues, e.g. 6 or 7 nucleotide analogues. In some embodiments, all the nucleotide analogues are the same. In some embodiments, some nucleotide analogs are different. In some embodiments, all the nucleotides in the oligonucleotide of the present disclosure are nucleotide analogues. In some embodiments, when all the nucleotides in the oligonucleotide of the present disclosure are nucleotide analogues, all the nucleotide analogues are the same. In some embodiments, when all the nucleotides in the oligonucleotide of the present disclosure are nucleotide analogues, some of the nucleotide analogues are different.ConjugationIn some embodiments, the oligonucleotide of the present disclosure is a conjugate, e.g., a GalNAc conjugate. The delivery potential of ASOs and siRNAs can be enhanced through direct covalent conjugation of various moieties that promote intracellular uptake, target the drug to specific cells / tissues or reduce clearance from the circulation. Non-limiting examples are lipids, peptides, aptamers, antibodies and sugars. Bioconjugates constitute distinct, homogeneous, single-component molecular entities with precise stoichiometry, meaning that high-scale synthesis is relatively simple and their pharmacokinetic properties are well defined. Furthermore, bioconjugates are typically of small size meaning that they generally exhibit favourable biodistribution profiles. For example, conjugating ASOs or siRNAs to the sugar moiety GalNAc results in more productive delivery to hepatocytes without a meaningful shift in distribution to other tissues and results in 15-30 fold increases in potency for RNA targets in those cells.ASOs and siRNAs can also be loaded to exosomes. Exosomes are heterogeneous, lipid bilayer- encapsulated vesicles approximately 100 nm in diameter that are generated as a result of the inward budding of the multivesicular bodies. Exosomes are thought to be released into the extracellular space by all cells, where they facilitate intercellular communication via the transfer of their complex macromolecular cargoes. Exosomes present numerous favourable properties in terms of oligonucleotide drug delivery of which crossing biological membranes, such as the blood-brain-barrier (BBB) is highly relevant for treatments of CNS disorders.Other inhibitorsBesides the use of the inhibitory RNA technology, modulation of expression of a gene of interest can be achieved at DNA level such as by gene therapy to knock-out or disrupt the target gene. As used herein, a "gene knock-out" can be a gene knockdown or the gene can be knocked out by a mutation such as, a point mutation, an insertion, a deletion, a frameshift, or a missense mutation by techniques such as described hereafter, including, but not limited to, retroviral gene transfer. Another way in which genes can be knocked out is by the use of zinc finger nucleases. Zinc-finger nucleases (ZFNs) are artificial restriction enzymes generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain. Zinc finger domains can be engineered to target desired DNA sequences, which enable zinc-finger nucleases to target unique sequence within a complex genome. By taking advantage of the endogenous DNA repair machinery, these reagents can be used to precisely alter the genomes of higher organisms. Other technologies for genome customization that can be used to knock out genes are meganucleases and TAL effector nucleases (TALENs, Cellectis bioresearch). A TALEN is composed of a TALE DNA binding domain for sequence-specific recognition fused to the catalytic domain of an endonuclease that introduces double strand breaks (DSB). The DNA binding domain of a TALEN is capable of targeting with high precision a large recognition site (for instance 17bp). Meganucleases are sequence-specific endonucleases, naturally occurring "DNA scissors", originating from a variety of single-celled organisms such as bacteria, yeast, algae and some plant organelles. Meganucleases have long recognition sites of between 12 and 30 base pairs. The recognition site of natural meganucleases can be modified in order to target native genomic DNA sequences (such as endogenous genes). Another recent genome editing technology is the CRISPR / Cas system, which can be used to achieve RNA-guided genome engineering. CRISPR interference is a genetic technique which allows for sequence-specific control of gene expression in prokaryotic and eukaryotic cells. It is based on the bacterial immune system-derived CRISPR (clustered regularly interspaced palindromic repeats) pathway. Recently, it was demonstrated that the CRISPR-Cas editing system can also be used to target RNA. It has been shown that the Class 2 type Vl-A CRISPR-Cas effector C2c2 can be programmed to cleave single stranded RNA targets carrying complementary protospacers (Abudayyeh et al 2016 Science 353 / science.aaf5573). C2c2 is a single-effector endoRNase mediating ssRNA cleavage once it has been guided by a single crRNA guide toward the target RNA. Hence, the invention disclosed herein can also be applied to develop gRNAs specifically reducing the expression of any of the genes selected from the listed consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLODS, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X, NLGN4Y, HSP90AB1, HSP90AA1, TRPM3, TRPM1, TRPM7, TRPM6, SLC8A1, SLC8A2, SLC8A3, DPP10, RYR1, RYR2, RYR3, GRIA1, GRIA2, GRIA3, GRIA4, CALM1, CALM2, CALM3, NLGN1, NLGN2 and NLGN3, more particular consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANKS, PLOD1, PLOD2, PLODS, FARP1, FARP2, POSTN, TGFBI, TRMP9B,ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGL0N5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X and NLGN4Y using the CRISPR / Cas system. Therefore, the application also provides that any of the oligonucleotides herein provided is a gRNA or CRISPR gRNA, more particularly a gRNA or CRISPR gRNA is provided with at least 90%, at least 95% or 100% complementary to a region within a sequence selected from SEQ. ID No. 1-372, particularly SEQ ID No. 51-63, 64-68, 69-72, 73-81, 82-88, 96-98, 99-112, 89-95, 162-170, 153-161, 171-176, 177-184, 211-215, 216-221, 222-229, 230-232, 233-243, 244-246, 320, 321-325, 326-336, 311-319, 303-310, 337-343, 365-372, 373-378 or 379-382.Ribozymes (ribonucleic acid enzymes) are another type of molecules that can be used to modulate expression of a target gene. They are RNA molecules capable of catalyzing specific biochemical reactions, in the current context capable of targeted cleavage of nucleotide sequences. Examples of ribozymes include the hammerhead ribozyme, the Varkud Satellite ribozyme, Leadzyme and the hairpin ribozyme.As indicated above, inhibition of any of the genes selected from the list consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X, NLGN4Y, HSP90AB1, HSP90AA1, TRPM3, TRPM1, TRPM7, TRPM6, SLC8A1, SLC8A2, SLC8A3, DPP10, RYR1, RYR2, RYR3, GRIA1, GRIA2, GRIA3, GRIA4, CALM1, CALM2, CALM3, NLGN1, NLGN2 and NLGN3, particularly selected from MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X or NLGN4Y may also be obtained at the functional level by interfering with the protein's function or structure. Interfering with structure, which can also result in inhibition of function, can be achieved by e.g. binding moieties that shield e.g. the binding site on the protein of interest for a ligand of interest. Non-limiting examples are (monoclonal) antibodies or antigenbinding fragments thereof, alpha-bodies, nanobodies, intrabodies (antibodies binding and / or acting to intracellular target; this typically requires the expression of the antibody within the target cell, which can be accomplished by gene therapy), aptamers, DARPins, affibodies, affitins, anticalins, monobodies, phosphatases (in case of phosphorylated target) and kinases (in case of a phosphorylatable target).The term "antibody" as used herein refers to any naturally occurring format of antibody or antigenbinding protein the production of which is induced by an immune system (immunoglobulins or IgGs). It is clear, however, that not all antibodies are naturally occurring as e.g. some antigens are problematic in the sense that they are poor or not at all immunogenic, or are not recognized by the immune system (e.g. self-antigens); artificial tricks may be required to obtain antibodies against such antigens (e.g. knock-out mice: e.g. Declercq et al. 1995, J Biol Chem 270:8397-8400; DNA immunization for e.g.transmembrane antigens; e.g. Liu et al. 2016, Emerg Microbes Infect 5:e33). "Conventional" antibodies comprise two heavy chains linked together by disulfide bonds and two light chains, one light chain being linked to each of the heavy chains by disulfide bonds. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains (three or four constant domains, CHI, CH2, CH3 and CH4, depending on the antibody class). Each light chain has a variable domain (VL) at one end and a constant domain (CL) at its other end; the constant domains of the light chains each align with the first constant domains of the heavy chains, and the light chain variable domains each align with the variable domains of the heavy chains. This type of antibodies exist in camels, dromedaries and llamas along with an "unconventional" naturally occurring type of antibodies consisting of only two heavy chains, and thus being devoid of light chains. Other "unconventional" naturally occurring antibodies exist in in the serum of nurse sharks (Ginglymostomatidae) and wobbegong sharks (Orectolobidae). These latter antibodies are called Ig new antigen receptors (IgNARs). They are disulfide-bonded homodimers consisting of five constant domains (CNAR) and one variable domain (VNAR). There is no light chain, and the individual variable domains are independent in solution and do not appear to associate across a hydrophobic interface (Greenberg et al. 1995, Nature 374, 168- 173; Nuttall et al. 2001, Mol Immunol 38, 313-326; Diaz et al. 2002, Immunogenetics 54, 501- 512; Nuttall et al. 2003, Eur J Biochem 270, 3543-3554). Due to the heavy chain dimer structure characteristic of camelid and shark antibodies, these are sometimes termed "Heavy-Chain Mini-Antibodies" (mnHCAbs) or simply "Mini- Antibodies" (mnAbs) (Holliger & Hudson 2005, Nature Biotechnol 23, 1 126-1136). The complementary determining region 3 (CDR3) of camel antibodies and shark antibodies is usually longer (comprising about 16-21 amino acids, and about 16-27 amino acids, respectively) than the CDR3 of mouse VH region (comprising about 9 amino acids) (Muyldermans et al. 1994, Prot Eng 7, 1129-1135; Dooley & Flajnik 2005, Eur J Immunol 35, 936-945). Without the light chain, these heavy-chain antibodies bind to their antigens by one single domain, the variable antigen binding domain of the heavy-chain immunoglobulin, referred to as Vab (camelid antibodies) or V-NAR (shark antibodies). These smallest intact and independently functional antigenbinding fragment Vab is referred to as nano-antibody or nanobody (Muyldermans 2001, J Biotechnol 74, 277-302). Multivalent (etc. divalent, trivalent, tetravalent and pentavalent) Vab and / or V-NAR domains may be preferred in some instances due to their potentially higher cellular intake and retention and may be made by recombinant technology or by chemical means, such as described in WO 2010 / 033913. The variable domains of the light and / or heavy chains are involved directly in binding the antibody to the antigen. The variable domains of naturally occurring light and heavy chains have the same general structure: four framework regions (FRs) connected by three complementarity determining regions (CDRs) (see e.g. Kabat et al. 1991, Sequences of Proteins of Immunological Interest, 5 thEd. Public Health Service, National Institutes of Health, Bethesda, MD). The CDRs in a light or heavy chain are held in close proximity by the FRs and contribute to the formation of the antigen binding site. An antibody, or antibodyfragment as described hereafter, may also be part of a multivalent and / or multispecific antigen binding molecule. An overview of e.g. available bispecific formats (around 100) is provided in Brinkmann & Kontermann 2017 (mAbs 9:182-212).The term "antibody fragment" refers to any molecule comprising one or more fragments (usually one or more CDRs) of an antibody (the parent antibody) such that it binds to the same antigen to which the parent antibody binds. Antibody fragments include Fv, Fab, Fab', Fab'-SH, single-chain antibody molecules (such as scFv), F(ab') 2, single variable VH domains, and single variable VL domains (Holliger & Hudson 2005, Nature Biotechnol 23, 1126-1136), Vab and V-NAR. The term further includes microantibodies, i.e. the minimum recognition unit of a parent antibody usually comprising just one CDR (Heap et al. 2005, J Gen Virol 86, 1791-1800). Any of the fragments