Methods for Treating Dermatomyositis

Abstract

The present invention relates to methods of using anti-CD26 antibodies and antigen-binding fragments thereof for the treatment of dermatomyositis.

Description

[Technical field]

[0001] The present invention relates to methods of using anti-CD26 antibodies and antigen-binding fragments thereof for the treatment of dermatomyositis. [Background technology]

[0002] background Dermatomyositis (DM) is a type of inflammatory muscle disease characterized by inflammation and degeneration of muscles and skin. Associated symptoms and physical findings can vary widely from case to case, as patients may present with a variety of things. Muscle abnormalities can begin with aching and weakness in the muscles of the trunk, upper arms, buttocks, and thighs (proximal muscles). The muscles become stiff, painful, weak, and eventually show signs of degeneration (atrophy). Affected individuals may have difficulty performing certain functions, such as lifting the arms and / or climbing stairs, or have difficulty speaking and swallowing. Skin abnormalities associated with dermatomyositis often include a distinctive reddish purple rash (heliotrope rash) over the upper eyelids or cheeks, and bridging on the nose in a "butterfly" distribution, as well as on the forehead and scalp. Other characteristic rashes include scaling and redness of the knuckles, elbows, knees, and / or other extensor areas (Gottron papules and signs); abnormal accumulation of fluid in the body tissues around the eyes (edema); and / or other characteristics. Symptoms of childhood (juvenile) dermatomyositis (JDM) are similar to those associated with the adult form of the disorder; however, onset is usually more sudden. In addition, abnormal accumulation of calcium deposits (calcification) in muscle and skin tissues as well as gastrointestinal complications are more common in JDM.

[0003] Treatment of dermatomyositis is directed at the specific symptoms presented to each individual and may therefore vary from patient to patient. In general, treatment of muscle complications associated with dermatomyositis requires the use of glucocorticoids. Treatment of skin manifestations associated with dermatomyositis includes sun avoidance, sunscreens, topical glucocorticoids, antimalarials, methotrexate, mycophenolate mofetil and / or intravenous immunoglobulin (IVIg).

[0004] Glucocorticoids, especially prednisone, are a common and frequently used first-line treatment for dermatomyositis. Similar to the natural hormone produced in the outer region of the adrenal gland, such medications are often used to reduce inflammation and associated swelling and also help suppress the immune response.

[0005] High-dose glucocorticoid treatment, especially after long-term use, can produce adverse side effects such as brittle and weakened bones (osteoporosis), loss of bone density; increased muscle weakness "overridden" by the effects of the drug (i.e., corticosteroid myopathy); tissue swelling (edema); peptic ulcers; elevated blood pressure; elevated blood sugar levels; weight gain or other findings with fat deposits in the abdomen, face, and / or back of the neck. Summary of the Invention [Problem to be solved by the invention]

[0006] Thus, there is a need in the art for improved methods of treating dermatomyositis. [Means for solving the problem]

[0007] overview The present invention provides a method of treating dermatomyositis in a subject, comprising administering to the subject a therapeutically effective amount of an anti-CD26 antibody, wherein the antibody is administered in an amount of 16 mg / m 2 / day once daily for 5 days, followed by 3 times weekly for a total of 16 doses.

[0008] The present invention also provides a method for reducing levels of dermatomyositis-associated cytokines in a subject, comprising administering to the subject a therapeutically effective amount of an anti-CD26 antibody, wherein the antibody is administered at a concentration of 16 mg / m 2 / day once daily for 5 days, then three times weekly for a total of 16 doses.

[0009] In some embodiments, the dermatomyositis associated cytokine is tumor necrosis factor-alpha (TNFα), interleukin-1β (IL-1β), interleukin-6 (IL-6), interleukin-17 (IL-17), interleukin-21 (IL-21), interferon-alpha (IFNα), or interferon-gamma (IFNγ).

[0010] In some embodiments, the anti-CD26 antibody is a full-length antibody. In other embodiments, the antibody is a monoclonal, human, humanized, chimeric, multivalent antibody or an antigen-binding fragment thereof.

[0011] In some embodiments, the antibody has an isotype selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgM, IgA, IgD and IgE. In other embodiments, the antibody has an IgG2b isotype. In other embodiments, the anti-CD26 antibody is vegelomab, 1F7 or CM03. In other embodiments, the anti-CD26 antibody is produced in Chinese Hamster Ovary (CHO) cells. In other embodiments, the anti-CD26 antibody is produced from a hybridoma cell line deposited at the CBA-ICLC in Genoa (Italy) under the accession number PD 12002.

[0012] In one embodiment, the anti-CD26 antibody (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:7; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:8; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:9; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 10; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 11; and (f) a light chain variable region CDR3 comprising the sequence shown in SEQ ID NO: 12 In other embodiments, the anti-CD26 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 3 and 5, respectively. In other embodiments, the anti-CD26 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively.

[0013] In some embodiments, the methods of the invention further comprise administering glucocorticoid and / or immunosuppressant therapy, hi other embodiments, the immunosuppressant therapy comprises administration of methotrexate, azathioprine, or mycophenolate. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0014] Detailed Description So that the present invention may be more readily understood, certain terms are first defined. As used in this application, unless expressly indicated otherwise, each of the following terms has the meaning indicated below. Additional definitions are set forth throughout this application.

[0015] definition An "antibody" (Ab) includes, but is not limited to, a glycoprotein immunoglobulin that specifically binds an antigen and comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds. Each H chain comprises a heavy chain variable region (herein referred to as V H The heavy chain constant region includes three constant domains, C H1 , C H2 and C H3 Each light chain comprises a light chain variable region (herein V L The light chain constant region comprises one constant domain, C L Includes: V H and V L The regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). H and V Lcomprises three CDRs and four FRs arranged in the following order from amino-terminus to carboxy-terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains comprise a binding domain that interacts with an antigen. The constant region of the antibody may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system. The heavy chain may or may not have a C-terminal lysine. Unless otherwise stated herein, the amino acids of the variable region are numbered using the Kabat numbering system and those of the constant region are numbered using the EU system. In some embodiments, the antibody is an intact antibody.

[0016] Immunoglobulins may be derived from any of the commonly known isotypes, including, but not limited to, IgA, secretory IgA, IgG, and IgM. IgG subclasses are also well known in the art, including, but not limited to, human IgG1, IgG2, IgG3, and IgG4. "Isotype" refers to the antibody class or subclass (e.g., IgM or IgG1) encoded by the heavy chain constant region genes. The term "antibody" includes, by way of example, monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human or non-human antibodies; fully synthetic antibodies; and single-chain antibodies. Non-human antibodies may be humanized by recombinant methods to reduce immunogenicity in humans. Unless expressly stated and unless otherwise indicated by context, the term "antibody" includes monospecific, bispecific, multivalent or multispecific antibodies and single-chain antibodies.

