Novel IL27 receptor agonists and methods of use thereof

Abstract

The present disclosure relates to IL27 receptor agonists with improved therapeutic profiles.

Description

[Technical field]

[0001] The present invention relates to novel IL27 receptor agonists and methods of using same. [Background technology]

[0002] Interleukin-27 (IL27 or IL-27) is a heterodimeric cytokine composed of two subunits: Epstein-Barr virus-induced gene 3 (EBI3) and IL27p28 (p28). IL27 is structurally related to both the IL27 and IL6 cytokine families. IL27 binds to and mediates signal transduction through a receptor complex composed of gp130 and IL27Ra (WSX1), which activates Janus kinase (JAK)-signal transducer and activator of transcription (STAT) and mitogen-activated protein kinase (MAPK) signal transduction (Non-Patent Document 1).

[0003] IL27 was initially reported as an immune-enhancing cytokine, but subsequent studies demonstrated that IL27 exhibits complex immunoregulatory functions (reviewed in Non-Patent Document 2). As a result of its pleiotropic activities, IL27 has been implicated in a wide range of diseases, disorders, and conditions, including inflammatory conditions and immune-related disorders.

[0004] One drawback of using IL27 in therapeutics, especially recombinant IL27 in any form, is its short serum half-life. Loss of IL27 activity in vivo can be due to several factors, including renal clearance and proteolysis.

[0005] It would be advantageous to have an IL27 receptor agonist that is better tolerated during systemic exposure during therapy by enhancing the circulating lifetime (delayed clearance), solubility, and stability of IL27. It would further be advantageous to have an IL27 receptor agonist that can be administered at a therapeutically effective dose, while having an improved therapeutic index and minimal side effects. The present disclosure addresses this and other related needs in the art. [Prior art documents] [Non-patent literature]

[0006] [Non-Patent Document 1] Kastelein et al.,2007,Annu Rev Immunol.25:221-242 [Non-Patent Document 2] Fabbi et al.,2017,Mediators of Inflammation 42:1-14 Summary of the Invention

[0007] The present disclosure provides novel IL27 receptor agonists. In certain embodiments, the IL27 receptor agonists address the shortcomings of IL27 therapeutics and feature an improved therapeutic profile with improved half-life and / or an improved safety profile. In further embodiments, the IL27 receptor agonists address the aggregation problems associated with conventional IL27 fusion constructs, such as fusion proteins comprising p28, EBI3, and an Fc domain. The IL27 receptor agonists of the present disclosure typically comprise or consist of IL27 muteins that differ from native IL27 by the primary amino acid sequence of p28 and / or EBI3 and / or by the inclusion of additional domains or moieties not normally present in IL27. IL27 receptors (used interchangeably with "IL27 agonists") and muteins typically comprise one or a pair of IL27 monomers, each comprising a p28 and / or EBI3 moiety and an optional multimerization moiety (e.g., an Fc domain), an optional stabilization moiety (e.g., human serum albumin), and / or an optional targeting moiety (e.g., an scFv antibody) or a component of a targeting moiety (e.g., a VH domain of a Fab targeting moiety), optionally in association with one or more additional polypeptide chains (e.g., a polypeptide chain comprising another multimerization moiety (e.g., an Fc domain) or a targeting moiety component (e.g., a VL domain of a Fab targeting moiety). Exemplary IL27 monomers are disclosed in Section 5.2. Exemplary IL27 receptor agonists are disclosed in Section 5.2 and in numbered embodiments 24-318 and are illustrated in Figures 3-6.

[0008] The present disclosure further provides variant p28 moieties that incorporate amino acid substitutions that contribute to improved therapeutic profiles. Exemplary variant p28 moieties are disclosed in Section 5.3.2 and in numbered embodiments 1-23.

[0009] The present disclosure further provides a p28 protein and an EBI3 protein. Some IL27 receptor agonists and muteins of the present disclosure comprise a p28 protein associated with an EBI3 protein.