can be incorporated in a multivalent and / or multispecific larger molecule, e.g. mono- or bi-specific Fab 2, mono- or tri-specific Fab 3, bis-scFv (mono- or bispecific), diabodies (mono- or bispecific), triabodies (e.g. trivalent monospecific), tetrabodies (e.g. tetravalent monospecific), minibodies and the like (Holliger & Hudson 2005, Nature Biotechnol 23, 1 126-1136). Any of the fragments can further be incorporated in e.g. V-NAR domains of shark antibodies or VhH domains of camelid antibodies (nanobodies). All these are included in the term "antibody fragment".Alphabodies are also known as Cell-Penetrating Alphabodies and are small 10 kDa proteins engineered to bind to a variety of antigens.Aptamers have been selected against small molecules, toxins, peptides, proteins, viruses, bacteria, and even against whole cells. DNA / RNA / XNA aptamers are single stranded and typically around 15-60 nucleotides in length although longer sequences of 220 nt have been selected; they can contain nonnatural nucleotides (XNA) as described for antisense RNA. A nucleotide aptamer binding to the vascular endothelial growth factor (VEGF) was approved by FDA for treatment of macular degeneration. Variants of RNA aptamers are spiegelmers are composed entirely of an unnatural L-ribonucleic acid backbone. A Spiegelmer of the same sequence has the same binding properties of the corresponding RNA aptamer, except it binds to the mirror image of its target molecule. Peptide aptamers consist of one (or more) short variable peptide domains, attached at both ends to a protein scaffold, e.g. the Affimer scaffold based on the cystatin protein fold. A further variation is described in e.g. WO 2004 / 077062 wherein e.g. 2 peptide loops are attached to an organic scaffold. Phage-display screening of such peptides has proven to be possible in e.g. WO 2009 / 098450.DARPins stands for designed ankyrin repeat proteins. DARPin libraries with randomized potential target interaction residues, with diversities of over 1012variants, have been generated at the DNA level. From these, DARPins can be selected for binding to a target of choice with picomolar affinity and specificity.Affitins, or nanofitins, are artificial proteins structurally derived from the DNA binding protein Sac7d, found in Sulfolobus acidocaldarius. By randomizing the amino acids on the binding surface of Sac7d and subjecting the resulting protein library to rounds of ribosome display, the affinity can be directed towards various targets, such as peptides, proteins, viruses, and bacteria.Anticalins are derived from human lipocalins which are a family of naturally binding proteins and mutation of amino acids at the binding site allows for changing the affinity and selectivity towards a target of interest. They have better tissue penetration than antibodies and are stable at temperatures up to 70 °C.Monobodies are synthetic binding proteins that are constructed starting from the fibronectin type III domain (FN3) as a molecular scaffold.Based on the above, the inhibitors of the application for use (in a method) according to the invention can be defined as those inhibitors specific to any of the genes selected from the list consisting of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X, NLGN4Y, HSP90AB1, HSP90AA1, TRPM3, TRPM1, TRPM7, TRPM6, SLC8A1, SLC8A2, SLC8A3, DPP10, RYR1, RYR2, RYR3, GRIA1, GRIA2, GRIA3, GRIA4, CALM1, CALM2, CALM3, NLGN1, NLGN2 and NLGN3 or selected from MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALMS, SLC38A11, SLC38A2, NLGN4X or NLGN4Y, including those inhibitor modalities selected from the group consisting of an antisense oligonucleotide, a gapmer, a siRNA, a shRNA, an antisense oligonucleotide, a zinc-finger nuclease, a meganuclease, a TAL effector nuclease, a CRISPR-Cas effector, an antibody or a fragment thereof binding to synaptogyrin-3, an alpha-body, a nanobody, an intrabody, an aptamer, a DARPin, an affibody, an affitin, an anticalin, and a monobody.Pharmaceutical saltThe nucleic acid molecules or oligonucleotides according to the present invention may exist in the form of their pharmaceutically acceptable salts. The term "pharmaceutically acceptable salt" refers to conventional acid-addition salts or base-addition salts that retain the biological effectiveness andproperties of the nucleic acid molecules or oligonucleotides of the present invention and are formed from suitable non-toxic organic or inorganic acids or organic or inorganic bases. Acid-addition salts include for example those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid and nitric acid, and those derived from organic acids such as p-toluene sulfonic acid, salicylic acid, methane sulfonic acid, oxalic acid, succinic acid, citric acid, malic acid, lactic acid, fumaric acid, and the like. Base-addition salts include those derived from ammonium, potassium, sodium and, quaternary ammonium hydroxides, such as for example, tetramethyl ammonium hydroxide. The chemical modification of a pharmaceutical compound into a salt is a technique well known to pharmaceutical chemists in order to obtain improved physical and chemical stability, hygroscopicity, flowability and solubility of compounds. It is for example described by Bastin (2000 Organic Process Research & Development 4:427-435) or in Ansel (1995 In: Pharmaceutical Dosage Forms and Drug Delivery Systems, 6th ed., pp. 196 and 1456-1457). For example, the pharmaceutically acceptable salt of the nucleic acid molecules or oligonucleotides provided herein may be a sodium salt. Provided herein is a pharmaceutically acceptable salt of the nucleic acid molecules or oligonucleotides described herein. In one embodiment, the pharmaceutically acceptable salt is a sodium or a potassium salt.Pharmaceutical CompositionIn another aspect, the invention provides pharmaceutical compositions comprising any of the nucleic acid molecules or oligonucleotides described herein or salts thereof and a pharmaceutically acceptable diluent, carrier, salt and / or adjuvant. A pharmaceutically acceptable diluent includes phosphate- buffered saline (PBS) and pharmaceutically acceptable salts include, but are not limited to sodium and potassium salts. In some embodiments the pharmaceutically acceptable diluent is sterile phosphate buffered saline. In some embodiments the nucleic acid molecules or oligonucleotides of the application are used in the pharmaceutically acceptable diluent at a concentration of 1-100 nanomolar (nM), 2- 50 nm, 5-150 nM, 10-250 nM, 25-500 nM, 50-750 nM, 0.1-1 micromolar (pM), 0.5-10 pM, 2-50 pM, 5- 250 pM or 10-500 pM solution.Suitable formulations for use in the present invention are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985. For a brief review of methods for drug delivery, see e.g. Langer (1990 Science 249:1527-1533). Non-limiting examples of pharmaceutically acceptable diluents, carriers, adjuvants, suitable dosages, formulations, administration routes, compositions, dosage forms, combinations with other therapeutic agents, pro-drug formulations are provided in W02007 / 031091. The nucleic acid molecules or oligonucleotides of the application or salts thereof may be mixed with pharmaceutically acceptable active or inert substances for the preparation of pharmaceutical compositions or formulations. Compositions and methods for the formulation ofpharmaceutical compositions are dependent upon a number of criteria, including but not limited to route of administration, extent of disease, or dose to be administered. Pharmaceutical compositions comprising any of the nucleic acid molecules or oligonucleotides of the application or salts thereof may be sterilized by conventional sterilization techniques or may be sterile filtered. The resulting aqueous solutions may be packaged for use as is or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.The pH of the preparations typically will be between 3 and 11, more particularly between 5 and 9 or between 6 and 8, most particularly between 7 and 8, such as 7 to 7.5. The resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the nucleic acid molecules or oligonucleotides of the application or salts thereof, such as in a sealed package of tablets or capsules. The composition in solid form can also be packaged in a container for a flexible quantity.Tauopathic disordersTauopathies are a diverse group of disorders all having in common their association with prominent accumulation of intracellular tau protein. The tau protein is abundantly expressed in the central nervous system. The group of tauopathies is growing as recently Huntington disease (Fernandez-Nogales et al 2014 Nat Med 20:881-885) and chronic traumatic encephalopathy (CTE; McKee et al 2009 J Neuropathol Exp Neurol 68,709-735) were added.Different classifications of tauopathies exist. In one classification system, tauopathic disorders are divided in predominant Tau pathologies, tauopathies associated with amyloid deposition and tauopathies associated with another pathology (Williams et al 2006 Intern Med J 36:652-660). Predominant Tau pathologies include progressive supranuclear palsy (PSP), progressive supranuclear palsy-parkinsonism (PSP-P), Richardson's syndrome, argyrophilic grain disease, corticobasal degeneration, Pick's disease, frontotemporal dementia with parkinsonism associated with chromosome 17 (FTDP-17), post-encephalitic parkinsonism, Parkinson's disease complex of Guam, and Guadeloupean parkinsonism. Tauopathic disorders associated with amyloid deposition include Alzheimer's disease, Down's syndrome, dementia pugilistica, familial British dementia and familial Danish dementia. Tauopathic disorders associated with another pathology include myotonic dystrophy, Hallevorden-Spatz disease, and Niemann Pick type C.Another classification is based on the isoform type found in the aggregates although overlaps may exist: 4R tauopathies include progressive supranuclear palsy (PSP), corticobasal degeneration, tangle predominant dementia, and argyrophilic grain disease. 3R tauopathies include Pick disease, and 3R+4R tauopathies include Alzheimer's disease (Dickson et al 2011 J Mol Neurosci 45:384-389; Murray et al 2014 Alzheimer's Res Ther 6:1). The tau protein is discussed herein in more detail further below.Further tauopathies include tangle-only dementia, white matter tauopathy with globular glial inclusions, subacute sclerosing panencephalitis, SLC9A6-related mental retardation, non-Guamanian motor neuron disease with neurofibrillary tangles, neurodegeneration with brain iron accumulation, Gerstmann- Straussler-Scheinker disease, frontotemporal lobar degeneration, diffuse neurofibrillary tangles with calcification, chronic traumatic encephalopathy, amyotrophic lateral sclerosis of Guam, amyotrophic lateral sclerosis and parkinsonism-dementia complex, prion protein cerebral amyloid angiopathy, and progressive subcortical gliosis (Murray et al 2014 Alzheimer's Res Ther 6:1; Spillantini & Goedert 2013 Lancet Neurol 12:609-622).Symptoms of tauopathic disorders include clinical or pathological symptoms such as mild cognitive impairment, dementia, cognitive decline (e.g. apathy, impairment in abstract thought), decline of motor function (causing e.g. postural instability, tremor or dystonia), oculomotor and bulbar dysfunction. Criteria for diagnosing dementia are outlined in e.g. the Diagnostic and Statistical Manual of Mental Disorders (DSM) or in the International Classification of Disease (ICD) and are subject to regular updates. The type of clinical symptoms depends on which region of the brain is affected by the tauopathy and explains why Alzheimer's disease is mainly a dementing disease and why Parkinson's disease is mainly affecting movement. Stereotypical temporospatial propagation of tau inclusions creates a consistent pattern of brain lesions in at least Alzheimer's disease and argyrophilic grain disease. The spreading may in part occur in a trans-synaptic manner (Spillantini & Goedert 2013 Lancet Neurol 12:609-622; Liu et al 2012 PloS One 7:e31802). Molecular symptoms of tauopathic disorders include synaptic dysfunction (in particular pre-synaptic dysfunction), neurotoxicity, neuronal degeneration, neuronal dysfunction, synapse loss and amyloid deposition.Any of the inhibitors, nucleic acid molecules or oligonucleotides herein described is applicable for use as a medicament. In one embodiment thereto, any of the nucleic acid molecules or oligonucleotides herein described is provided for use in (a method for) treating or inhibiting progression of a tauopathic disorder or for use in (a method for) treating or inhibiting a symptom of a tauopathic disorder. In particular, the nucleic acid molecules or oligonucleotides of the invention are inhibitors of human MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X, NLGN4Y, HSP90AB1, HSP90AA1, TRPM3, TRPM1, TRPM7, TRPM6, SLC8A1, SLC8A2, SLC8A3, DPP10, RYR1, RYR2, RYR3, GRIA1, GRIA2, GRIA3, GRIA4, CALM1, CALM2, CALM3, NLGN1, NLGN2 or NLGN3 expression.In the methods for treating or inhibiting progression of a tauopathic disorder or a symptom of a tauopathic disorder, any of the nucleic acid molecules or oligonucleotides herein described is administered to a subject in need thereof (a subject suffering of or displaying a tauopathy or symptomthereof) in an effective amount, i.e. in an amount sufficient to treat or to inhibit progression of a tauopathic disorder or a symptom of a tauopathic disorder.For the purpose of treating, preventing or inhibiting (progression of) an intended disease or disorder, and in method for treating, preventing or inhibiting (progression of) an intended disease or disorder, an effective amount of the therapeutic compound is administered to a subject in need thereof. An "effective amount" of an active substance in a composition is the amount of said substance required and sufficient to elicit an adequate response in treating, preventing, inhibiting (progression of) the intended or targeted medical indication. It will be clear to the skilled artisan that such response may require successive (in time) administrations with the composition as part of an administration scheme. The effective amount may vary depending on the nature of the compound, the route of administration of the compound (crossing of the blood-brain barrier and the cell membrane are potential barriers to be taken by oligonucleotides as described herein), the health and physical condition of the individual to be treated, the age of the individual to be treated (e.g. dosing for infants may be lower than for adults) the taxonomic group of the individual to be treated (e.g. human, non-human primate, primate, etc.), the capacity of the individual's system to respond effectively, the degree of the desired response, the formulation of the active substance, the treating doctor's assessment and other relevant factors. The effective amount further may vary depending on whether it is used in monotherapy or in combination therapy. Determination of an effective amount of a compound usually follows from pre-clinical testing in a representative animal or in vitro model (if available) and / or from dose-finding studies in early clinical trials.Any of the inhibitors, nucleic acid molecules or oligonucleotides described herein is provided for use in (a method for) treating or inhibition progression of a tauopathic disorder wherein the tauopathic disorder is selected from the group consisting of Alzheimer's disease, progressive supranuclear palsy (PSP), progressive supranuclear palsy-parkinsonism (PSP-P), Richardson's syndrome, argyrophilic grain disease, corticobasal degeneration Pick's disease, frontotemporal dementia with parkinsonism associated with chromosome 17 (FTDP-17), post-encephalitic parkinsonism, Parkinson's disease complex of Guam, Guadeloupean parkinsonism, Huntington disease, Down's syndrome, dementia pugilistica, familial British dementia, familial Danish dementia, myotonic dystrophy, Hallevorden-Spatz disease, Niemann Pick type C, chronic traumatic encephalopathy, tangle-only dementia, white matter tauopathy with globular glial inclusions, subacute sclerosing panencephalitis, SLC9A6-related mental retardation, non-Guamanian motor neuron disease with neurofibrillary tangles, neurodegeneration with brain iron accumulation, Gerstmann-Straussler-Scheinker disease, frontotemporal lobar degeneration, diffuse neurofibrillary tangles with calcification, chronic traumatic encephalopathy, amyotrophic lateralsclerosis of Guam, amyotrophic lateral sclerosis and parkinsonism-dementia complex, prion protein cerebral amyloid angiopathy, and progressive subcortical gliosis.Any of the inhibitors, nucleic acid molecules or oligonucleotides described herein is thus likewise applicable for use in (a method for) treating or inhibition progression of a symptom of tauopathic disorder selected from the group of mild cognitive impairment, dementia, cognitive decline, decline of motor function, oculomotor and bulbar dysfunction, synaptic dysfunction, neurotoxicity, neuronal degeneration, neuronal dysfunction, synapse loss, and amyloid deposition. In particular, in relation to synaptic dysfunction it concerns pre-synaptic dysfunction.Therapeutic effects of the inhibitors herein disclosed may be obtained at statistically significant levels of inhibition of the expression of the human target. For example, the level of inhibition can be about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 100%. In some, the level of inhibition can be at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.As used herein, the term "reducing", e.g., reducing the expression of the MCTPl gene transcript and / or MCTPl protein level or MCTPl activity refers to the oligonucleotide of the present disclosure (e.g., an ASO or siRNA) disclosed herein reducing the expression of the MCTPl gene transcript and / or MCTPl protein level and / or activity in a cell, a tissue, or a subject.In some aspects, the term "reducing" refers to complete inhibition (100% inhibition or non-detectable level) of the gene transcript or the protein level and / or activity. In other aspects, the term "reducing" refers, e.g., to at least about 25%, to at least about 30%, to at least about 35%, to at least about 40%, to at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least 90%, at least 95% or at least 99% inhibition of the gene transcript and / or the protein expression and / or activity in a cell, a tissue, or a subject.The terms "individual", "subject", "host", and "patient", are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired, particularly humans. The compositions and methods described herein are applicable to both human therapy and veterinary applications. In some aspects, the subject is a mammal, and in other aspects the subject is a human. As used herein, a "mammalian subject" includes all mammals, including without limitation, humans,domestic animals (e.g., dogs, cats and the like), farm animals (e.g., cows, sheep, pigs, horses and the like) and laboratory animals (e.g., monkey, rats, mice, rabbits, guinea pigs and the like).The application also provides methods of treating or inhibiting progression of a symptom of a tauopathic disorder, the method comprises the step of administering any of the nucleic acid molecules or oligonucleotides herein described to a subject in need thereof.In one embodiment, a method of reducing the expression level of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X, NLGN4Y, HSP90AB1, HSP90AA1, TRPM3, TRPM1, TRPM7, TRPM6, SLC8A1, SLC8A2, SLC8A3, DPP10, RYR1, RYR2, RYR3, GRIA1, GRIA2, GRIA3, GRIA4, CALM1, CALM2, CALM3, NLGN1, NLGN2 or NLGN3, particularly of MCTP1, MCTP2, SHANK1, SHANK2, SHANK3, PLOD1, PLOD2, PLOD3, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALM3, SLC38A11, SLC38A2, NLGN4X or NLGN4Y in a subject is provided, comprising the step of administering any of the nucleic acid molecules or oligonucleotides herein described to the subject. In a particular embodiment, the subject is in need for a therapy, more particularly a therapy to treat a tauopathy."Treatment" refers to any rate of reduction or retardation of the progress of the disease or disorder compared to the progress or expected progress of the disease or disorder when left untreated. More desirable, the treatment results in no / zero progress of the disease or disorder (i.e. "inhibition" or "inhibition of progression") or even in any rate of regression of the already developed disease or disorder. Tauopathies are in general progressive disorders, and progression may imply propagation of pathological tau protein (Asai et al 2015 Nat Neurosci 18:1584-1593; deCalignon et al 2012 Neuron 73:685-697)."Reduction" or "reducing" in terms of progress of a disease as used herein refers to a statistically significant reduction. More particularly, a statistically significant reduction upon administering the inhibitor of the invention compared to a control situation wherein the inhibitor is not administered. In a particular embodiment, said statistically significant reduction in progress of a disease is an at least 25%, 30%, 35%, 40%, 45% or 50% reduction compared to the control situation.Diagnosis of tauopathic disordersMagnetic resonance imaging (MRI) in itself allows for radiologic determination of brain atrophy. Midbrain atrophic signs such as the Hummingbird or Penguin silhouette are for instance indicators of progressive supranuclear palsy (PSP). Determination of tau protein content in the cerebrospinal fluid (CSF) may also serve as an indicator of tauopathies. The ratio between the 33 kDa / 55 kDa tau-forms in CSF was e.g. found to be reduced in a patients with PSP (Borroni et al 2008 Neurology 71:1796-1803).Recently, in vivo imaging techniques of neurodegeneration have become available. Such techniques can clearly support the clinical diagnosis of neurodegenerative diseases in general and of tauopathies in particular. In vivo diagnosis of tauopathies benefits from the existence of Tau imaging ligands detectable by positron emission tomography (PET), and include the radiotracers 2-(l-(6-((2-[18F]fluoroethyl) (methyl) amino)-2-naphthyl)ethylidene) malononitrile ([18F]FDDNP), 2-(4-aminophenyl)-6-(2-([18F]fluoroethoxy))quinolone ([18F]THK523), and [18F]T807 and [18F]T808 (Murray et al 2014 Alzheimer's Res Ther 6:1). In addition, MRI can be used to detect tauopathies, and PET imaging with fluorodeoxyglucose (FDG,18F agent) is indicative of synaptic activity (Murray et al 2014 Alzheimer's Res Ther 6:1). Beta-amyloid, that can be detected in vivo, e.g. by using florbetapir (or other amyloid markers) in combination with PET, proved to be an accurate biomarker for at least Alzheimer's disease (Clark et al 2011 J Am Med Assoc 305:275-283) and the florbetapir-PET technique received FDA approval in 2012. The availability of in vivo tauopathy detection techniques is further supportive for selecting subjects that can benefit from synaptogyrin-3 inhibitory therapies as described herein.Administrating the inhibitors of the inventionThe inhibitors, nucleic acid molecules or the oligonucleotides of the present invention may be administered via intravenous, subcutaneous, intramuscular, intracerebral, intracerebroventricular, intraventricular, intraocular, or intrathecal administration. In some embodiments, the administration is via intrathecal administration. "Administering" as used herein, means to give a composition comprising a composition disclosed herein to a subject via a pharmaceutically acceptable route.Inhibition of expression of the target gene, can be also achieved through the creation of transgenic organisms expressing one of the oligonucleotides of the invention (e.g. siRNA), or by administering said inhibitor to the subject. The nature of the inhibitor (siRNA, shRNA, gapmer, etc.) and whether the effect is achieved by incorporating the oligonucleotide into the subject's genome or by administering the inhibitor is not vital to the invention, as long as said oligonucleotide or inhibitor reduces the level of the target transcripts. An oligonucleotide construct can be delivered, for example as an expression plasmid, which when transcribed in the cell, produces the oligonucleotide that is complementary to at least a unique portion of the cellular target RNA. Alternatively, oligonucleotide inhibitors such as siRNA can also be expressed from recombinant circular or linear DNA plasmids using any suitable promoter. Suitable promoters for expressing these inhibitors from a plasmid include, for example the U6 or Hl RNA polymerase III promoter sequences and the cytomegalovirus promoter. Selection of other suitable promoters is within the skill in the art. Non-limiting examples are neuronal-specific promoters, glial cell specific promoters, the human synapsin 1 gene promoter, the Hb9 promotor or the promoters disclosed in US7341847B2.The recombinant plasmids comprising any of the inhibitors, nucleic acid molecules or oligonucleotides of the invention can also comprise inducible or regulatable promoters for expression of the inhibitor, nucleic acid molecule or oligonucleotide in a particular tissue or in a particular intracellular environment. The inhibitor, nucleic acid molecule or oligonucleotide expressed from recombinant plasmids can either be isolated from cultured cell expression systems by standard techniques, or can be expressed intracellularly, e.g. in brain tissue or in neurons. Nucleic acid molecules or oligonucleotides can also be expressed intracellularly from recombinant viral vectors. The recombinant viral vectors comprise sequences encoding the nucleic acid molecules or oligonucleotides of the invention and