[0017] As used herein, an "IgG antibody" has the structure of a naturally occurring IgG antibody, i.e., has the same number of heavy and light chains and disulfide bonds as a naturally occurring IgG antibody of the same subclass. For example, an anti-CD26 IgG1, IgG2, IgG3 or IgG4 antibody consists of two heavy chains (HC) and two light chains (LC), in which the two heavy and light chains are linked by the same number and positions of disulfide bridges as naturally occurring IgG1, IgG2, IgG3 and IgG4 antibodies, respectively (unless the antibody has been mutated to modify the disulfide bonds).

[0018] An "isolated antibody" refers to an antibody that is substantially free of other antibodies having different antigen specificities (e.g., an isolated antibody that specifically binds to CD26 is substantially free of antibodies that specifically bind to antigens other than CD26). However, an isolated antibody that specifically binds to CD26 may have cross-reactivity with other antigens, such as CD26 molecules from different species. Furthermore, an isolated antibody may be substantially free of other cellular material and / or chemicals.

[0019] The antibody may be an antibody that has been modified (e.g., by mutation, deletion, substitution, conjugation to a non-antibody moiety). For example, the antibody may contain one or more variant amino acids (compared to naturally occurring antibodies) that alter the properties (e.g., functional properties) of the antibody. Numerous such modifications are known in the art, for example, that affect the half-life in a patient, effector functions, and / or immune response to the antibody. The term antibody also includes artificial polypeptide constructs that contain at least one antibody-derived antigen-binding site.

[0020] The term "monoclonal antibody" ("mAb") refers to a non-naturally occurring preparation of antibody molecules of single molecular composition, i.e., essentially identical in primary sequence and displaying a single binding specificity and affinity for a particular epitope. mAbs are an example of an isolated antibody. MAbs may be produced by hybridoma, recombinant, transgenic, or other techniques known to those skilled in the art.

[0021] A "human" antibody (HuMAb) refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, when the antibody contains a constant region, the constant region is also derived from a human germline immunoglobulin sequence. The human antibodies of the invention may contain amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term "human antibody" as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. The terms "human" antibody and "fully human" antibody are used interchangeably.

[0022] "Humanized antibody" refers to an antibody in which some, most or all of the amino acids outside the CDR domain of a non-human antibody are replaced with the corresponding amino acids from human immunoglobulin. In some embodiments of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domain are replaced with amino acids from human immunoglobulin, while some, most or all of the amino acids in one or more CDR regions remain unchanged. Small enrichments, deletions, insertions, substitutions or modifications of amino acids are tolerated as long as they do not eliminate the ability of the antibody to bind to a specific antigen. A "humanized" antibody retains antigen specificity similar to that of the original antibody.

[0023] "Chimeric antibody" refers to an antibody in which the variable region is derived from one species and the constant region is derived from another species, such as an antibody in which the variable region is derived from a mouse antibody and the constant region is derived from a human antibody.

[0024] An "anti-antigen" antibody refers to an antibody that specifically binds to the antigen. For example, an anti-CD26 antibody specifically binds to CD26.

[0025] An "antigen-binding portion" (also referred to as an "antigen-binding fragment") of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to the antigen bound by the whole antibody. It has been shown that the antigen-binding function of an antibody can be performed by fragments or portions of a full-length antibody. Examples of binding fragments encompassed by the term "antigen-binding portion" or "antigen-binding fragment" of an antibody, e.g., an anti-CD26 antibody described herein, are: (1) Fab fragment (a papain cleavage-derived fragment) or a similar monovalent fragment consisting of the VL, VH, LC, and CH1 domains; (2) F(ab')2 fragment (pepsin cleavage-derived fragment) or similar bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (3) an Fd fragment consisting of the VH and CH1 domains; (4) Fv fragment consisting of the VL and VH domains of a single arm of an antibody; (5) single-domain antibody (dAb) fragment consisting of a VH domain (Ward et al., (1989) Nature 341:544-46); (6) Bisingle-domain antibodies consisting of two VH domains linked by a hinge (dual-affinity retargeting antibodies (DART)); (7) dual variable domain immunoglobulin; (8) an isolated complementarity determining region (CDR); and (9) A combination of two or more isolated CDRs, optionally connected by a synthetic linker. Furthermore, the two domains of the Fv fragment, VL and VH, are encoded by separate genes, but can be connected by a synthetic linker that allows them to be produced as a single protein chain in which the VL and VH regions are paired to form a monovalent molecule using recombinant methods (known as single-chain Fv (scFv); see Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single-chain antibodies are also intended to be encompassed by the term "antigen-binding portion" or "antigen-binding fragment" of an antibody. These antibody fragments are obtained using conventional techniques known to those skilled in the art, and the fragments are screened for their utility in the same manner as intact antibodies. Antigen-binding portions can be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact immunoglobulins. In certain embodiments, the antibody is an antigen-binding fragment.

[0026] The term "CD26" refers to dipeptidyl peptidase 4 (DPP4). The terms CD26 and DPP4 are used interchangeably herein. The term "CD26" includes variants, isoforms, homologs, orthologs, and paralogs. For example, an antibody specific for human CD26 protein may cross-react with CD26 protein from species other than human in some cases. In other embodiments, an antibody specific for human CD26 protein may be completely specific for human CD26 protein and may not show species or other types of cross-reactivity, or may cross-react with some other species but not all other species (e.g., cross-react with monkey CD26 but not with mouse CD26). The term "human CD26" refers to human sequence CD26, such as the complete amino acid sequence of human CD26 having GenBank Accession No. AH005372.3. The human CD26 sequence can differ from human CD26 of GenBank Accession No. AH005372.3, for example, by having conservative mutations or mutations in non-conserved regions, and the CD26 has substantially the same biological function as human CD26 of GenBank Accession No. AH005372.3.

[0027] A particular human CD26 sequence generally has at least 90% amino acid sequence identity with human CD26 of GenBank Accession No. AH005372.3 and contains amino acid residues that identify the amino acid sequence as human when compared with the CD26 amino acid sequence of other species (e.g., mouse). In some cases, human CD26 may have at least 95% or at least 96%, 97%, 98% or 99% amino acid sequence identity with CD26 of GenBank Accession No. AH005372.3. In some embodiments, human CD26 sequence does not show more than 10 amino acid differences with CD26 sequence of GenBank Accession No. AH005372.3. In some embodiments, human CD26 may not show more than 5 or more than 4, 3, 2 or 1 amino acid differences with CD26 sequence of GenBank Accession No. AH005372.3.