[0010] In certain aspects, the p28 protein comprises a p28 moiety and a multimerization (e.g., Fc) domain. The p28 protein may comprise one, two, or more polypeptide chains and is typically configured to associate with an EBI3 moiety, such as the EBI3 moiety of an EBI3 protein. In some embodiments, the p28 protein does not comprise an EBI3 moiety. Exemplary p28 proteins are disclosed in Section 5.2 and in numbered embodiments 319-326.

[0011] In certain aspects, the EBI3 protein comprises an EBI3 moiety and a multimerization (e.g., Fc) domain. The EBI3 protein can comprise one, two, or more polypeptide chains and is typically configured to associate with a p28 moiety, such as the p28 moiety of a p28 protein. In some embodiments, the EBI3 protein does not comprise a p28 moiety. Exemplary EBI3 proteins are disclosed in Section 5.2 and in numbered embodiments 327-334.

[0012] The present disclosure further provides nucleic acids encoding the IL27 receptor agonist, IL27 mutein, IL27 monomer, p28 protein, EBI3 protein, p28 portion, and EBI3 portion of the present disclosure. Nucleic acids encoding IL27 receptor agonist, IL27 mutein, p28 protein, and EBI3 protein that are composed of more than one polypeptide chain can be a single nucleic acid (e.g., a vector encoding all polypeptide chains) or multiple nucleic acids (e.g., two or more vectors encoding different polypeptide chains). The present disclosure further provides host cells and cell lines engineered to express the nucleic acids and IL27 receptor agonist, IL27 mutein, IL27 monomer, p28 protein, EBI3 protein, p28 portion, and EBI3 portion of the present disclosure. The present disclosure further provides methods of producing the IL27 receptor agonist, IL27 mutein, IL27 monomer, p28 protein, EBI3 protein, p28 portion, or EBI3 portion of the present disclosure. Exemplary nucleic acids, host cells, cell lines, and methods for producing IL27 receptor agonists, IL27 muteins, IL27 monomers, p28 proteins, EBI3 proteins, p28 portions, and EBI3 portions are described infra in Section 5.9 and in numbered embodiments 335-343.

[0013] The present disclosure further provides pharmaceutical compositions comprising an IL27 receptor agonist, an IL27 mutein, an IL27 monomer, a p28 protein, an EBI3 protein, a p28 portion, and an EBI3 portion of the present disclosure. Exemplary pharmaceutical compositions are described in Section 5.10, infra, and in numbered embodiments 344-346.

[0014] Further provided herein are methods of using the disclosed IL27 receptor agonists, IL27 muteins, IL27 monomers, p28 proteins, EBI3 proteins, p28 portions, EBI3 portions, and pharmaceutical compositions, e.g., to modulate immune responses, treat autoimmune conditions, and / or for localized delivery of IL27 receptor agonists. Exemplary methods are described in Section 5.11, infra, and in numbered embodiments 347-355. [Brief description of the drawings]