any suitable promoter for expressing them. The nucleic acid molecules or oligonucleotides will be administered in an "effective amount" which is an amount sufficient to cause a statistically significant reduction of the target transcript. Generally, an effective amount of a nucleic acid molecule or oligonucleotide targeting target transcripts comprises an intracellular concentration of from about 1 nanomolar (nM) to about 100 nM, preferably from about 2 nM to about 50 nM, more preferably from about 2.5 nM to about 10 nM. It is contemplated that greater or lesser amounts of inhibitor can be administered. shRNAs for example can be introduced into the nuclei of target cells using a vector (e.g. bacterial or viral) that optionally can stably integrate into the genome. shRNAs are usually transcribed from vectors, e.g. driven by the Pol III U6 promoter or Hlpromoter. Vectors allow for inducible shRNA expression, e.g. relying on the Tet-on and Tet-off inducible systems commercially available, or on a modified U6 promoter that is induced by the insect hormone ecdysone. A Cre-Lox recombination system has been used to achieve controlled expression in mice. Synthetic shRNAs can be chemically modified to affect their activity and stability. Plasmid DNA or dsRNA can be delivered to a cell by means of transfection (lipid transfection, cationic polymer-based nanoparticles, lipid or cell-penetrating peptide conjugation) or electroporation. Viral vectors include lentiviral, retroviral, adenoviral and adeno-associated viral vectors.Drug administration across blood-brain barrierIn some aspects, the inhibitors of the present disclosure are administered across the blood-brain barrier. The blood-brain barrier (BBB) is a protective layer of tightly joined cells that lines the blood vessels of the brain which prevents entry of harmful substances (e.g. toxins, infectious agents) and restricts entry of (non-lipid) soluble molecules that are not recognized by specific transport carriers into the brain. This poses a challenge in the delivery of drugs, such as the inhibitors described herein, to the central nervous system / brain in that drugs transported by the blood not necessarily will pass the blood-brain barrier. Although the BBB often is to some degree affected or broken down in case of a tauopathic disorder, it may be needed to rely on a means to enhance permeation of the BBB for a candidate drug for treating a tauopathic disorder to be able to enter the affected brain cells. Thus, in some aspects, theoligonucleotides of the present disclose are formulated, conjugated, or carried by vectors, polymers, cells, or devices, to name a few alternatives, that allow the oligonucleotides to cross the BBB. Several options are nowadays available for delivery of drugs across the BBB (Peschillo et al 2016 J Neurointervent Surg 8:1078-1082; Miller & O'Callaghan 2017 Metabolism 69:S3-S7; Drapeau & Fortin 2015 Current Cancer Drug Targets 15:752-768).Drugs can be directly injected into the brain (invasive strategy) or can be directed into the brain after BBB disruption with a pharmacological agent (pharmacologic strategy). In some embodiments, an inhibitor of the present disclosure can be directly injected into the brain, e.g., using a needle or a catheter. In some embodiments, an inhibitor of the present disclosure can be directed into the brain by BBB disruption with a pharmacological agent. Invasive means of BBB disruption are associated with the risk of hemorrhage, infection or damage to diseased and normal brain tissue from the needle or catheter. Direct drug deposition may be improved by the technique of convection-enhanced delivery. Accordingly, in some embodiments, an inhibitor of the present disclosure can be administered via convection- enhanced delivery.Longer term delivery of a therapeutic protein (e.g. a neurotrophic factor or nerve growth factor, or a proteinaceous inhibitor as described herein) can be achieved by implantation of genetically modified stem cells, by recombinant viral vectors, by means of osmotic pumps, or by means of incorporating the therapeutic drug in a polymer (slow release; can be implanted locally). Thus, in some aspects, an inhibitor of the present disclosure can be administered, e.g., by implantation of genetically modified cells (e.g., stem cells), recombinant vectors (e.g., viral vectors), delivery devices (e.g., pumps such as osmotic pumps), or incorporation in a polymer.Pharmacologic BBB disruption has the drawback of being non-selective and can be associated with unwanted effects on blood pressure and the body's fluid balance. This is circumvented by targeted or selective administration of the pharmacologic BBB disrupting agent. As an example, intra-arterial cerebral infusion of an antibody (bevacizumab) in a brain tumor was demonstrated after osmotic disruption of the BBB with mannitol (Boockvar et al. 2011, J Neurosurg 114:624-632); other agents capable of disrupting the BBB pharmacologically include bradykinin and leukotriene C4 (e.g. via intracarotid infusion; Nakano et al. 1996, Cancer Res 56:4027-4031). Thus, in some embodiments, the inhibitors of the present disclosure are formulated in combination with a pharmacologic BBB disrupting agent. In some embodiments, the inhibitors of the present disclosure are administered in combination with a pharmacologic BBB disrupting agent. In some embodiments, the pharmacologic BBB disrupting agent is administered prior to the administration of the inhibitor of the present disclosure. In someembodiments, the pharmacologic BBB disrupting agent is administered concurrently to the administration of the inhibitor of the present disclosure. In some embodiments, the pharmacologic BBB disrupting agent is administered subsequently to the administration of the inhibitor of the present disclosure. In some embodiments, the pharmacologic BBB disrupting agent comprises mannitol, bradykinin, leukotriene C4, or a combination thereof.BBB transcytosis and efflux inhibition are other strategies to increase brain uptake of drugs supplied via the blood. Using transferrin or transferrin-receptor antibodies as carrier of a drug is one example of exploiting a natural BBB transcytosis process (Friden et al. 1996, J Pharmacol Exp Ther 278:1491-1498). Exploiting BBB transcytosis for drug delivery is also known as the molecular Trojan horse strategy. In some embodiments, the inhibitor of the present disclosure are conjugated to carrier, e.g., transferrin or a transferrin-receptor antibody. In some embodiments, the inhibitors of the present disclosure are conjugated or formulated to transverse the BBB via transcytosis. Another mechanism underlying BBB, efflux pumps or ATP-binding cassette (ABC) transporters (such as breast cancer resistance protein (BCRP / ABCG2) and P-glycoprotein (Pgp / MDRl / ABCBl)), can be blocked in order to increase uptake of compounds (e.g. Carcaboso et al. 2010, Cancer Res 70:4499-4508). In some embodiments, the inhibitors of the present disclosure can be formulated in combination with a compound that can block an ABC transporter, a compound that can block P-glycoprotein, or a combination thereof.Kumar et al (2007 Nature 448:39-43) demonstrated uptake of siRNAs in the brain after coupling to a 29- amino acid peptide derived from rabies virus glycoprotein (RVG) which is specifically binding the acetylcholine receptor. In some aspects, the inhibitors of the present disclosure are conjugated to RVG.Therapeutic drugs can alternatively be loaded in liposomes to enhance their crossing of the BBB, an approach also known as liposomal Trojan horse strategy. Thus, in some embodiments, the inhibitors of the present disclosure are formulated in liposomes, e.g., liposomes for use in a liposomal Trojan horse strategy.Especially in the field of treating cognitive and neurodegenerative disorders there has been quite some interest in intranasal delivery of drugs (e.g. Muhs et al. 2007, Proc Natl Acad Sci USA 104:9810-9815; Kao et al. 2000, Pharm Res 17:978-984; Hanson & Frey 2008, BMC Neurosci 9 (Suppl3): 55). This strategy is based on the trigeminal and olfactory nerves that innervate the nasal epithelium, representing direct connections between the external environment and the brain. Thus, in some aspects, the inhibitors of the present disclosure are formulated for intranasal delivery.A more recent and promising avenue for delivering therapeutic drugs to the brain consists of (transient) BBB disruption by means of ultrasound, more particularly focused ultrasound (FUS; Miller et al. 2017, Metabolism 69:S3-S7). Besides being non-invasive, this technique has, often in combination with realtime imaging, the advantage of precise targeting to a diseased area of the brain. Therapeutic drugs can be delivered in e.g. microbubbles e.g. stabilized by an albumin or other protein, a lipid, or a polymer. Therapeutic drugs can alternatively, or in conjunction with microbubbles, be delivered by any other method, and subsequently FUS can enhance local uptake of any compound present in the blood (e.g. Nance et al. 2014, J Control Release 189:123-132). Just one example is that of FUS-assisted delivery of antibodies directed against toxic amyloid-beta peptide with demonstration of reduced pathology in mice (Jordao et al. 2010, PloS One 5:el0549). Microbubbles with a therapeutic drug load can also be induced to burst (hyperthermic effect) in the vicinity of the target cells by means of FUS, and when driven by e.g. a heat shock protein gene promoter, localized temporary expression of a therapeutic protein can be induced by ultrasound hyperthermia (e.g. Lee Titsworth et al. 2014, Anticancer Res 34:565-574). Alternatives for ultrasound to induce the hyperthermia effect are microwaves, laser-induced interstitial thermotherapy, and magnetic nanoparticles (e.g. Lee Titsworth et al. 2014, Anticancer Res 34:565-574). Thus, in some embodiments, the inhibitors of the present disclosure are formulated for FUS-mediated delivery.Intracellular drug administrationIn some aspects, the inhibitors of the present disclosure are formulated for intracellular administration. Besides the need to cross the BBB, drugs targeting disorders of the central nervous system, such as the inhibitors described herein, may also need to cross the cellular barrier. Although most antisense oligonucleotides are readily taken up by neurons and glia after reaching the nervous system, it can be advantageous to use facilitators of intracellular drug uptake.One solution is the use of cell-penetrating proteins or peptides (CPPs). Such peptides enable translocation of the drug of interest coupled to them across the plasma membrane. CPPs are alternatively termed Protein Transduction Domains (TPDs), usually comprise 30 or less (e.g. 5 to 30, or 5 to 20) amino acids, and usually are rich in basic residues, and are derived from naturally occurring CPPs (usually longer than 20 amino acids), or are the result of modelling or design. A non-limiting selection of CPPs includes the TAT peptide (derived from HIV-1 Tat protein), penetratin (derived from Drosophila Antennapedia -Antp), pVEC (derived from murine vascular endothelial cadherin), signal-sequence based peptides or membrane translocating sequences, model amphipathic peptide (MAP), transportan, MPG, polyarginines; more information on these peptides can be found in Torchilin 2008 (Adv Drug Deliv Rev 60:548-558) and references cited therein. The TAT peptide was e.g. used to shuffle a tau-fragment into neuronal cells (Zhou et al. 2017).CPPs can be coupled to carriers such as nanoparticles, liposomes, micelles, or generally any hydrophobic particle. Coupling can be by absorption or chemical bonding, such as via a spacer between the CPP and the carrier. To increase target specificity an antibody binding to a target-specific antigen can further be coupled to the carrier (Torchilin 2008, Adv Drug Deliv Rev 60:548-558)CPPs have already been used to deliver payloads as diverse as plasmid DNA, oligonucleotides, siRNA, peptide nucleic acids (PNA), proteins and peptides, small molecules and nanoparticles inside the cell (Stalmans et al. 2013, PloS One 8:e71752).Methods of manufacturingThe present disclosure also provides a method of manufacturing an inhibitor, more particularly an oligonucleotide of the present disclosure, the method comprising chemically synthesizing the inhibitor or oligonucleotide of the present disclosure using sequential solid phase oligonucleotide synthesis. The present disclosure provides a method of manufacturing an inhibitor or oligonucleotide of the present disclosure comprising a conjugate moiety, wherein the method comprises covalently attaching the conjugate moiety (e.g., at least one non-nucleotide or non-polynucleotide moiety) covalently to an antisense oligomer disclosed herein. In some aspects, the conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety) is attached to an antisense oligomer disclosed herein directly or via a linker positioned between the antisense oligomer sequence and the conjugate moiety. In some aspects, covalently attaching the conjugate moiety (e.g., a non-nucleotide or non- polynucleotide moiety, such as a GalNAc moiety) to the antisense oligomer comprises: (i) chemically synthesizing the antisense oligomer; and, (ii) adding by chemical synthesis or conjugation the conjugate moiety to the antisense oligomer to yield an oligonucleotide conjugate. In some aspects, adding by chemical synthesis or conjugation the conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety) to the antisense oligomer to yield an oligonucleotide conjugate comprises: (i) incorporating by chemical synthesis or conjugation at least one conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety) to the antisense oligomer; (ii) incorporating by chemical synthesis or conjugation at least one linker to the antisense oligomer or conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety); (iii) incorporating by chemical synthesis or conjugation at least one branching point to the antisense oligomer or conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety); (iv) incorporating by chemical synthesis or conjugation at least one spacer to the antisense oligomer or conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety); or, (v) a combination thereof. In some aspects, (i) at least one linker is interposed between the antisense oligomer and a branching point; (ii) at least one branching point is interposed between a linker and a conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety);(iii) at least one, two, or three conjugate moieties (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety) are attached to a branching point; (iv) at least one polymer spacer (e.g., a PEG spacer) is interposed between a conjugate moiety (e.g., a non-nucleotide or non-polynucleotide moiety, such as a GalNAc moiety) and a branching point; or, (v) any combination thereof.Kits and products of manufactureAlso provided herein are kits and products of manufacture comprising one or more compositions (e.g., an inhibitor more particularly an oligonucleotide of the present disclosure or pharmaceutical compositions comprising the inhibitor or oligonucleotide of the present disclosure) described herein. In some aspects, provided herein is a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions described herein.In some aspects, the kit or product of manufacture comprises, e.g., a first container comprising a first pharmaceutical composition comprising an inhibitor or oligonucleotide of the present disclosure, a second container containing a solvent, and optionally an instruction for use.In some aspects, the kit or product of manufacture comprises a container comprising an inhibitor or oligonucleotide of the present disclosure and optionally an instruction for use.In some aspects, the kit contains a pharmaceutical composition described herein and any prophylactic or therapeutic agent, such as those described herein. In some aspects, the kit further comprises instructions to administer a composition of the present disclosure according to any method disclosed herein. In some aspects, the kit is for use in the treatment of a medical indication disclosed herein. In some aspects, the kit is a diagnostic kit.All of the references cited above, as well as all references cited herein, are incorporated herein by reference in their entireties.The sequences of biomolecules (e.g., proteins, genes) disclosed herein and identified by either database accession number or gene name are incorporated by reference. The database accession numbers disclosed herein (e.g, Genbak accession numbers) refer to the database version that in effect on August 10, 2022. The nucleic acid sequences of genes identified by name as well as their official names and alternative names correspond to those in the version of the Genbank database active on August 10, 2022, and are herein incorporated by reference. The amino acid sequences of proteins identified by name or translation products of genes identified by name as well as their official and alternative names correspond to those in the version of the UniProt database active on January 23, 2023 and are herein incorporated by reference.The following examples are offered by way of illustration and not by way of limitation.EXAMPLESExample 1. Cell-type specific a-sy nuclein and tau expression levels do not account for differential vulnerability in mutation carriersTo test whether increased expression of a-synuclein and tau explains cell-type preferential vulnerability, we explored publicly available human brain mRNA sequencing datasets of non-neurodegeneration control individuals. In regional bulk gene expression data across different human brain areas, there is brain-wide expression of a-synuclein and tau without obvious correlation with regions known to be differentially vulnerable, such as substantia nigra, locus coeruleus, temporal cortex and hippocampus, amongst others, in the case of a-synuclein mutations and frontal, temporal, parietal and cingulate cortex, hippocampus and entorhinal cortex, amygdala, caudate nucleus and substantia nigra, amongst others, in the case of tau mutations (Schneider and Alcalay, 2017; Mirra et al., 1999; Spillantini et al., 1998) (Figure 1A). Expression of a-synuclein and tau is higher in the cerebellum as compared to the primary sites of vulnerability, i.e. substantia nigra and frontal cortex, respectively (Figure 1A). Median a- synuclein and tau expression in the hippocampus and substantia nigra - both regions affected in mutations carriers (Mirra et al., 1999; Schneider and Alcalay, 2017; Spillantini et al., 1998) - are amongst the five lowest expressing brain regions out of 13 analyzed. Hence, a-synuclein or tau expression levels in specific brain regions do not correlate with known vulnerable regions.Next, to assess the contribution of individual cell types to regional bulk gene expression, we analyzed a- synuclein and tau in single-cell RNA sequencing (scRNA-seq) datasets. We resorted to the nervous system-wide atlas of mouse (Zeisel et al., 2018), that allows us to compare relative expression levels across most brain cell types. Patients with pathogenic a-synuclein, and frequently also those harboring tau mutations, show loss of melanin-containing dopaminergic neurons (Mirra et al., 1999; Schneider and Alcalay, 2017; Spillantini et al., 1998). In the mouse brain, median a-synuclein and tau expression in substantia nigra and ventral tegmental area dopaminergic neurons are within the top decile of cell types (data not shown). Furthermore, median a-synuclein expression in CA3 hippocampal neurons that substantially degenerate in a-synuclein mutation carriers (Spira et al., 2001), ranks high (5th) across 265 cell types (data not shown). However, also many other cell types not reported as affected in a-synuclein and tau mutation carriers express high levels of a-synuclein and tau, such as spinal cord excitatory neurons or cranial nerve nuclei (data not shown). Collectively, this suggests that high a-synuclein or tau expression levels might sensitize neurons, but that other cellular features exist that modulate toxicity. We confirm these findings using single-cell sequencing datasets that are available from specific human brain regions. To enable comparisons between datasets acquired with different technologies, we further normalized mean a-synuclein and tau expression to the means of all detected genes in a given cell type by calculating their expression percentiles. In dopaminergic neurons in a combined substantia nigra and middle frontal gyrus dataset, we find robust expression of a-synuclein and tau, both above the 97thpercentile (Agarwal et al., 2020) (Figure 1C; data not shown). Also, the preferentially vulnerable CA2 and CA3 neurons express high levels of a-synuclein in the human hippocampus (Franjic et al., 2022) (data not shown). Tau expression is similarly high across different neuron types of the entorhinal cortex, subiculum and hippocampus (data not shown). Across multiple human cortical areas a-synuclein expression is higher in excitatory compared to inhibitory neurons (data not shown). Tau is expressed highly throughout excitatory and inhibitory neurons and expression levels are similar across brain areas, providing no direct explanation why frontal and temporal cortices are preferentially vulnerable in tau mutant patients (Figure IB; data not shown).Taken together, our analysis of regional and cell-type specific a-synuclein and tau expression levels across the human and mouse brain reveals that vulnerable cell types and brain regions express high levels of a-synuclein and tau. However, similar or sometimes even higher levels are observed in several regions and cell types that are not apparently vulnerable in a-synuclein and tau mutant patients, suggesting that region and cell-type intrinsic properties influence toxicity.Example 2. Drosophila models of a-synuclein and tau mutations show differential neuronal vulnerabilityTo experimentally test whether neurons are differentially affected when exposed to pathogenic a- synuclein or tau, we generated Drosophila models expressing human A53T mutant a-synuclein or P301L mutant tau in all neurons. In fruit flies, a very large number of highly diverse neuron types can be assayed in parallel (Davie et al., 2018; Jenett et al., 2012; Konstantinides et al., 2018; Kurmangaliyev et al., 2020; Li et al., 2022; Ozel et al., 2021). We also generated, as extra controls, transgenic flies with an empty backbone insertion (mini-w+), a fluorophore-dead GFP (smGdP) and a-synuclein as well as tau mutants where the main aggregation-prone regions are deleted (NAC and PHF6 VQIVYK, respectively; von Bergen et al., 2000, 2001; Bodies et al., 2001; Rodriguez et al., 2015; Sawaya et al., 2007). These were all crossed for >5 generations into the same inbred reference background and expressed using the neuronal nSyb promoter, which acts through the exogenous QF2w transcriptional activator and Q.UAS binding sites (Potter et al., 2010; Riabinina et al., 2015).Two design features are of particular importance. First, because all transgenes are inserted as single copies into the same genomic locus (Bischof et al., 2007; Venken et al., 2006), their relative expression levels across cell types are genetically hardwired to be comparable - which we confirm with single-cell RNA sequencing (see below). Second, a-synuclein and tau are expressed at levels comparable to those found in non-diseased human brains (Figure 2A-B; data not shown). We also validated that the expression is maintained throughout the lifespan of these flies (Figure 2C), enabling us to include ageing as an experimental variable. To test the functional impact of pathogenic a-synuclein and tau in a well- established model circuit, we performed electro-retinogram (ERGs) recordings. ERGs are local fieldpotentials that occur in response to a light stimulus, thus providing the integrated response of the retinal cells and post-synaptic lamina monopolar neurons. At 45 days of age, but not before, we find in P301L tau expressing flies a loss of light-on and -off transients that are physiologically elicited at the switchover from dark to light and vice versa (Figure 2D). Conversely, animals expressing tau harboring an aggregation-domain deletion do not show ERG defects, indicating this is largely driven by aggregation toxicity. ERGs in A53T a-synuclein expressing flies and the aggregation-domain deletion are similar to controls (Figure 2D). Given the difference between ERG recordings between a-synuclein and tau expressing flies, these data are functional evidence of differential neuronal vulnerability in this specific circuit. To evaluate the functional integrity of broader neuronal circuits upon expression of the toxic proteins, we used high-resolution sleep and activity monitoring using video-tracking of individual flies in ethoscopes (Geissmann et al., 2017) and extracted sleep and activity parameters that are controlled by different neuronal systems (Donlea et al., 2011; Valadas et al., 2018). We validated the flies of different genotypes and ages move normally. This is a prerequisite to be able to infer behavioral parameters such as sleep. We detect reduced night-time sleep and latency to fall asleep in aged P301L tau, but not in A53T a-synuclein flies (data not shown). We extended this analysis by incorporating additional parameters at 5, 25 and 45 days of age and then used hierarchical clustering to compare the genotypes. This places tau and a-synuclein at opposing ends of the tree (Figure 2E), consistent with different circuits being