[0028] "Percent (%) amino acid sequence identity" with respect to the polypeptide sequences shown herein is defined as the percentage of amino acid residues in the candidate sequence of interest to be compared that are identical to the amino acid residues of a particular polypeptide sequence shown herein (e.g., a particular polypeptide sequence characterized by a sequence identifier in the sequence listing), after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity and without considering any conservative substitutions as part of the sequence identity. Sequence alignment performed to determine percent amino acid sequence identity can be performed by methods known in the art, for example as described in EP1241179B1, which is incorporated herein by reference, including, in particular, page 9, line 35 to page 10, line 40, including Table 1 related to the definitions and possible conservative substitutions used herein. For example, the skilled artisan can use publicly available computer software. Computer program methods for determining sequence identity include, but are not limited to, BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. According to one embodiment, the software alignment program used can be BLAST. Those skilled in the art can determine the appropriate parameters for measuring alignment, including any algorithms required to achieve maximum alignment over the full length of the sequences being compared. In some embodiments, % identity values ​​can be generated using the WU-BLAST-2 computer program (Altschul et al., 1996, Methods in Enzymology 266:460-480, incorporated herein by reference). In some embodiments, the following parameters are used when running the WU-BLAST-2 computer program: Most of the WU-BLAST-2 search parameters are set to default values. Adjustable parameters are set to the following values: overlap span=1, overlap fraction=0.125, word threshold (T)=11, and scoring matrix=BLOSUM62.The dynamic values ​​HSP S and HSP S2 parameters used in BLAST-2 are established by the program itself, depending on the composition of the sequence of interest and the composition of the database against which the sequence is searched. However, the values ​​can be adjusted to increase sensitivity. The % sequence identity value can be determined by dividing (a) the number of matching identical amino acid residues between the specific amino acid sequence shown herein (e.g., the specific polypeptide sequence characterized by a sequence identifier in the sequence listing) and the candidate amino acid sequence of interest, e.g., the number of matching identical amino acid residues determined by WU-BLAST-2, by (b) the total number of amino acid residues in the polypeptide sequence shown herein (e.g., the specific polypeptide sequence characterized by a SEQ ID NO: in the sequence listing) being compared.

[0029] "Percent (%) nucleic acid sequence identity" with respect to the nucleic acid sequences presented herein is defined as the percentage of nucleotides in the candidate sequence of interest to be compared that are identical to a specific nucleic acid sequence presented herein (e.g., a specific polypeptide sequence characterized by a sequence identifier in the sequence listing) after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for the purpose of determining percent nucleic acid sequence identity can be performed by methods known to those skilled in the art, for example, as described in EP1241179B1. For example, those skilled in the art can use publicly available computer software, such as using computer software available for this process, such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms required to achieve maximum alignment over the full length of the sequences to be compared. According to a preferred embodiment, the % identity value can be generated using the WU-BLAST-2 computer program. According to a preferred embodiment, the following computer programs and parameters are used: The identity values ​​used herein are generated by the BLASTN module of WU-BLAST-2 set to default values, with overlap span and overlap fraction being 1 and 0.125, respectively. A % nucleic acid sequence identity value can be obtained by dividing (a) the number of matching identical nucleotides between a specific nucleic acid sequence (e.g., a specific nucleic acid sequence characterized by a sequence identifier in the sequence listing) and a comparison nucleic acid molecule of interest, e.g., the number of matching identical nucleotides determined by WU-BLAST-2, by (b) the total number of nucleotide residues in the specific nucleic acid sequence (e.g., a specific nucleic acid sequence characterized by a sequence identifier in the sequence listing) shown herein being compared.

[0030] As used herein, a "patient" includes any patient suffering from dermatomyositis. The terms "subject" and "patient" are used interchangeably herein.

[0031] "Administering" refers to the physical introduction of a composition containing a therapeutic agent into a subject using any of a variety of methods and delivery systems known to those skilled in the art. Routes of administration of the formulations disclosed herein include, for example, intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, such as by injection or infusion. As used herein, the term "parenteral administration" refers to methods of administration other than enteral and topical administration, including, but not limited to, intravenous, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intrathecal, epidural and intrasternal injection and infusion, usually by injection, and in vivo electroporation. In some embodiments, the formulation is administered via a non-parenteral route, in some embodiments, orally. Other non-parenteral routes include topical, epithelial or mucosal routes of administration, such as intranasal, vaginal, rectal, sublingual or topical. Administration can be carried out, for example, once, multiple times and / or over one or more extended periods.

[0032] "Treatment" or "treatment" of a subject refers to any type of intervention or process or administration of an active agent performed on a subject for the purpose of reversing, alleviating, ameliorating, preventing, slowing the progression, development, severity or recurrence of a symptom, complication or condition, or biochemical indicators associated with a disease.

[0033] As used herein, "effective treatment" refers to a treatment that produces a beneficial effect, e.g., improves at least one symptom of a disease or disorder. The beneficial effect can take the form of an improvement from baseline, i.e., an improvement from a measurement or observation before the start of treatment with the method.

[0034] The term "effective amount" refers to an amount of an agent that produces a desired biological, therapeutic and / or prophylactic result, which may be reduction, amelioration, alleviation, reduction, delay and / or relief of one or more of the signs, symptoms or causes of a disease or any other desired alteration of a biological system.

[0035] In certain instances, an "effective amount" is an amount of anti-CD26 antibody that has been clinically proven to affect a significant reduction in the inflammatory response of dermatomyositis. As used herein, the terms "fixed dose", "constant dose" and "constant fixed dose" are used interchangeably and refer to a dose administered to a patient regardless of the patient's weight or body surface area (BSA). A fixed or constant dose is thus expressed in mg / m 2 It is not stated as a dose, but rather as an absolute amount of agent (e.g., anti-CD26 antibody). For example, a 60 kg human and a 100 kg human would receive the same dose of a composition (e.g., 100 mg of anti-CD26 antibody).

[0036] As used herein, the term "body surface area based dose" means that the dose administered to a patient is calculated based on the patient's body surface area. For example, a dose of 4 mg / m2 for a patient with a body surface area (BSA) of 2.0 2 When one requires an amount of anti-CD26 antibody, one can deliver an appropriate amount of anti-CD26 antibody (ie, 8 mg).

[0037] As used herein, "dosing interval" refers to the time that elapses between doses of an anti-CD26 antibody disclosed herein being administered to a subject. Thus, the dosing interval can be expressed as a range.

[0038] As used herein, the term "dosing frequency" refers to how often an anti-CD26 antibody disclosed herein is administered over a period of time. Dosing frequency can be expressed as the number of doses per period of time, for example, once a week or once every two weeks.