[0015] [Figure 1A] Schematic diagram of the IL27 heterodimer (FIG. 1A) and the heterodimeric IL27 receptor (FIG. 1B). [Figure 1B] Schematic diagram of the IL27 heterodimer (FIG. 1A) and the heterodimeric IL27 receptor (FIG. 1B). [Diagram 2] FIG. 1 is a schematic diagram of the wild-type IL27 heterodimer. [Figure 3A] Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 3B] Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 3C]Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 3D] Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 3E] Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 3F]Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 3G] Various orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M1-IL27M3 and IL27M12-IL27M15, are shown. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4A] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4B]1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4C] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4D] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4E]1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4F] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 4G] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M4-IL27M6 and IL27M16-IL27M19. The triangle in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 5A] Additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M20 (FIG. 5A) and IL27M21 (FIG. 5B), with human serum albumin (HSA) are shown. The figures are intended to show the organization of domains contained in the IL27 agonists and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 5B]Additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M20 (FIG. 5A) and IL27M21 (FIG. 5B), with human serum albumin (HSA) are shown. The figures are intended to show the organization of domains contained in the IL27 agonists and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 6A] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M7-IL27M11. The asterisk in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 6B] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M7-IL27M11. The asterisk in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 6C] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M7-IL27M11. The asterisk in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 6D]1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M7-IL27M11. The asterisk in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 6E] 1 shows additional orientations of embodiments of the IL27 agonists of the present disclosure, designated IL27M7-IL27M11. The asterisk in one of the CH3 domains indicates that the two CH3s are not identical and contain one or more mutations that allow for heterodimerization (e.g., knob-in-hole mutations, star mutations, etc.). The figures are intended to show the organization, including the N-terminal to C-terminal order of the domains contained in the IL27 agonists, and are not intended to convey a particular sequence, scale, or three-dimensional structure. [Figure 7A] STAT3-mediated luciferase reporter activity and aggregation profiles of IL27 muteins are shown. Recombinant IL27 and IL27 muteins increase STAT3 response element-driven luciferase activity in engineered MC9 / STAT3-Luc reporter cells. The filled circles represent commercial mouse IL27 (purchased from R&D Systems), the filled triangles represent EBI3×p28-Fc(monovalent) (an example of an IL27 agonist with an orientation of IL27M2), and the filled squares represent EBI3-p28-Fc(bivalent) (an example of an IL27 agonist with an orientation of IL27M1) (FIG. 7A). The SE-UPLC profile of EBI3×p28-Fc(monovalent) is shown in FIG. 7B, and the aggregation profile of EBI3-p28-Fc(bivalent) is shown in FIG. 7C. [Figure 7B]STAT3-mediated luciferase reporter activity and aggregation profiles of IL27 muteins are shown. Recombinant IL27 and IL27 muteins increase STAT3 response element-driven luciferase activity in engineered MC9 / STAT3-Luc reporter cells. The filled circles represent commercial mouse IL27 (purchased from R&D Systems), the filled triangles represent EBI3×p28-Fc(monovalent) (an example of an IL27 agonist with an orientation of IL27M2), and the filled squares represent EBI3-p28-Fc(bivalent) (an example of an IL27 agonist with an orientation of IL27M1) (FIG. 7A). The SE-UPLC profile of EBI3×p28-Fc(monovalent) is shown in FIG. 7B, and the aggregation profile of EBI3-p28-Fc(bivalent) is shown in FIG. 7C. [Figure 7C] STAT3-mediated luciferase reporter activity and aggregation profiles of IL27 muteins are shown. Recombinant IL27 and IL27 muteins increase STAT3 response element-driven luciferase activity in engineered MC9 / STAT3-Luc reporter cells. The filled circles represent commercial mouse IL27 (purchased from R&D Systems), the filled triangles represent EBI3×p28-Fc(monovalent) (an example of an IL27 agonist with an orientation of IL27M2), and the filled squares represent EBI3-p28-Fc(bivalent) (an example of an IL27 agonist with an orientation of IL27M1) (FIG. 7A). The SE-UPLC profile of EBI3×p28-Fc(monovalent) is shown in FIG. 7B, and the aggregation profile of EBI3-p28-Fc(bivalent) is shown in FIG. 7C. [Figure 8] Figure 1 shows the activity of IL27 muteins on STAT1 phosphorylation in CD4+ T cells isolated from naive spleens. Recombinant IL27 and EBI3 x p28-Fc (monovalent), but not EBI3-p28-Fc (bivalent), induce a dose-dependent increase in pSTAT1 in CD4+ T cells isolated from naive spleens. Circles represent commercial mouse IL27 (purchased from R&D Systems), squares represent EBI3-p28-Fc (bivalent), and triangles represent EBI3 xp 28-Fc (monovalent). [Figure 9A]Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9B] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9C] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9D] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9E] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9F] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9G] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9H]Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9I] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9J] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9K] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 9L] Shown are SE-UPLC traces for IL27 agonists of the present disclosure. Figures 9A and 9B: The IL27 domain of the IL27 agonists was of human origin. Figures 9C-9L: The IL27 domain of the IL27 agonists was of mouse origin. [Figure 10A]

[0036] Figure 10 shows the activity of IL27 agonists of the present disclosure on mouse cell lines in an IL27 reporter assay. MC9 / STAT3-Luc cells were incubated with titrations of mIL27 monomeric IL2 Fc fusion (Figure 10A) or dimeric IL27 Fc fusion (Figure 10B) or IL27 HSA fusion (Figure 10C). [Figure 10B]