affected. Furthermore, the distance between a-synuclein / tau harboring aggregation-domain deletions vs. their pathogenic counterparts is larger as compared to the distance between the mini-w+ and smGdP controls. This suggests that the observed circuit dysfunction is partly caused by aberrant aggregation-mediated toxicity.Finally, we also tested whether pathogenic a-synuclein and tau cause neurodegeneration in our models. We prepared brain sections and used automated analysis to quantify the area of brain vacuolization (data not shown). A53T a-synuclein-expressing brains show numerous vacuoles in the optic lobes at 25 days of age (Figure 2F). This is even more apparent at 45 days of age and is not observed in a-synuclein with the aggregation domain deletion. P301L tau expressing flies also exhibit age-dependent increases of vacuolar area that is not seen in animals expressing tau with an aggregation-domain deletion (Figure 2F). However, the extent of vacuolization and the regional distribution is markedly different compared to A53T a-synuclein-expressing flies. In P301L brains vacuoles are present throughout the brain; in A53T a-synuclein they mainly cluster in the optic lobes. This further suggests that different neurons are affected in A53T a-synuclein vs. P301L tau brains.Example 3. Differential transcriptomic impact to pathogenic a-synuclein and tau across >200 neuron typesTo identify neuron types differentially vulnerable to a-synuclein and tau we performed brain wide singlecell RNA sequencing. We sampled A53T a-synuclein, P301L tau, mini-w+ controls and smGdP at 5 and 25 days of age in six repeat experiments. Cells from all genotypes and experimental dates intermix homogenously, suggesting that all cell types are formed across conditions. After quality control filtering, we retain 143,013 cells, evenly distributed between the conditions. Individual cells were clustered and annotated with classifiers previously trained on manually annotated fly brain atlases as well as with bulk transcriptomes of FAC-sorted cell types (Davis et al., 2020; Li et al., 2022; Ozel et al., 2021; Traag et al., 2019). We identify a total of 208 brain cell types of which 202 are neurons of all the major neurotransmitters classes. This large number of neuronal subtypes is the consequence of being able to sample entire fly brains in every repeat experiment. Our dataset thus provides a high-resolution platform for the study of the neuron-type specific impact of pathogenic a-synuclein and tau.We first confirmed that A53T a-synuclein and P301L tau are expressed at similar levels in the identified cell types; a prerequisite to study their differential impact. Consistent with the experimental design, we detect A53T a-synuclein and P301L tau in nSyb-positive cells (data not shown), and we observe highly correlated expression in all analyzed cell types (Figure 3A; data not shown). Conversely glial cells, which express the repo marker gene, or miniw+ do not express the toxic transgenes (data not shown). We also see that cell-type specific expression levels are maintained throughout ageing from 5 to 25 days (data not shown), suggesting that comparing cell-type specific effects at 5 and 25 days are not confounded by changes in transgene levels. In addition, we validated that a-synuclein and tau mRNA levels are expressed at levels comparable to endogenous neuronal genes in Drosophila and comparably high to human brains (Figure 3B).Next, we calculated gene expression changes in cells of A53T a-synuclein, P301L tau and smGdP compared to non-expressing controls for each cell type. We filtered cell types with low cell counts as well as poorly defined clusters and evaluated differentially expressed genes (DEGs) both at 5 and 25 days separately as well as in a combined model with DESeq2 (Love et al., 2014) (data not shown). The magnitude of transcriptional deregulation (i.e. the number of genes) across neuron types is highly heterogenous, ranging from 1 DEG in glutamatergic neuron type 44 (N-44-Glut) and LC12 neurons to 36 in T1 neurons upon expression of A53T a-synuclein in the 5 and 25 day joint analysis; and from 1 DEG in the GABAergic neuron type 75 (N-75-GABA) to 78 in T1 neurons when P301L tau is expressed. Thus, gene expression in some neuron types is deregulated several-fold stronger than in others. Similarly, another well-established differential gene expression testing algorithm, edgeR (Robinson et al., 2009), provides robustly correlated prioritizations of neuron types based on magnitudes of transcriptional deregulation as compared with DESeq2 (median Spearman rho = 0.655 at the 5, 25, and 5 + 25 days analyses). Tofurther refine our neuron type prioritizations based on the number of DEGs in transcriptomics, we evaluated technical covariates that might influence the number of recovered DEGs. The number of cells per neuron type shows a moderate contribution (Spearman rho < 0.5); the number of detected genes is not correlated in A53T a-synuclein and only weakly correlated in P301L tau due to a few outliers (Spearman rho < 0.3), such as T1 neurons which are physically larger cells than many other fly brain neuron types. Correspondingly, in T1 neurons ~70% more genes are detected. Finally, we also assessed whether transgene levels predicted the number of DEGs and found that A53T a-synuclein does not correlate and P301L tau only moderately (Spearman rho = 0.13 and 0.43). To correct for the technical covariates, we fitted negative binomial regression models including these explanatory variables. We also included toxic transgene levels, which is critical in order to be able to assess neuron-type specific effects beyond and independent of expression levels. This ultimately enabled us to make conservative estimates as to which neuron types exhibit significantly more or less DEGs than predicted by the model. We find that TmY5a, Tm3, a / b-KC, TmY8, T2a, Tml neurons are impacted significantly stronger than expected upon A53T a-synuclein expression. They are cholinergic or glutamatergic excitatory neurons, from the optic lobes - where the vast majority of identified cell-types reside - as well as from the learning and memory centre (a / b-KC). Likewise, Tm3, C2, T2, C3, Tml, T3 and Mil5 are impacted significantly stronger than expected upon P301L tau expression, independent of the covariates cell and gene number as well as transgene levels. C2 and C3 neurons are GABAergic, Mil5 neurons dopaminergic and the rest cholinergic neurons. Neurons with significantly smaller transcriptomic deregulation than expected in response to A53T a-synuclein or P301L tau expression are cholinergic, GABAergic and glutamatergic neurons from the optic, antennal lobes as well as of yet unresolved identity. While Tml and Tm3 neurons appear preferentially deregulated both upon A53T a-synuclein and P301L tau expression, there are several neuron types where the responses in the A53T a-synuclein versus P301L tau versus smGdP conditions diverge, such as C2, C3, T2, T3, Tm2, a / b-KC and TmY5a neurons. Collectively, these results provide transcriptomic evidence of differential neuron impact by a-synuclein and tau.We next assessed if the magnitude of transcriptional deregulation (the number of DEGs) correlates with neuronal phenotypes that can intuitively be connected to neurodegeneration symptoms, i.e. neuronal structural deficits, neuronal loss or neuronal functional impairments. To study structural changes, we expressed mutant tau or a-synuclein in C2 and C3 neurons together with a membrane-tagged GFP (CD8::GFP). C2 and C3 neurons are an interesting test case, since they are significantly more affected in P301L tau versus A53T a-synuclein brains, which is particularly apparent at 25 days of age and not yet visible at 5 days of age. Their cell bodies are located in the optic lobes, which send projections into the laminae (Tuthill et al., 2013). We first validated that P301L tau and A53T a-synuclein are expressed at similar levels (data not shown). We then found in 25-day old P301L tau animals C2 / 3 neurons dystrophic neuronal processes and >50% thinning of the terminal GFP-labeled varicosities, when compared tocontrol animals expressing smGdP (Figure 3C-D). Conversely, animals that express A53T a-synuclein in C2 / 3 neurons do not show morphological defects (Figure 3C-D). These changes are not seen at 5 days (data not shown), consistent with >10-times fewer DEGs in 5 vs. 25 days in C2 and C3 neurons in P301L tau expressing animals.In Tml neurons, which we predict to be vulnerable to A53T a-synuclein and in P301L tau, we note increased density of dendritic proliferations in both conditions versus control, as measured by increased CD8::GFP signal in the medulla (Figure 3E). In addition, P301Ltau-expressing Tml neurons, but not A53T a-synuclein-expressing Tml neurons, frequently display dystrophic neurites with swollen segments (Figure 3F). Thus, Tml neurons are structurally affected in A53T a-synuclein and P301L tau, with additional defects in tau, consistent with the higher number of DEGs in Tml neurons of P301L tau expressing animals. a / p-Kenyon cells (KC), which we predict to be vulnerable specifically to A53T a-synuclein, display abnormal focal patches of CD8::GFP hyperintensities in the synaptic and dendritic areas in A53T a- synuclein-expressing neurons and not in P301L tau or smGdP controls (Figure 3G). In contrast, LClOa neurons, which we predict to be resilient to both P301L tau and A53T a-synuclein do not display synaptic hyperintensities or synaptic loss (Figure 3H-I).To further test our predictions at a time point where neurodegeneration had already occurred and strong neuronal phenotypes are present, we performed additional single-cell RNA sequencing in 45 day old P301L tau and mini-w+ controls. We conducted four repeat experiments amounting to 121,108 high- quality cells, which we annotated based on co-clustering to our 5 and 25 days datasets. Comparing the recovered cell-type proportions, we note that 2 out of 7 neuron types (C2 and Tm3) that we predict to be vulnerable, are significantly lost in 45 days old P301L tau flies compared to miniw+ control (Figure 4A), whereas out of 14 predicted resilient cell types, none are lost (Figure 4B). At younger ages - 5 and 25 days - C2 and Tm3 neurons are preserved in P301L tau animals (data not shown). This is consistent with neurons we classify as vulnerable to be enriched for cell types that degenerate in an age-dependent manner. To assess whether more subtle functional defects might also correlate with the magnitude of transcriptional deregulation, we assessed the number of DEGs in neuron types that underlie visual circuitry and sleep defects. In 45 days old P301L tau expressing flies we find that lamina monopolar neurons 1-4 (Ll-4) are the most highly deregulated neuron type (Figure 4C). This is intriguing, since at this age we observe a loss of light-on and -off ERG transients, that are known to be mediated by these cells (Coombe 1986). Conversely, photoreceptors are minimally deregulated, suggesting preserved integrity. Correspondingly, electrophysiological assessment of this cell-type showed intact depolarization in ERGs. We also re-assessed our 5- and 25-day dataset, which we had dissected without the majority of the visual system. Thus, only very few cells remained attached to the optic lobes and they therefore had not passed our original filtering (Methods). Nevertheless, with the few remaining laminamonopolar neurons we could detect greater transcriptional deregulation in P301L tau vs A53T a- synuclein flies in Ll-4 neurons (Figure 4D), which correlates with loss of on- and off-transients selectively in P301L tau and not A53T a-synuclein in 45-day animals. In 45-day old P301L tau flies we also detect robust transcriptional deregulation in dorsal fan-shaped body type B (dFB_B) neurons (Figure 4C). Comparing 42 DEGs in dFB_B neurons to cell clusters that are up to 3 times this size, the dFB_B still remain the most highly deregulated cell type. This is interesting, since dFB neurons are known to promote sleep (Donlea et al., 2011), which we find to be reduced in 45-day old P301L tau flies (data not shown).Taken together, our neurodegeneration, structural and functional analyses show that the number of DEGs is a parameter capable of identifying resilience / vulnerability to pathogenic a-synuclein or tau expression.Example 4. Leveraging vulnerability / resilience to uncover toxicity modifiersWe then used the classification of Drosophila neuron cell types into preferentially vulnerable and resilient, to uncover genes and pathways associated with this dichotomy. For both a-synuclein and tau separately, we pooled the RNA expression data of all vulnerable cell types and of all resilient cell types in the mini-w+ control dataset. We then performed differential gene