[0039] The terms "about once a week," "about once every week," "about once every two weeks," or any other similar dosing interval term used herein, mean approximate values, and "about once a week" or "about once every week" can include every 7 days ± 2 days, i.e., every 5 days to every 9 days. Thus, the dosing frequency of "once a week" can be every 5 days, every 6 days, every 7 days, every 8 days, or every 9 days. "About once every two weeks" can include every 14 days ± 3 days, i.e., every 11 days to every 17 days. Similar approximations apply, for example, to about every 3 weeks, about every 4 weeks, about every 5 days, about every 6 weeks, and about every 12 weeks. In certain embodiments, a dosing interval of about once every 6 weeks or about once every 12 weeks means that the first dose can be administered on any day of the first week, and then the next dose can be administered on any day of the sixth or twelfth week, respectively. In other embodiments, a dosing interval of about once every 6 weeks or about once every 12 weeks means that the first dose is administered on a particular day of the week (e.g., Monday) in week 1, and then the next dose is administered on the same day of the week (e.g., Monday) in week 6 or week 12, respectively.

[0040] The term "CD26 positive" or "positive CD26 expression" in relation to CD26 expression refers to the percentage of cells in a test tissue sample, typically including muscle cells, which tissue sample is assessed as expressing CD26.

[0041] "Immune response" refers to the actions of cells of the immune system (e.g., T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells, and neutrophils) and soluble macromolecules produced by these cells or the liver, including antibodies, cytokines, and complement, that result in the selective targeting, binding, damaging, destroying, and / or eliminating from the vertebrate body an invading pathogen, a pathogen-infected cell or tissue, a cancer or other abnormal cell, or, in the case of autoimmunity or pathological inflammation, a normal human cell or tissue.

[0042] The use of the alternative (e.g., "or") should be construed to mean either one, both, or any combination of the alternatives. As used herein, the singular form "a" or "an" should be construed to refer to "one or more" of any cited or listed components.

[0043] The term "and / or" as used herein is to be construed as a specific disclosure of each of two specified properties or components, with or without the other. Thus, the term "and / or" as used herein in phrases such as "A and / or B" is intended to include "A and B," "A or B," "A" (single) and "B" (single). Similarly, the term "and / or" as used in phrases such as "A, B and / or C" is intended to encompass each of the following embodiments: A, B and C; A, B or C; A or C; A or B; B or C; A and C; A and B; B and C; A (single); B (single); and C (single).

[0044] Whenever an embodiment is described herein using the term "comprising," it is understood that otherwise similar embodiments described using the terms "consisting of" and / or "consisting essentially of" are also provided.

[0045] The term "about" or "consists essentially of" refers to a value or composition that is within an acceptable error range of the particular value or composition as determined by one of ordinary skill in the art, which depends, in part, on how the value or composition is measured or determined, i.e., the limits of the measurement system. For example, "about" or "consists essentially of" can mean within one or more standard deviations per practice in the art. Alternatively, "about" or "consists essentially of" can mean within a range of up to 10% or 20% (i.e., ±10% or ±20%). For example, about 3 mg can include any number between 2.7 mg and 3.3 mg (for 10%) or between 2.4 mg and 3.6 mg (for 20%). Furthermore, particularly with respect to biological systems or processes, the term can mean up to an order of magnitude or up to 5 times the value. When a particular value or composition is provided in the specification and claims, unless otherwise indicated, the meaning of "about" or "consists essentially of" is assumed to be within an acceptable error range for that particular value or composition.

[0046] Any concentration range, percentage range, ratio range, or integer range described herein, unless otherwise specified, is intended to include every integer value within the described range and, where appropriate, fractions thereof (e.g., 1 / 10 and 1 / 100 of an integer).

[0047] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by those skilled in the art to which the present invention pertains. For example, Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 5th ed., 2013, Academic Press; and Oxford Dictionary Of Biochemistry And Molecular Biology, 2006, Oxford University Press provide those skilled in the art with a general dictionary of many of the terms used herein.

[0048] Units, prefixes, and symbols are written in the form accepted by the International System of Units (SI). Numerical ranges are inclusive of the numerical values ​​defining the range. The headings provided herein do not limit the various aspects of the invention, which may be read by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.

[0049] Various aspects of the invention are described in further detail in the following subsections.

[0050] CD26 antibody In one embodiment, the present invention relates to a method of using anti-CD26 antibodies in the treatment of dermatomyositis.Anti-human CD26 antibodies (or VH / VL domains derived therefrom) suitable for use in the present invention can be produced by methods well known in the art.Alternatively, art-recognized anti-CD26 antibodies can be used.

[0051] In one embodiment, the anti-CD26 antibody is produced from the hybridoma cell line deposited under the Budapest Treaty at the Centro di Biotecnologie Avanzate (CBA)--Interlab Cell Line Collection (ICLC) of Genoa (L. go R. Benzi, 10, Genoa, Italy) on September 11, 2012 as deposit PD 12002. In another embodiment, the anti-CD26 antibody used in the methods of the invention binds to the same epitope as the antibody produced by the hybridoma cell line deposited at the CBA-ICLC of Genoa (Italy) as PD 12002.

[0052] In one embodiment, the anti-CD26 antibody is begelomab or an antigen-binding fragment or variant thereof comprising a heavy chain and a light chain comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively, as described in U.S. Patents 9,376,498 and 10,208,126, the disclosures of which are incorporated herein by reference.

[0053] In other embodiments, the antibody has the heavy and light chain CDRs or variable regions of vegelomab. Thus, in some embodiments, the antibody comprises the CDR1, CDR2 and CDR3 domains of the VH region of vegelomab having the sequence shown in SEQ ID NO: 3 and the CDR1, CDR2 and CDR3 domains of the VL region of vegelomab having the sequence shown in SEQ ID NO: 5. In other embodiments, the antibody comprises the CDR1, CDR2 and CDR3 domains comprising the sequences shown in SEQ ID NOs: 7, 8 and 9, respectively, and the CDR1, CDR2 and CDR3 domains comprising the sequences shown in SEQ ID NOs: 10, 11 and 12, respectively. In other embodiments, the antibody comprises the VH and / or VL regions comprising the amino acid sequences shown in SEQ ID NO: 3 and / or SEQ ID NO: 5, respectively. In other embodiments, the antibody comprises the heavy chain variable (VH) and / or light chain variable (VL) regions encoded by the nucleic acid sequences shown in SEQ ID NO: 4 and / or SEQ ID NO: 6, respectively. In other embodiments, the antibody competes for binding to CD26 with the above-mentioned antibodies and / or binds to the same epitope. In other embodiments, the antibody has at least about 90% variable region amino acid sequence identity to the above antibodies (eg, at least about 90%, 95% or 99% variable region identity to SEQ ID NO:3 or SEQ ID NO:5).