[0036] Figure 10 shows the activity of IL27 agonists of the present disclosure on mouse cell lines in an IL27 reporter assay. MC9 / STAT3-Luc cells were incubated with titrations of mIL27 monomeric IL2 Fc fusion (Figure 10A) or dimeric IL27 Fc fusion (Figure 10B) or IL27 HSA fusion (Figure 10C). [Figure 10C]

[0036] Figure 10 shows the activity of IL27 agonists of the present disclosure on mouse cell lines in an IL27 reporter assay. MC9 / STAT3-Luc cells were incubated with titrations of mIL27 monomeric IL2 Fc fusion (Figure 10A) or dimeric IL27 Fc fusion (Figure 10B) or IL27 HSA fusion (Figure 10C). [Figure 11]

[0033] Figure 1 shows the activity of IL27 agonists of the present disclosure on human cell lines in an IL27 reporter assay. NCI-H929 / GAS-Luc cells were incubated with human IL27 (dashed black circles) or monovalent (hEBI3xhp28-Fc (e.g., with IL27M2 configuration); solid squares) or bivalent (hEBI3-hp28-Fc (e.g., with IL27M1 configuration); solid triangles) IL27-Fc. After 5 hours and 30 minutes, STAT1 activity was assessed by luminescence readout. [Figure 12] Figure 1 shows the activity of IL27 muteins on Th0, Th2, and Th17 polarization of naive CD4+ mouse T cells. Recombinant IL27 and EBI3 x p28-Fc (monovalent), but not EBI3-p28-Fc (bivalent), inhibit Th2 polarization of naive CD4+ mouse T cells as determined by reduced expression of the Th2-associated transcription factor Gata3 under Th2 polarization-inducing conditions (Th0: 10ug / mL anti-IFNg + 10ug / mL anti-IL-4), Th2: 10ug / mL anti-IFNg + 50ng / mL rIL-4, Th17: 10ug / mL anti-IFNg + 10ug / mL anti-IL-4 + 1ng / mL rhTGFb + 10ng / mL rIL-6). [Figure 13A]Figure 13 shows the ability of the recombinant IL27 mutein of the present disclosure to inhibit Gata3 expression during Th2 polarization (10ug / mL anti-IFNg + 50ng / mL IL-4) as assessed in an in vitro mouse T cell polarization assay. (Figure 13A) Flow cytometry plot showing Gata3 expression on CD4+ T cells. (Figure 13B) Gata3 MFI was quantified. (FIG. 13C) The ability of recombinant IL27 of the present disclosure to promote PDL1 expression under T cell polarization conditions (Th0: 10 ug / mL anti-IFNg + 10 ug / mL anti-IL-4), Th2: 10 ug / mL anti-IFNg + 50 ng, Th2: 10 ug / mL anti-IFNg + 50 ng / mL rIL-4, Th17: 10 ug / mL anti-IFNg + 10 ug / mL anti-IL-4 + 1 ng / mL rhTGFb + 10 ng / mL rIL-6) was evaluated in an in vitro mouse T cell polarization assay. [Figure 13B] Figure 13 shows the ability of the recombinant IL27 mutein of the present disclosure to inhibit Gata3 expression during Th2 polarization (10ug / mL anti-IFNg + 50ng / mL IL-4) as assessed in an in vitro mouse T cell polarization assay. (Figure 13A) Flow cytometry plot showing Gata3 expression on CD4+ T cells. (Figure 13B) Gata3 MFI was quantified. (FIG. 13C) The ability of recombinant IL27 of the present disclosure to promote PDL1 expression under T cell polarization conditions (Th0: 10 ug / mL anti-IFNg + 10 ug / mL anti-IL-4), Th2: 10 ug / mL anti-IFNg + 50 ng, Th2: 10 ug / mL anti-IFNg + 50 ng / mL rIL-4, Th17: 10 ug / mL anti-IFNg + 10 ug / mL anti-IL-4 + 1 ng / mL rhTGFb + 10 ng / mL rIL-6) was evaluated in an in vitro mouse T cell polarization assay. [Figure 13C]Figure 13 shows the ability of the recombinant IL27 mutein of the present disclosure to inhibit Gata3 expression during Th2 polarization (10ug / mL anti-IFNg + 50ng / mL IL-4) as assessed in an in vitro mouse T cell polarization assay. (Figure 13A) Flow cytometry plot showing Gata3 expression on CD4+ T cells. (Figure 13B) Gata3 MFI was quantified. (FIG. 13C) The ability of recombinant IL27 of the present disclosure to promote PDL1 expression under T cell polarization conditions (Th0: 10 ug / mL anti-IFNg + 10 ug / mL anti-IL-4), Th2: 10 ug / mL anti-IFNg + 50 ng, Th2: 10 ug / mL anti-IFNg + 50 ng / mL rIL-4, Th17: 10 ug / mL anti-IFNg + 10 ug / mL anti-IL-4 + 1 ng / mL rhTGFb + 10 ng / mL rIL-6) was evaluated in an in vitro mouse T cell polarization assay. [Figure 14] Figure 1 shows the PK of recombinant