expression testing between vulnerable and resilient cells to uncover predictive gene signatures: i.e. a list of genes that are expressed higher / lower in cell types that are classified as vulnerable or resilient, and that thus collectively serve as markers for cell-types more / less prone to A53T a-synuclein and to P301L tau-induced stress. We then performed gene ontology (GO) term overrepresentation analysis on the resulting genes (Figure 5A, 5B). This identifies processes related to mitochondrial energy metabolism expressed at higher levels in neuron cell types that are resilient in A53T a-synuclein expressing animals (data not shown), suggesting that high baseline mitochondrial respiration capacity might be protective to a-synuclein. This finding reinforces an established link between a-synuclein and mitochondrial dysfunction (Devi et al., 2008; Ganjam et al., 2019). P301L tau resilient neurons exhibit higher expression of 'axon guidance' and 'synapse organization' terms (Figure 5A), supporting the idea that genes involved in the development or remodeling of these compartments might be able counteract tau-induced synaptic loss. P301L vulnerable neurons are enriched for ion channel and Ca2+-related GO terms, consistent with a role of neuronal excitability and altered Ca2+ homeostasis in neurodegenerative diseases (Fu et al., 2018; Saxena and Caroni, 2011; Sulzer and Surmeier, 2013) (Figure 5B). GO terms enriched in both A53T a- synuclein and P301L tau vulnerable neurons are related to translation, dendrite, synapse and axon, suggesting that distance from the neuronal soma as well as increased input into the protein quality control network are vulnerability factors. Thus, we have uncovered pathways that associate withpreferential vulnerability and resilience to pathogenic a-synuclein and tau by screening >200 fly neuron subtypes.Next, we used the gene expression differences between tau or a-synuclein vulnerable and resilient neurons in Drosophila to assess whether specific human neuron types have enriched expression levels of a-synuclein or tau vulnerability or resilience marker genes which would ultimately contribute, in addition to other factors, to the resulting selective vulnerability as observed in disease. Since human genes show a high degree of conservation in Drosophila (Adams et al., 2000), we 'converted' our deregulated fly genes to their human homologues and used expression weighted cell type enrichment in conjunction with single nucleus RNA sequencing data from healthy human control brains (Skene and Grant, 2016). Across all neurons in a combined dataset encompassing substantia nigra and cortex from the middle frontal gyrus (Agarwal et al., 2020) we find the highest ranking A53T a-synuclein vulnerability genes significantly enriched in substantia nigra dopaminergic neurons (Bonferroni corrected p = 0.004, SD from mean = 4.7). Conversely, A53T a-synuclein resilience genes are enriched in substantia nigra GABAergic neurons (uncorrected p = 0.04, SD from mean = 2.1). These findings are in line with human neuropathology of PD brains, where a-synuclein aggregates and neuronal loss are key hallmarks of substantia nigra pars compacta dopaminergic neurons, but not of the neighboring GABAergic neurons of the substantia nigra pars reticulata (Braak et al., 2003; Damier et al., 1999; Gibb and Lees, 1991; Patt et al., 1991). We then predicted neuron-type specific vulnerability to pathogenic tau across the substantia nigra and cortex from the middle frontal gyrus (Agarwal et al., 2020) and uncovered significant vulnerability enrichment for substantia nigra dopaminergic neurons (Bonferroni corrected p < 0.00001, SD from mean = 7.1) and resilience enrichment in substantia nigra GABAergic neurons (Bonferroni corrected p < 0.00001, SD from mean = 11.1). This finding is in line with dopaminergic neuronal loss and intracytoplasmic tau deposits observed in this region in patients with pathogenic tau mutations (Spil lantini et al., 1998; Mirra et al., 1999). In a combined entorhinal cortex, subiculum and hippocampus dataset we find enrichment in layer 2 entorhinal cortex neurons (BMPR1B+) (uncorrected p = 0.02, SD from mean = 2.8) and several inhibitory neurons. EC L2 reelin-positive neurons are interesting given their established preferential vulnerability in Alzheimer's disease (Gomez-lsla et al., 1996; Stranahan & Mattson 2010). We detect them even more clearly upon re-mapping with non-neuronal cell-types included, which increases the relative differences (Bonferroni corrected p = 0.014, SD from mean = 6.9). Conversely, we detect Cajal-Retzius cells to be enriched for tau resilience genes (Bonferroni corrected p < 0.00001, SD from mean = 7.9), in agreement with evidence suggesting preserved structural integrity of entorhinal CR cells in AD (Riedel et al., 2003). Tauopathies typically involve also the neocortex - albeit at later time points and varying distributions. We thus assessed different neocortical areas from the Allen Brain Map (Allen Brain Map, 2021) where we find significant enrichment of GABAergic neurons in the lower limb region of primary motor cortex (Bonferroni corrected p < 0.00001, SD from mean = 4.5) andno specific enrichment for tau resilience genes. While the motor cortex is not a primarily affected site in AD, in several forms of PSP it is highly enriched for pathogenic tau (Kovacs et al., 2020). Thus, by comparing vulnerable and resilient neurons in Drosophila models of a-synuclein and tauopathy we are able to prioritize neuron-types in the human brain with altered vulnerability-resilience equilibrium.We finally asked whether our predicted tau vulnerability and resilience marker genes contain tau toxicity modifiers. To conduct a focused 'mini-screen', we refined our gene list in two ways. First, we calculated overlapping genes between human AD vulnerability genes (see Experimental Procedures) and our predicted tau vulnerability genes, since part of the differential vulnerability in AD is expected to be due to differential neuronal sensitivity to pathogenic tau (see above). And second, we extracted chaperones from our list as positive controls, given their established importance in neurodegenerative diseases (Lindberg et al., 2015). As a readout, we made use of the progressive decline in on- and off-transients in the ERGs of P301L tau mutant flies (Figure 2D). For this purpose we generated a new nsyb-QF2w fly line that, together with QUAS-tau[P301L], exhibited preserved on-transients at 25 days and significantly reduced on-transients (~2mV) at 45 days. We then combined these tau expressing flies with heterozygous prioritized loss-of-function alleles. This system allowed us to assess enhancement at 25 days as well as enhancement and suppression at 45 days (Figure 6-7). As expected, we find Hsp83 - orthologous to human HSP90AA1 - and synaptogyrin heterozygous loss-of-function to partially rescue tau-induced on-transient defects at 45 days, thus validating our experimental approach (Luo et al., 2007, Mclnnes et al., 2018; Largo-Barrientos et al., 2021). We also found multiple additional modifiers linked to pathways such as synapse - Mctp, Prosap, DIP-L; neuronal excitability - DpplO, GluRIA, Eaat2, which caused synthetic lethality with P301L tau prior to our ERG recordings; and - intracellular Ca2+ homeostasis - Trpm, Calx, Cam and RyR (Figure 6-7). Hence, several of the genes that associate with preferential vulnerability and resilience to pathogenic tau are also genetic modifiers of tau-induced neuronal dysfunction.EXPERIMENTAL PROCEDURESDrosophila modelsTo create the Drosophila models, we first generated pQUASTattB by transferring the '5xQUAS-hsp70 promoter-MCS-SV40 polyA signal' cassette from pQUAST (Addgene #24349, (Potter et al., 2010)) into pUASTattB (Bischof et al., 2013) via BamHI digestion and T4 ligation (NEB). pQUASTattB or pUASTattB were linearized with EcoRI-Xhol to enable the insertion of transgenes via Gibson assembly (HiFi DNA Assembly, NEB). V5-tagged, fluorophore-dead GFP (smGdP::V5; to enable downstream experiments with GFP based reporters together with this line) was amplified from pJFRC206 (with primers smGFP::v5_hifi_F / R from Addgene #63168, (Nern et al., 2015)); human wild-type and A53T mutant a- synuclein coding sequence was custom synthesized (IDT, sequences below) and tau[P301L] 0N4Ramplified from previously reported constructs with tau_hifi_F / R (Zhou et al., 2017). The a-synuclein NACore 68-GAVVTGVTAVA-78 and PHF6 tau 306-VQIVYK-311 deletions were introduced with site- directed mutagenesis with asyn_del_NAC_F / R and tau_del_VQIVYK_F / R (von Bergen et al., 2000; Rodriguez et al., 2015). To control for potential effects of the plasmid insertion itself, we generated an expression deficient variant 'mini-w+' by removing the '5xUAS-hsp70 promoter' cassette from pUASTattB via H ind 11 l-Xhol digesting, blunting and ligating with the Quick Blunting Kit (NEB) and T4 ligase. All transgenes were inserted into the VK00005 attP landing site (75A10, 3L: 17,952, 108..17,952, 108 [-]) by BestGene and backcrossed for five generations into an inbred Canton-S strain harboring the w
[1118] mutation. nSyb-QF2w.attP2, nSyb-QF2.attP2 and UASmCD8::GFP.su(Hw)attPl where obtained from Bloomington Drosophila Stock Centre (#51960, #78338, #32187); the C2.C3_dl-Gal4 line (R20C11- p65ADZp_attP40; R48Dll-ZpGDBD_attP2) from Janelia FlyLight (SS00779). nSyb-QF2w.JK22C was generated by microinjection of pattB-synaptobrevin-7ml-QFBDADMl-hsp70 (Addgene #46116) into theJK22C landing site (BestGene). Flies were maintained on standard corn meal and molasses food. For all experiments, male flies of control and experimental genotypes were raised in parallel on the same batch of food in a temperature and light-controlled incubator at 25°C and 12-hour light-dark cycle.ElectroretinogramsElectroretinograms (ERGs) were recorded as previously described (Slabbaert et al., 2016). Briefly, flies were immobilized on glass slides with 5 s fix UV glue (JML). Glass electrodes (borosilicate, 1.5 mm outer diameter, Hilgenberg) were filled with 3 M NaCI. One electrode was positioned in the thorax as a reference while another was placed on the fly eye for recording. Responses to repetitive light stimuli were measured using Axosope 10.7 (Molecular Devices) and analyzed with Clampfit 10.7 (Molecular Devices) and Igor Pro 6.37 (WaveMetrics).Fly sleep and activity monitoringProfiling of sleep and activity behaviour of 5, 25 and 45 day old male flies was performed using the fly behaviour video recording platform ethoscope (Geissmann et al., 2017). Briefly, flies were sorted into glass tubes (65 mm length, 5 mm external and 3 mm internal diameter) with standard corn meal and molasses food on one end and closed with cotton wool on the other. Twenty individual animals per ethoscope were recorded for at least 4 consecutive days at 2 frames per second with infrared light in incubators at 25°C with 12 hour light-dark conditions. The position of each animal was saved at each time point in SQLite files and subsequently analysed with R (v3.6.3) and rethomics with adjusted R packages behavr, scopr and sleepr (vO.3.99). The behaviour of individual flies was determined with the automatic behaviour annotator at a resolution of 10 s. Thus, in 10 s intervals flies were scored as moving or asleep. Sleep was defined following the 5-min rule, in which immobility bouts longer than 5 min werecounted as sleep bouts, including the first 5 min. A fly was scored as immobile if the distance between 2 consecutive frames in the 10 s interval was less than 0.27 mm. Flies that died during the monitoring as well as the first day of recording due to habituation were excluded from further analysis. To describe the activity and sleep profile of individual flies the following parameters were analysed: Within 3 days of the indicated age, the sleep amount per light condition (sleep_fraction_day) and per dark condition (sleep_fraction_night) were calculated. For the latency parameter, the time between zeitgeber 12 (= lights off) and the first sleep bout was determined. The mean bout length as well as the number of sleep bouts were scored during the dark condition. Morning and evening anticipation were calculated as described previously (Valadas et al., 2018). The velocity_if_awake was assessed based on 10 s interval annotation 'moving'. The cumulative distance within the 10 s interval was calculated and summed per 24 h to determine the travelled distance (total_distance) for each animal. Finally, the means of the activity and sleep parameters were calculated for each genotype, scaled and hierarchically clustered based on correlation distance and average-linkage with the R pheatmap package.Mapping vulnerability-resilience genes to human neuron typesTo uncover neuron types in the human brain with increased