[0054] In certain embodiments, the anti-CD26 antibody, or antigen-binding portion thereof, cross-competes with vegelomab for binding to human CD26. In other embodiments, the anti-CD26 antibody, or antigen-binding portion thereof, binds to the same epitope as vegelomab.

[0055] In some embodiments, the anti-CD26 antibody is codon-optimized for expression in host cells.In some embodiments, the anti-CD26 antibody is vegelomab that is codon-optimized for expression in Chinese hamster ovary (CHO) cells.In other embodiments, the codon-optimized vegelomab comprises the heavy and light chains of SEQ ID NOs: 15 and 16, respectively.

[0056] In certain embodiments, the anti-CD26 antibody is an antibody or antigen-binding fragment thereof described in U.S. Patent No. 7,658,923 (e.g., 1F7); U.S. Patent No. 7,462,698 (e.g., CM03), U.S. Patent No. 8,771,688, and European Patent No. 3348276A1. Antibodies or antigen-binding fragments thereof that compete for binding to CD26 with any of the art-recognized antibodies mentioned above may also be used.

[0057] In some embodiments, anti-CD26 antibody is used to determine CD26 expression. In some embodiments, anti-CD26 antibody is selected for its ability to bind to CD26 in formalin-fixed, paraffin-embedded (FFPE) tissue specimens. In other embodiments, anti-CD26 antibody can bind to CD26 in frozen tissue. In further embodiments, anti-CD26 antibody can distinguish between membrane-bound, cytoplasmic and / or soluble forms of CD26.

[0058] Immunosuppressants In some embodiments, the method of the present invention relates to the use of one or more glucocorticoids and / or immunosuppressants in combination with anti-CD26 antibody for the treatment of dermatomyositis.In some embodiments, immunosuppressants are considered the standard treatment for dermatomyositis.An "immunosuppressant" is a compound that inhibits or blocks the activity of the immune system.In some embodiments, the immunosuppressant is methotrexate, azathioprine or mycophenolate.

[0059] The glucocorticoid may be an anti-inflammatory agent. As used herein, the term glucocorticoid may include, but is not limited to, methylprednisolone, prednisolone, dexamethasone, betamethasone, fluticasone propionate, budesonide, flunisolide, mometasone furoate, triamcinolone acetonide, rofleponide, ciclesonide, and butixocort propionate.

[0060] In certain embodiments, glucocorticoids or immunosuppressants include pharma- ceutically acceptable salts, acids, or derivatives of any of the above; as well as combinations of two or more of the above.

[0061] Pharmaceutical Compositions Pharmaceutical compositions suitable for administration to human patients are typically formulated, for example, to be suitable for reconstitution with a liquid carrier for parenteral administration or into a liquid solution or suspension for intravenous administration.

[0062] In general, such compositions typically include a pharma- ceutically acceptable carrier. As used herein, the term "pharmaceutical acceptable" means approved by a government regulatory agency or listed in the United States Pharmacopeia or other generally recognized pharmacopoeias for use in animals, particularly humans. The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, including peanut oil, soybean oil, mineral oil, sesame oil, glycerol polyethylene glycol ricinoleate, and the like. Water or saline solutions and aqueous dextrose and glycerol solutions can be used as carriers, particularly for injectable solutions (e.g., containing anti-CD26 antibodies). Liquid compositions for parenteral administration can be formulated for administration by injection or continuous infusion. Routes of administration by injection or infusion include intravenous, intraperitoneal, intramuscular, intrathecal, and subcutaneous. In some embodiments, the anti-CD26 antibody is administered intravenously.

[0063] Methods of the Invention In one embodiment, the present invention relates to a method for investigating the pharmacokinetics, pharmacodynamics, safety and clinical activity of anti-CD26 antibody (e.g., begelomab) as an initial treatment of dermatomyositis in combination with standard glucocorticoid and / or immunosuppressant therapy.In one embodiment, the immunosuppressant therapy is methotrexate, azathioprine or mycophenolate administration.The study is designed to investigate the pharmacokinetics, pharmacodynamics, safety and clinical activity of anti-CD26 antibody (e.g., begelomab) as an initial treatment of dermatomyositis in combination with standard glucocorticoid and / or immunosuppressant therapy. EXAMPLES

[0064] Overall study design and planning details Test Design This is a multicenter, randomized, double-blind, placebo-controlled, two-period, crossover, Phase II study aimed at evaluating the efficacy and safety of begelomab in combination with standard steroid and / or immunosuppressant therapy in the treatment of patients with dermatomyositis.

[0065] Twenty patients will be enrolled in two arms receiving glucocorticoid and / or immunosuppressant therapy (azathioprine, mycophenolate, methotrexate) in combination with begelomab or placebo. At the end of the first treatment period, patients will be crossed over to the other treatment arm, regardless of disease status. A three-month washout period will be planned between the two treatment periods.

[0066] This is a 2 x 2 crossover design trial. A 3-month washout period is planned between each treatment period to avoid carryover of effects of the first treatment into the second treatment.

[0067] A 3-month follow-up is planned at the end of the entire treatment period. Screening to confirm eligibility must occur no earlier than 1 week prior to the baseline visit (days -7 to 0).

[0068] Treatment period The experimental phase of the study consisted of two 1-month treatment periods, each separated by a 3-month washout period.

[0069] Each treatment period consisted of a 5-day induction phase in which begelomab was administered daily, followed by a maintenance phase in which begelomab was administered three times weekly (on Mondays, Wednesdays, and Fridays) for a total of 11 doses. Therefore, each treatment period consisted of 16 doses of begelomab (5 inductions and 11 maintenances).

[0070] A washout period separates the two treatment periods. Safety and disease evaluations are performed at the beginning of the second and third months of the washout period (M2 and M3 from the start of treatment).

[0071] The follow-up period will consist of the last 3 months of the study. Monthly visits will be scheduled.

[0072] Test Purpose The main goal of the clinical trial is To evaluate the efficacy of adding begelomab to glucocorticoid and / or immunosuppressant therapy (methotrexate, azathioprine, mycophenolate) compared with glucocorticoid and / or immunosuppressant plus placebo in the treatment of patients with dermatomyositis (DM). It is.

[0073] The secondary objective of the clinical trial is - Assessment of improvement in skin symptoms in the begelomab arm compared with placebo; · Evaluation of the safety and tolerability of multiple doses of begelomab compared with placebo in patients with dermatomyositis; To assess whether treatment with begelomab compared with placebo improves the quality of life in patients with dermatomyositis; To evaluate whether treatment with begelomab can reduce or stably maintain glucocorticoid / immunosuppressant therapy. It is.