IL27 muteins of the present disclosure evaluated in vivo. C57BL / 6 mice were treated intraperitoneally with 10ug of the indicated recombinant IL27 muteins. Serum was collected 2, 6, 24, and 48 hours after treatment. ELISA (duoset mouse IL27 p28 ELISA; R&D Systems) was performed to quantify the levels of each IL27 mutein in serum at each time point. [Figure 15A] Shown is a model of the interaction between IL27 and the IL27 receptor complex (FIG. 15A), a three-dimensional model of the receptor binding site present on IL27p28 (FIG. 15B), and a sequence alignment of mouse IL27p28 (SEQ ID NO: 36) and human IL27p28 (SEQ ID NO: 34) (FIG. 15C). The solid arrow indicates the site of mutation in binding site 2, which is involved in receptor binding. The dashed arrow indicates the site of mutation in binding site 3, which is involved in receptor binding. [Figure 15B]Shown is a model of the interaction between IL27 and the IL27 receptor complex (FIG. 15A), a three-dimensional model of the receptor binding site present on IL27p28 (FIG. 15B), and a sequence alignment of mouse IL27p28 (SEQ ID NO: 36) and human IL27p28 (SEQ ID NO: 34) (FIG. 15C). The solid arrow indicates the site of mutation in binding site 2, which is involved in receptor binding. The dashed arrow indicates the site of mutation in binding site 3, which is involved in receptor binding. [Figure 15C] Shown is a model of the interaction between IL27 and the IL27 receptor complex (FIG. 15A), a three-dimensional model of the receptor binding site present on IL27p28 (FIG. 15B), and a sequence alignment of mouse IL27p28 (SEQ ID NO: 36) and human IL27p28 (SEQ ID NO: 34) (FIG. 15C). The solid arrow indicates the site of mutation in binding site 2, which is involved in receptor binding. The dashed arrow indicates the site of mutation in binding site 3, which is involved in receptor binding. [Figure 16] IL27 reporter assay for mIL27 site 2 and site 3 muteins. MC9 / STAT3-Luc was incubated with a titration of mIL27 or monovalent Fc-IL27 muteins and STAT3 activity was assessed by luminescence readout after 5 hours. The right panel is an enlargement of the area enclosed by the dotted box presented on the left panel. [Figure 17A] FIG. 1 shows the activity of mIL27 site 2 and site 3 muteins in primary human T cells. [Figure 17B] FIG. 1 shows the activity of mIL27 site 2 and site 3 muteins in primary human T cells. [Figure 17C] FIG. 1 shows the activity of mIL27 site 2 and site 3 muteins in primary human T cells. [Figure 17D] FIG. 1 shows the activity of mIL27 site 2 and site 3 muteins in primary human T cells. [Figure 18A] Flow binding of mIL27 site 2 and site 3 muteins to mouse reporter cells MC9 / STAT3-Luc (FIG. 18A) and IL27Rα knockout derivatives (FIG. 18B) is shown. [Figure 18B]Flow binding of mIL27 site 2 and site 3 muteins to mouse reporter cells MC9 / STAT3-Luc (FIG. 18A) and IL27Rα knockout derivatives (FIG. 18B) is shown. [Figure 19-1] Figures 19A-19H show the efficacy of targeted IL27 muteins against target expressing cells (Figures B, D, F, and H) versus non-expressing cells (Figures A, C, E, and G). [Figure 19-2] Figures 19A-19H show the efficacy of targeted IL27 muteins against target expressing cells (Figures B, D, F, and H) versus non-expressing cells (Figures A, C, E, and G). DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0016] 5.1.Definition About, Approximately: The terms "about," "approximately," and the like are used throughout this specification preceding numerical values ​​to indicate that the numerical value is not necessarily exact (e.g., to account for fractions, variations in measurement precision, and / or accuracy, timing, etc.). A disclosure of "about X" or "approximately X," where X is a number, is also understood to be a disclosure of "X." Thus, for example, a disclosure of an embodiment in which a sequence has "about X% sequence identity" to another sequence is also a disclosure of an embodiment in which the sequence has "X% sequence identity" to the other sequence.