relative expression of a-synuclein or tau vulnerability / resilience genes as uncovered in Drosophila models, we used Expression Weighted Celltype Enrichment (EWCE, vl.0.0) (Skene and Grant, 2016) together with human brain single-nucleus RNA sequencing datasets from substantia nigra and middle frontal gyrus (Agarwal et al., 2020), from the entorhinal cortex, subiculum and hippocampus (Franjic et al., 2022) or from multiple cortical areas, including the middle temporal gyrus, anterior cingulate cortex, primary visual cortex, primary motor cortex, primary somatosensory cortex and primary auditory cortex (Allen Brain Map, 2021). Drosophila genes up- or downregulated with a Iog2-fold change >2 or <2 and a Benjamini-Hochberg corrected p- value <0.05 in vulnerable vs. resilient neurons were mapped to human neuron types by converting them to their human orthologous genes with DIOPT at a minimum score of 5 (Hu et al., 2011). In the human datasets, we only retained neurons, since our study focuses specifically on neuronal vulnerability. We removed genes with little variance across each of the datasets with the EWCE function drop_uninformative_genes() and calculated the specificity matrix with generate_celltype_data(). To assess whether our gene sets are enriched in any of the human neuron types we used the bootstrap_enrichment_test() function with human orthologous genes of the detected genes in our Drosophila dataset as background. This allowed us to compare the average neuron type specific expression of our vulnerability / resilience gene sets with the expression of 10 000 random gene lists of the same length.Tau toxicity modifier screenTo extract AD vulnerability genes, differential gene expression testing was carried out between vulnerable cell types (entorhinal cortex L2 and CAI neurons) and resilient ones (CA2, CA3 and dentate gyrus neurons) in the healthy human Franjic et al. 2022 dataset. MAST was used based on log2(CPM+l) and number of genes as a covariate (Finak et al., 2015). Resulting DEGs with Benjamini-Hochberg corrected p-value of < 0.05 and Iog2-fold change > 0.5 were intersected with human orthologs of Drosophila tau vulnerability / resilience genes, converted with DIOPT at a minimum score of 5 (Hu et al., 2011). Of the resulting 122 genes, best candidates were prioritized based on the magnitude of Iog2-fold change and the availability of suitable Drosophila stocks. We selected mutants that were predicted or confirmed null alleles, such as deletions encompassing large portions of the gene as well as MiMIC, Trojan Gal4 and CRIMICS lines that had insertions in an early exon or in an early intron in the same orientation as the target gene (Venken et al., 2011; Diao et al., 2015; Lee et al.; 2018). All mutants had white eyes, therefore not interfering with ERG recordings. To test for genetic interaction, we combined these lines with nSyb-QF2w.JK22C > QUAS-tau[P301L] in a heterozygous manner. nSyb-QF2w inserted into JK22C yielded ~2mV on-transients at 45 days when expressing tau[P301L] - as opposed to ~0mV with the same driver in the attP2 insertion site, which was otherwise used - which therefore enabled to screen for suppression and enhancement with this line. ERGs were recorded at 25 and 45 days of age and analyzed in R (v3.6.3), with the readABF (vl.0.2), tidyverse (vl.3.1) and multcomp (vl.4.19) packages.45 day dataset generation and analysisGeneration and analysis of the 45 day single-cell dataset followed the protocols above, with few minor differences. Four batches of male nSyb-QF2w > mini-w+ and nSyb-QF2w > QUAStau[P301L] flies were aged 45 + / - 1 day of age in parallel and their brains including lamina and retina were dissected. Library preparations for single cell RNAseq was performed using Chromium v3.1 Next GEM chemistry (lOx Genomics). However, for single cell encapsulation, custom microfluidics as described previously (De Rop et al., 2022) was used instead of the standard lOx GEM generation chips. The custom HyDrop chip provided an improved encapsulation efficiency of >75% and better control of droplet formation. Cell count and viability (>96%) of the samples were assessed using FLUNA-FL Dual Fluorescence Cell Counter (Logos Biosystems). Both genotypes of the same batch were processed on the same experimental day. The workflow of the HyDrop chip allowed combining two lOx reactions into a single run (De Rop et al., 2022), which enabled us to target for 20 000 cell recovery per genotype and experimental date. The rest of the single cell RNAseq libraries were prepared as per manufacturer's recommendations and detailed before. For quality assessment and cell number estimation of finished libraries we performed shallow sequencing on a NextSeq 2000 sequencer (Illumina). Deeper sequencing (targeted sequencing saturationof 80%), were performed on the MGISEQ-2000 sequencing platform (MGI Hong Kong SAR sequencing facility). Before being able to sequence on the MGI platforms, the lOx libraries need to undergo a conversion step using MGIEasy Universal DNA Library Prep kit. Briefly, the final lOx sequencing libraries were circularized using the splint-ligation step and the circularized libraries were converted to single stranded DNA copies. DNA nanoballs were prepared from the circularized ssDNA using Rolling Circle Amplification (RCA). DNB libraries generated were then flown through the patterned flow cell of the MGISEQ.-2000RS High-Throughput Sequencing kit. A custom sequencing recipe of paired end reads of 28 bps (read 1), 100 bps (read 2) and 10 bps (index 1) was used for sequencing. After applying the index- hopping-filter as before, mapping, soupX correction, and QC filtering (min. 600 genes, max. 20000 counts and max. 15% mitochondrial content), the 45 day dataset was jointly clustered with the 5 and 25 day datasets as detailed above. Leiden resolution 3 was chosen as the base resolution and cluster labels were transferred to the 45 day cells if >80% of that cluster had a unique label in the 5 and 25 day dataset. Otherwise higher resolutions were explored to split the respective cluster. Differential gene expression testing was carried out with DESeq2 as described above. Differential abundances were calculated based on cell-type fractions of the cell-types that were used for the P301L tau vulnerability classification at 5 and 25 days.REFERENCESAdams et al 2000 Science 287, 2185-2195.Agarwal et al 2020 Nat Commun 11.Allen Brain Map 2021 Available from celltypes.brainmap.org / rnaseq. von Bergen et al 2000 Proc Natl Acad Sci USA 97, 5129-5134. von Bergen et al 2001 J Biol Chem 276, 48165-48174.Bischof et al 2007 Proc Natl Acad Sci USA 104, 3312-3317.Bischof et al 2013 Development 140, 2434-2442.Bodies et al 2001 J Neurochem 78, 384-395.Braak et al 2003 Neurobiol Aging 24, 197-211.Coombe 1986 J Comp Physiol A 159, 655-665.Damier et al 1999 Brain 122, 1437-1448.Davie et al 2018 Cell 174, 982-998.e20.Davis et al 2020 Elife 9, 1-40.De Rop et al 2022 Elife 11, 1-26.Devi et al 2008 J Biol Chem 283, 9089-9100.Diao et al 2015 Cell Rep 10, 1410-1421.Donlea et al 2011 Science 332, 1571-1576.Finak et al 2015 Genome Biology 16.Franjic et al 2022 Neuron 110, 452-469. el4.Fu et al 2018 Cortex 28, 433-446.Ganjam et al 2019 Cell Death Dis 10.Geissmann et al 2017 PLOS Biol. 15, e2003026.Gibb and Lees 1991 J Neurol Neurosurg Psychiatry 54, 388-396.Gomez-lsla et al 1996 J Neurosci 16, 4491-4500.Hu et al 2011 BMC Bioinformatics 12.Jenett et al 2012 Cell Rep 2, 991-1001.Konstantinides et al 2018 Cell 174, 622-635. el3.Kurmangaliyev et al 2020 Neuron 108, 1045-1057. e6.Largo-Barrientos et al 2021 Neuron 109, 767-777. e5.Lee et al 2018 Elife 7, 1-24.Li et al 2022 Science 375.Lindberg et al 2015 J Neurosci 35, 13853-13859.Love et al 2014 Genome Biol. 15, 550.Luo et al 2007 Proc Natl Acad Sci USA 104, 9511-9516.Mclnnes et al 2018 Neuron 97, 823-835. e8.Mirra et al 1999 J Neuropathol Exp Neurol 58, 335-345.Nern et al 2015 Proc Natl Acad Sci USA 112, E2967-E2976.Ozel et al 2021 Nature 589, 88-95.Patt et al 1991 Histol Histopathol 6, 373-380.Potter et al 2010 Cell 141, 536-548.Riabinina et al 2015 Nat Methods 12, 219-222.Robinson et al 2009 Bioinformatics 26, 139-140.Rodriguez et al 2015 Nature 525, 486-490.Sawaya et al 2007 Nature 447, 453-457.Saxena and Caroni 2011 Neuron 71, 35-48.Schneider and Alcalay 2017 Mov Disord 32, 1504-1523.Skene and Grant 2016 Front Neurosci 10, 1-11.Slabbaert et al 2016 J Neurosci 36, 1914-1929.Spillantini et al 1998 Am J Pathol 153, 1359-1363.Spira et al 2001 Ann Neurol 49, 313-319.Stranahan and Mattson 2010 Neural Plast 2010.Sulzer and Surmeier 2013 Mov Disord 28, 41-50.Traag et al 2019 Sci Rep 9, 1-12.Tuthill et al 2013 Neuron 79, 128-140.Valadas et al 2018 Neuron 98, 1155-1169.e6.Venken et al 2006 Science 314, 1747-1751.Venken et al 2011 Nat Methods 8, 737-747.Zeisel et al 2018 Cell 174, 999-1014.e22.Zhou et al 2017 Nat Commun 8, 15295.
Claims
CLAIMS1. An inhibitor of MCTP1, MCTP2, SHANK1, SHANK2, SHANKS, PLOD1, PLOD2, PLODS, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALMS, NLGN4X or NLGN4Y for use as a medicine.
2. An inhibitor of MCTP1, MCTP2, SHANK1, SHANK2, SHANKS, PLOD1, PLOD2, PLODS, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALMS, NLGN4X or NLGN4Y for use in treating or inhibiting progression of a tauopathic disorder or for use in treating or inhibiting a symptom of a tauopathic disorder.
3. The inhibitor according to claim 2 for use according to claim 2, wherein the inhibitor significantly reduces the functional expression of MCTP1, MCTP2, SHANK1, SHANK2, SHANKS, PLOD1, PLOD2, PLODS, FARP1, FARP2, POSTN, TGFBI, TRMP9B, ALKBH8, ACDY4, ACDY2, ACDY7, ACDY8, IGLON5, OPCML, NTM, CALM1, CALMS, NLGN4X or NLGN4Y compared to the functional expression of the gene in the absence of the inhibitor.
4. The inhibitor according to any of claims 2-3 for use according to claim 2, wherein the inhibitor is selected from the group consisting of an antisense oligonucleotide, a gapmer, a siRNA, a shRNA, an antisense oligonucleotide, a zinc-finger nuclease, a meganuclease, a TAL effector nuclease, a CRISPR- Cas effector, an antibody or a fragment thereof binding to synaptogyrin-3, an alpha-body, a nanobody, an intrabody, an aptamer, a DARPin, an affibody, an affitin, an anticalin, and a monobody.
5. The inhibitor according to any of claims 2-4 for use according to claim 2 wherein the tauopathic disorder is selected from the group consisting of Alzheimer's disease, progressive supranuclear palsy (PSP), progressive supranuclear palsy-parkinsonism (PSP-P), Richardson's syndrome, argyrophilic grain disease, corticobasal degeneration Pick's disease, frontotemporal dementia with parkinsonism associated with chromosome 17 (FTDP-17), post-encephalitic parkinsonism, Parkinson's disease complex of Guam, Guadeloupean parkinsonism, Huntington disease, Down's syndrome, dementia pugilistica, familial British dementia, familial Danish dementia, myotonic dystrophy, Hallevorden- Spatz disease, Niemann Pick type C, chronic traumatic encephalopathy, tangle-only dementia, white matter tauopathy with globular glial inclusions, subacute sclerosing panencephalitis, SLC9A6-related mental retardation, non-Guamanian motor neuron disease with neurofibrillary tangles, neurodegeneration with brain iron accumulation, Gerstmann-Straussler-Scheinker disease, frontotemporal lobar degeneration, diffuse neurofibrillary tangles with calcification, chronic traumatic encephalopathy, amyotrophic lateral sclerosis of Guam, amyotrophic lateral sclerosis and parkinsonism-dementia complex, prion protein cerebral amyloid angiopathy, and progressive subcortical gliosis.
6. The inhibitor according to any of claims 2-5 for use according to claim 2 wherein the symptom of the tauopathic disorder is selected from the group of mild cognitive impairment, dementia, cognitive decline, decline of motor function, oculomotor and bulbar dysfunction, synaptic dysfunction, neurotoxicity, neuronal degeneration, neuronal dysfunction, synapse loss, and amyloid deposition.
7. The inhibitor according to claim 6 for use according to claim 2 wherein the synaptic dysfunction is pre-synaptic dysfunction.
8. The inhibitor according to any of claims 2-6 for use according to claim 2, wherein the inhibitor is an oligonucleotide comprising a contiguous nucleotide sequence of at least 15 nucleotides in length.
9. The oligonucleotide according to claim 8 for use according to claim 2, wherein the contiguous nucleotide sequence is 100% complementary to a region within SEQ. ID No. 51-63, 64-68, 69-72, 73-81, 82-88, 96-98, 99-112, 89-95, 162-170, 153-161, 171-176, 177-184, 211-215, 216-221, 222-229, 230-232, 233-243, 244-246, 320, 321-325, 326-336, 311-319, 303-310, 337-343 or 365-372.
10. A pharmaceutical composition comprising the inhibitor or oligonucleotide according to any of the preceding claims.