[0074] The exploratory purpose of the clinical trial is To evaluate whether treatment with Begelomab can reduce dermatomyositis-associated cytokine / chemokine levels (TNFα, IL-1β, IL-6, IL-17, IL-21, IFNγ, IFNα) It is.

[0075] Study Endpoints The primary endpoint of the study was assessment of the mean difference (begelomab vs. placebo) in the International Myositis Assessment and Clinical Studies Group (IMACS) total improvement score at Day 31 of each treatment period.

[0076] The secondary endpoint is Number of subjects achieving IMACS Definition of Improvement (IMACS DOI) at Day 31 of each treatment period in the begelomab arm compared to placebo. IMACS DOIs are ≥ 20% improvement from baseline in 3 IMACS core measures AND No more than two IMACS core measure scores worsening by ≥25% from baseline AND Manual Muscle Testing (MMT-8) scores do not decrease by ≥25% from baseline. Change from baseline in Dermatomyositis Disease Area and Severity Index (CDASI) activity score at Day 31 of each treatment period and for M2 / M6 in the vegelomab arm compared to placebo. · Mean difference in International Myositis Assessment and Clinical Studies Group (IMACS) total improvement score for M2 / M6 in the vegelomab arm compared to placebo. Change from baseline in HAQ (Health Assessment Questionnaire) or PGA (Patient Global Activity) scores at Day 31 of each treatment period and at M2 / M6 in the vegelomab arm compared to placebo. Number of subjects who changed (increased or tapered) glucocorticoid / immunosuppressant treatment (vegelomab vs. placebo). Proportion of participants with treatment-related adverse events (TRAEs) at Days 15 and 31 of each treatment period It is. Exploratory endpoints were (vegelomab vs. placebo): Change from baseline in DM-associated cytokine / chemokine levels (TNFα, IL-1β, IL-6, IL-17, IL-21, IFNγ, IFNα) at ​​day 31 of each treatment period and in M2 / M6 in the vegelomab arm compared to placebo It is.

[0077] Study population The study population included patients aged 18 years or older, regardless of gender, diagnosed with DM.

[0078] Only patients who sign an informed consent form, meet all inclusion criteria, and do not meet any exclusion criteria will be included in the study. Admission Criteria

[0079] To be eligible to participate in this study, each patient must meet all of the following inclusion criteria: - Written informed consent prior to the start of any relevant study. Men and women aged ≥ 18 and ≤ 80 years · Suspected or confirmed diagnosis of DM according to the Bohan and Peter criteria (1975) or ACR / EULAR criteria (Lundberg et al, 2017). Although not required, patients with muscle weakness are eligible to enroll. Those with active muscle weakness have a manual muscle testing (MMT-8) score of <142 out of 150. Active skin disease as defined by a CDASI score ≥ 5. Stable glucocorticoid treatment for DM with a stable dose of ≤0.5 mg / kg methylprednisolone or prednisolone or equivalent for ≥4 weeks prior to randomization (Day 1). Stable immunosuppressant treatment for DM for ≥ 4 weeks prior to randomization (Day 1), where stable treatment is defined as: · Patients currently treated with oral or subcutaneous methotrexate (MTX) must be on a stable dose of ≤25 mg per week. · Patients currently treated with oral azathioprine (AZA) must be on a stable dose of ≤ 3 mg / kg / day. Patients currently on oral mycophenolate (MMF) must be on a stable dose of ≤3 g / day. Patients undergoing the following procedures may be enrolled only if they are able to discontinue the medication prior to the screening visit: Rituximab: 9 months (Note: Patients receiving rituximab are eligible only if B-cell counts are confirmed to be within normal limits) Intravenous immunoglobulin (IVIG): 3 months Female subjects must meet one of the following criteria: · Surgical sterilization (total hysterectomy, tubal ligation and / or bilateral oophorectomy or tubal occlusion at least 6 months prior to the first dose) or documented congenital infertility. Postmenopausal: Absence of menses for at least 12 months prior to screening and serum follicle-stimulating hormone (FSH) measurement to confirm postmenopausal status at the time of screening. · Females of childbearing potential must agree to use adequate contraception to avoid pregnancy during the course of the study (or for at least 3 months after the last dose of study drug, whichever is longer). Acceptable methods of contraception include hormonal methods of contraception by oral, injected or implant, placement of an intrauterine device (IUD) or intrauterine system (IUS), barrier methods of contraception: condoms or occlusive caps (diaphragm or cervical / fornix cap) with spermicidal foam / gel / film / cream / suppository. Abstinence is considered an acceptable form of contraception only if it is part of the individual's usual lifestyle. Male patients who are surgically sterilized (vasectomy) or who are willing to agree to true abstinence (abstain from heterosexual intercourse) for the entire duration of study treatment and for 3 months after the last dose of study drug, or who use a barrier method of contraception. Patients' partners are allowed to use oral contraception instead. Women must have a negative pregnancy test at screening and baseline and must not be breastfeeding. Subjects must be willing and able to comply with the conditions of the study, clinic attendance, and return to the clinic for follow-up evaluations as specified in this protocol for the duration of the study.

[0080] Investigational Products In this study, the investigational medicinal product (IMP) is vegelomab, a murine monoclonal IgG2b antibody against CD26 produced by a hybridoma cell line.

[0081] Vegelomab is provided as a concentrated solution for iv infusion. The excipient present in Vegelomab is Dulbecco's Phosphate Buffered Saline (DPBS). The composition is set forth in Table 1 in the master formulation. [Table 1]

[0082] The matching placebo will be identical to the test product except for the murine monoclonal antibody vegelomab.

[0083] 16 mg / m 2 The 16 mg / m dose level was selected for this study because PK / PD modeling from the ADN014 study in patients with acute graft-versus-host disease (aGvHD) showed that this dose level provided near-maximal CD26 occupancy of CD26+ T lymphocytes in the central compartment and substantial (70-75%) suppression of soluble CD26 in serum. Systemic exposure at this dose level is approximately 10% of the NOAEL exposure in nonclinical safety studies. 2 Dose levels are safe and well tolerated in patients with aGvHD.

[0084] 16 mg / m 2 In , once-daily dosing of begelomab is associated with a 5- to 6-fold serum accumulation on days 1 to 5, whereas trough levels suggest that dosing on alternate days corresponds to a steady-state situation without further serum accumulation. Interindividual variability in exposure was mild, and no clear correlation between clearance and demographic or phenotypic modifiers was observed. Data from the ADN014 study show that occupancy correlated closely with begelomab serum levels, exhibited relatively fast on- and off-kinetics, and required at least alternate-day dosing to maintain occupancy and suppress soluble CD26 levels.