[0017] And, or: Unless otherwise noted, the conjunction "or" is intended to be used in its proper sense as a Boolean logical operator and encompasses both the selection of features in an alternative (A or B where the selection of A is mutually exclusive of B) and the simultaneous selection of features (A or B where both A and B are selected). In some places in the text, the term "and / or" is used for the same purpose and should not be interpreted to imply that "or" is used to refer to mutually exclusive alternatives.

[0018] Antigen Binding Domain or ABD: As used herein, the term "antigen binding domain" or "ABD" refers to a portion of a targeting moiety capable of specifically, non-covalently, and reversibly binding to a target molecule.

[0019] Associated: The term "associated" in the context of an IL27 receptor agonist or a component thereof (e.g., an IL27 EBI3 portion; an IL27 p28 portion; a targeting portion such as an antibody) refers to a functional relationship between two or more polypeptide chains. In particular, the term "associated" means that two or more polypeptides are associated with each other, e.g., non-covalently via molecular interactions, or covalently via one or more disulfide or chemical bridges, to produce a functional IL27 receptor agonist. Examples of associations that may be present in the IL27 receptor agonists of the present disclosure include (but are not limited to) an association between the IL27 EBI3 and p28 portions, an association between homodimeric or heterodimeric Fc domains in an Fc region, an association between the VH and VL regions in a Fab or scFv, an association between CH1 and CL in a Fab, and an association between CH3 and CH3 in a domain-substituted Fab.

[0020] Bivalent: The term "bivalent" as used herein with respect to IL27 and / or a targeting moiety in an IL27 receptor agonist refers to an IL27 receptor agonist having two IL27 heterodimers (i.e., two EBI3xp28 heterodimers) and / or a targeting moiety, respectively. Typically, an IL27 receptor agonist that is bivalent with respect to an IL27 moiety and / or a targeting moiety is a dimer (either a homodimer or a heterodimer).

[0021] Cancer: The term "cancer" refers to a disease characterized by the uncontrolled (and often rapid) growth of abnormal cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein, including, but not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colon cancer, kidney cancer, liver cancer, brain cancer, adrenal gland cancer, autonomic ganglion cancer, biliary tract cancer, bone cancer, endometrial cancer, eye cancer, fallopian tube cancer, reproductive tract cancer, colon cancer, meningeal cancer, esophageal cancer, peritoneal cancer, pituitary cancer, penile cancer, placental cancer, pleural cancer, salivary gland cancer, small intestine cancer, stomach cancer, testicular cancer, thymus cancer, thyroid cancer, upper aerodigestive tract cancer, urinary tract cancer, vaginal cancer, vulvar cancer, lymphoma, leukemia, lung cancer, and the like.