[0085] During the induction phase, patients received 16 mg / m 2 Patients will receive begelomab or matching placebo once daily for 5 days (days 1-5). During the maintenance phase, patients will receive 16 mg / m 2Patients will receive either begelomab or a matching placebo three times a week (Monday, Wednesday, and Friday) plus 11 more doses (on days 8, 10, 12, 15, 17, 19, 22, 24, 26, 29, and 31) for a total of 16 doses.

[0086] A 12-week washout period will follow 32 days after the end of the first treatment period. Upon completion of the washout period, patients randomized to vegelomab in the first treatment period will begin receiving placebo, and patients randomized to placebo in the first treatment period will begin receiving vegelomab 16 mg / m 2 During the second treatment period, patients continue with the 16 assigned treatments according to the scheme used in treatment period 1. [Table 2]

[0087] Placebo vials, identical in appearance and indistinguishable from the active treatment vegelomab, will be used in the study. Placebo will be administered to each patient for two periods according to a randomization list. Administration, compliance and accountability will be identical to the procedures applied for the active substance vegelomab, as this is a double-blind study.

[0088] Prior and Concurrent Treatment Prior treatment refers to medications that were started within 4 weeks prior to screening and discontinued before the first dose of study treatment. Concurrent medications refer to medications that are started before the first dose of study treatment and continued thereafter or taken at any time between the first dose of study treatment and the follow-up visit.

[0089] The use of all concurrent medications or procedures, whether permitted or prohibited, will be recorded in the electronic data capture system (EDC) until the end of the study (including the follow-up phase).

[0090] During the study, any concomitant medications deemed necessary for the subject's welfare may be given at the discretion of the Investigator. However, it is the Investigator's responsibility to ensure that details regarding medications are fully recorded in the EDC. The minimum requirement is a record of drug name, dose, indication and date of administration. Any changes in concomitant medications will also be recorded in the EDC.

[0091] Unauthorized medicines The following medications are not permitted during the study (their use is a significant deviation and should be recorded as such) and concurrent use during screening will result in subject exclusion: Systemic corticosteroid treatment for indications other than DM; topical steroid application is permitted. · No increase in glucocorticoid treatment for DM (methylprednisolone, prednisolone or equivalent) dosage of more than 0.2 mg / kg will be allowed during the study: if the dosage is increased for any reason, the patient will be removed from the study. Any medication for the treatment of DM other than begelomab or stable immunosuppressant therapy (methotrexate, azathioprine, and mycophenolate). · Dosage increases of immunosuppressant treatments (methotrexate, azathioprine and mycophenolate) beyond those permitted at study entry will not be permitted during the study: if for any reason the dosage is increased above that threshold, the patient will be removed from the study. Any other investigational product in the 4 weeks prior to enrollment and during study participation.

[0092] Permitted medicines The following medications are permitted during the study: Glucocorticoid treatment for DM at a stable dose of 0.2mg / kg methylprednisolone, prednisolone or equivalent. Dosage increases of glucocorticoid treatment above this concentration will not be allowed during the study. · Concurrent or additional use of topical steroid treatments (skin creams, inhaled beclomethasone and other non-absorbable steroids) is permitted. Stable immunosuppressant treatments for DM are: · Oral or subcutaneous methotrexate at a stable dose of ≤25 mg per week. · Oral azathioprine at a stable dose of ≤3 mg / kg / day. · Oral mycophenolate at a stable dose of ≦3gr / day. · Increased doses of immunosuppressant therapy above this concentration will not be permitted during the study.

[0093] array SEQ ID NO: 1 Heavy chain constant region amino acid sequence; anti-CD26 mAb (vegelomab) AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSG LYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPA PNLEGGPSVFIFPPPNIKDVLMISLTPKVTCVVVDVSEEDDPDVQISWFVNNVEVHTAQTQT HREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYIL PPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLN MKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

[0094] SEQ ID NO: 2 Light chain constant region amino acid sequence; anti-CD26 mAb (vegelomab) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQD SKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

[0095] SEQ ID NO: 3: Heavy chain variable region (VH) amino acid sequence; anti-CD26 mAb (Vegelomab) QVQLQQSGAELVKPGASVKLSCKASGYTFRSYDINWVRQRPEQGLEWIGWIFPGDGSTKY NEKFKGKATLTTDKSSSTAYMQLSRLTSEDSAVYFCARWTVVGPGYFDVWGAGTTVTVSS

[0096] SEQ ID NO: 4 Heavy chain variable region (VH) nucleotide sequence; anti-CD26 mAb (Vegelomab) caggtccagctgcagcagtctggagctgaactggtaaagcctggggcttcagtgaagttgtcctgcaaggcttctggctacaccttcagaagttatgatataaactgggtgagacagaggcctgaacagggacttgagtggattggatggatttttcctggagatggtagtactaagtac aatgagaagttcaagggcaaggccacactgactacagacaaatcctccagcacagcctacatgcagctcagcaggctgacatctgaggactctgctgtctatttctgtgcaagatggacggtagtaggcccagggtacttcgatgtctggggcgcagggaccacggtcaccgtctcctca

[0097] SEQ ID NO: 5: Light chain variable region (VL) amino acid sequence; anti-CD26 mAb (vegelomab) QIVLTQSPAIMSASPGEKVTITCSASSSVSYMNWFQQKPGTSPKLWIYSTSNLASGVPAR FSGSGTSYSLTISRMEAEDAATYYCQQRSSYPNTFGGGTKLEIK

[0098] SEQ ID NO:6 Light chain variable region (VL) nucleotide sequence; anti-CD26 mAb (Vegelomab) Caaattgttctcacccagtctccagcaatcatgtctgcatctccaggggagaaggtcaccataacctgcagtgccagctcaagtgtaagttacatgaactggttccagcagaagccaggcacttctcccaaactctggatttatagcacctccaacctg gcttctggagtccctgctcgcttcagtggcagtggatctgggacctcttactctctcacaatcagccgaatggaggctgaagatgctgccacttattactgccagcaaaggagtagttacccgaacacgttcggaggggggaccaagctggaaataaaa

[0099] SEQ ID NO: 7 Heavy chain CDR1 amino acid sequence; anti-CD26 mAb (Vegelomab) GYTFRSYDIN

[0100] SEQ ID NO:8 Heavy chain CDR2 amino acid sequence; anti-CD26 mAb (Vegelomab) WIFPGDGSTKYNEKFK

[0101] SEQ ID NO: 9 Heavy chain CDR3 amino acid sequence; anti-CD26 mAb (Vegelomab) WTVVGPGYFDV

[0102] SEQ ID NO: 10 Light chain CDR1 amino acid sequence; anti-CD26 mAb (vegelomab) SASSSVSYMN

[0103] SEQ ID NO: 11 Light chain CDR2 amino acid sequence; anti-CD26 mAb (Vegelomab) STSNLAS

[0104] SEQ ID NO: 12 Light chain CDR3 amino acid sequence; anti-CD26 mAb (Vegelomab) QQRSSYPNT

[0105] SEQ ID NO: 13 Heavy chain constant region nucleotide sequence; anti-CD26 mAb (vegelomab) gccaaaacaacacccccatcagtctatccactggcccctgggtgtggagatacaactggttcctccgtgactctgggatgcctggtcaagggctacttccctgagtcagtgactgtgacttggaactctg gatccctgtccagcagtgtgcacaccttcccagctctcctgcagtctggactctacactatgagcagctcagtgactgtcccctccagcacctggccaagtcagaccgtcacctgcagcgttgctcaccc agccagcagcaccacggtggacaaaaaacttgagcccagcgggcccatttcaacaatcaacccctgtcctccatgcaaggagtgtcacaaatgcccagctcctaacctcgagggtggaccatccgtcttc atcttccctccaaatatcaaggatgtactcatgatctccctgacacccaaggtcacgtgtgtggtggtggatgtgagcgaggatgacccagacgtccagatcagctggtttgtgaacaacgtggaagtac acacagctcagacacaaacccatagagaggattacaacagtactatccgggtggtcagcaccctccccatccagcaccaggactggatgagtggcaaggagttcaaatgcaaggtcaacaacaaagacctcccatcacccatcgagagaaccatctcaaaaattaaagggctagtcagagctccacaagtatacatcttgccgccaccagcagagcagttgtccaggaaagatgtcagtctcacttgcctggtcgtgggcttcaaccctggagacatcagtgtggagtggaccagcaatgggcatacag aggagaactacaaggacaccgcaccagtcctggactctgacggttcttacttcatatatagcaagctcaatatgaaaacaagcaagtgggagaaaacagattccttctcatgcaacgtgagacacgaggtctgaaaaattactacctgaagaagaccatctcccggtctccgggtaaa

[0106] SEQ ID NO: 14 Light chain constant nucleotide sequence; anti-CD26 mAb (vegelomab) cgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctaccccaaagacatcaatgtcaagtggaagatgatggcagtgaacgacaaaatggcgtcctga acagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacgttgaccaaggacgagtatgaacgacataacagttatacctgtgaggccactcacaagacatcaacttcacccattgtcaagagcttcaacaggaatgagtgt

[0107] SEQ ID NO: 15 Heavy chain nucleotide sequence; anti-CD26 mAb (Vegelomab-CHO optimized)

[0108] Sequence number 16 Light chain nucleotide sequence; anti-CD26 mAb (Bergelomab-CHO optimization) Cagatcgtgcttacccaatccccggcgattatgtcagccagccccggagaaaaggtcaccattacttgctcggcatcctcctccgtgtcgtacatgaactggttccagcaaaagcccggcactagcccaaagctgtggatctattccacgtccaacctggcgtcaggagtgcctgcccgcttttcgggttctggcagcgggactagctactccctcaccatctcgagaatggaagctgaggacgccgccacctactactgtcagcagcggtcctcctacccgaacaccttcgggggaggcaccaaactggagatcaaacgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttcttgaacaacttctaccccaaagacatcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctgaacagttggactgatcaggacagcaaagacagcacctacagcatgagcagcaccctcacgttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcacaagacatcaacttcacccatcgtcaagagcttcaacaggaatgagtgt

Claims

1. A pharmaceutical composition for treating dermatomyositis in a subject, comprising an anti-CD26 antibody, wherein the amount of the anti-CD26 antibody is 16 mg / m ２ The pharmaceutical composition is administered to a subject at a dose of 1 / day once daily for 5 days, followed by 3 times a week for a total of 16 doses.

2. A pharmaceutical composition for reducing dermatomyositis-associated cytokine levels in a subject, comprising an anti-CD26 antibody, wherein the amount of the anti-CD26 antibody is 16 mg / m ２ The pharmaceutical composition is administered to a subject at a dose of 1 / day once daily for 5 days, followed by 3 times a week for a total of 16 doses.

3. 3. The pharmaceutical composition of claim 2, wherein the dermatomyositis-associated cytokine is tumor necrosis factor-alpha (TNFα), interleukin-1β (IL-1β), interleukin-6 (IL-6), interleukin-17 (IL-17), interleukin-21 (IL-21), interferon-alpha (IFNα), or interferon-gamma (IFNγ).

4. The pharmaceutical composition of claim 1 or 2, wherein the anti-CD26 antibody is a full-length antibody.

5. 3. The pharmaceutical composition of claim 1 or 2, wherein the antibody is a monoclonal antibody, a human antibody, a humanized antibody, a chimeric antibody, a multivalent antibody, or an antigen-binding fragment thereof.

6. 3. The pharmaceutical composition of claim 1 or 2, wherein the antibody has an isotype selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgM, IgA, IgD and IgE.

7. 7. The pharmaceutical composition of claim 6, wherein the antibody has an IgG2b isotype.

8. The pharmaceutical composition of claim 1 or 2, wherein the anti-CD26 antibody is begelomab, 1F7, or CM03.

9. 9. The pharmaceutical composition of claim 8, wherein the anti-CD26 antibody is produced in Chinese hamster ovary (CHO) cells.

10. 3. The pharmaceutical composition of claim 1 or 2, wherein the anti-CD26 antibody is produced from the hybridoma cell line deposited at the CBA-ICLC in Genoa (Italy) under accession number PD 12002.

11. Anti-CD26 antibody (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:7; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:8; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:9; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 10; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 11; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 12 3. The pharmaceutical composition of claim 1 or 2, comprising:

12. 3. The pharmaceutical composition of claim 1 or 2, wherein the anti-CD26 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 3 and 5, respectively.

13. 3. The pharmaceutical composition of claim 1 or 2, wherein the anti-CD26 antibody comprises a heavy chain and a light chain comprising the sequences shown in SEQ ID NOs: 1 and 2, respectively.

14. 3. The pharmaceutical composition of claim 1 or 2, administered in combination with glucocorticoid and / or immunosuppressant therapy.

15. 15. The pharmaceutical composition of claim 14, wherein the immunosuppressant therapy comprises administration of methotrexate, azathioprine, or mycophenolate.