[0022] Complementarity determining region or CDR: As used herein, the term "complementarity determining region" or "CDR" refers to a sequence of amino acids in an antibody variable region that confers antigen specificity and binding affinity. Generally, each heavy chain variable region has three CDRs (CDR-H1, CDR-H2, HCDR-H3), and each light chain variable region has three CDRs (CDR1-L1, CDR-L2, CDR-L3). Exemplary rules that can be used to identify the boundaries of CDRs include, for example, the Kabat definition, the Chothia definition, the ABM definition, and the IMGT definition. See, e.g., Kabat, 1991, "Sequences of Proteins of Immunological Interest," National Institutes of Health, Bethesda, Md. (Kabat numbering scheme); Al-Lazikani et al., 1997, J. Mol. Biol. 273:927-948 (Chothia numbering scheme); Martin et al., 1989, Proc. Natl. Acad. Sci. USA 86:9268-9272 (ABM numbering scheme); and Lefranc et al., 2003, Dev. Comp. Immunol. 27:55-77 (IMGT numbering scheme). Public databases for identifying CDR sequences within antibodies are also available.

[0023] EBI3 portion or IL27 EBI3 portion: The terms "EBI3 portion" and "IL27 EBI3 portion" refer to an amino acid sequence that comprises at least 70% sequence identity, such as at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to a p28-binding portion of a mammalian, e.g., human or mouse, EBI3 protein. The sequence of human EBI3 has the Uniprot identifier Q14213 (uniprot.org / uniprot / Q14213). The sequence of mouse EBI3 has the Uniprot identifier O35228 (uniprot.org / uniprot / O35228).

[0024] In some embodiments, the EBI3 portion comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to a mature mammalian EBI3 protein, such as human or mouse EBI3 (e.g., amino acids 24-229 of full-length human EBI3).

[0025] Further embodiments of the EBI3 moiety are described in Section 5.3.1. EBI3 polypeptide: The term "EBI3 polypeptide" refers to a polypeptide that includes an EBI3 portion (e.g., as described in Section 5.2). In some embodiments, the EBI3 polypeptide is a fusion polypeptide, e.g., a polypeptide that includes an Fc domain in addition to the EBI3 portion.

[0026] EBI3 protein: The term "EBI3 protein" refers to a monomeric or multimeric (eg, dimeric) protein that comprises an EBI3 moiety (eg, an Fc dimer that comprises an EBI3 moiety). The term "EBI3 protein" encompasses EBI3 polypeptides.

[0027] EC50: The term "EC50" refers to the half-maximal effective concentration of a molecule (e.g., an IL27 agonist) that induces a response halfway between baseline and maximum after a particular exposure time. EC50 essentially represents the concentration of an antibody or IL27 agonist at which 50% of its maximal effect is observed. In certain embodiments, the EC50 value is equal to the concentration of an IL27 agonist that gives half-maximal STAT3 activation in the assay described in Section 7.1.2.

[0028] Epitope: The term "epitope" is a portion of an antigen (e.g., a target molecule) that is recognized by an antibody or other antigen-binding moiety. Epitopes can be linear or conformational.

[0029] Fab: The term "Fab" in the context of the targeting moiety of the present disclosure refers to a pair of polypeptide chains, the first of which comprises the variable heavy chain (VH) domain of an antibody N-terminal to a first constant domain (referred to herein as C1), and the second of which comprises the variable light chain (VL) domain of an antibody N-terminal to a second constant domain (referred to herein as C2) that can pair with the first constant domain. In a natural antibody, the VH is N-terminal to the first constant domain (CH1) of the heavy chain, and the VL is N-terminal to the constant domain (CL) of the light chain. The Fabs of the present disclosure may be arranged according to the natural orientation, or may include domain substitutions or exchanges that facilitate correct VH and VL pairing. For example, the CH1 and CL domain pair in a Fab can be replaced with a CH3 domain pair to facilitate correct modified Fab chain pairing in a heterodimeric molecule. It is also possible to reverse CH1 and CL, attaching CH1 to VL and CL to VH, a configuration generally referred to as a crossmab.

[0030] Fc domain and Fc region: The term "Fc domain" refers to the portion of a heavy chain that pairs with the corresponding portion of another heavy chain. The term "Fc region" refers to the region of an antibody-based binding molecule formed by the association of two heavy chain Fc domains. The two Fc domains within an Fc region may be the same as or different from each other. In natural antibodies, the Fc domains are typically identical, although one or both Fc domains may be advantageously modified to allow heterodimerization, for example, via knobs-in-holes interactions. Additionally, Fc domains may comprise chimeric sequences derived from two or more immunoglobulin isotypes.

[0031] Host cell: As used herein, the term "host cell" refers to a cell into which a nucleic acid of the present disclosure has been introduced. The terms "host cell" and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer to the particular subject cell and the progeny or potential progeny of such a cell. Because certain modifications may occur in successive generations, either due to mutation or environmental influences, such progeny may not actually be identical to the parent cell, but are still within the scope of the term as used herein. Exemplary host cells are eukaryotic host cells, such as mammalian host cells. Exemplary eukaryotic host cells include yeast and mammalian cells, e.g., vertebrate cells such as mouse, rat, monkey or human cell lines, e.g., HKB11 cells, PER.C6 cells, HEK cells or CHO cells.

[0032] IL27 agonist or IL27 receptor agonist: The terms "IL27 agonist" and "IL27 receptor agonist" are used interchangeably herein and refer to a molecule that comprises or consists of an IL27 mutein and has IL27 activity. IL27 activity may be greater than, less than, or equal to the activity of wild-type or recombinant IL27 (e.g., human or murine IL27) in one or more in vitro or in vivo biological assays, such as the STAT3-driven luciferase-based reporter assay described in Section 7.1.2. In various embodiments, the IL27 agonist has activity in the range of 5%-90%, 5%-85%, 5%-80%, 10%-80%, 15%-80%, 20%-80%, 25%-80%, 30%-80%, 35%-80%, 45%-80%, 50%-80%, 5%-70%, 10%-70%, 15%-70%, 20%-70%, 25%-70%, 30%-70%, 35%-70%, 45%-70%, or 50%-70% compared to recombinant IL27.

[0033] IL27 moiety: As used herein, the term "IL27 moiety" refers to an EBI3 moiety (e.g., as described in Section 5.3.1) or a p28 moiety (e.g., as described in Section 5.3.2). The related term "internal IL27 moiety linker" therefore refers to a linker that connects two IL27 moieties, e.g., an EBI3 moiety and a p28 moiety.

[0034] IL27 Monomer or Monomer: As used herein, the terms monomer and IL27 monomer refer to a molecule comprising a first polypeptide chain that (a) comprises an EBI3 portion and a p28 portion and is capable of associating with a second polypeptide chain; (b) comprises an EBI3 portion and is capable of associating with a p28 portion on a second polypeptide chain; (c) comprises a p28 portion and is capable of associating with an EBI3 portion on a second polypeptide chain; (d) comprises a multimerization portion (e.g., an Fc domain) and is capable of associating with a corresponding multimerization portion (e.g., another Fc domain) on the second polypeptide chain; (e) comprises a stabilization portion (e.g., human serum albumin) and a p28 portion and / or an EBI3 portion; or (f) is any combination of (a), (b), (c), (d), and (e) above. In some embodiments, a monomer can associate with another monomer through EBI3 / p28 moiety pairing and / or multimerization moiety (e.g., Fc domain) pairing. In some embodiments, the monomer forms an association through a hinge sequence or other portion of the Fc domain. Thus, a monomer of the present disclosure can associate with another monomer to form a dimer. A dimer may be a homodimer in which each constituent monomer is identical, or a heterodimer in which each constituent monomer is different. As used herein, reference to a "monomer" does not exclude the presence of a second polypeptide chain that does not include EBI3, p28, or a multimerization moiety, such as a light chain of a Fab domain. Thus, a "dimer" of two monomers may include more than two polypeptide chains, for example, three or four polypeptide chains.

[0035] In some embodiments, two or more IL27 monomers (e.g., two, three, or four IL27 monomers) associate with one another to form an IL27 receptor agonist of the present disclosure. In other embodiments, a single IL27 monomer forms an IL27 receptor agonist of the present disclosure.

[0036] IL27 Mutein: An "IL27 mutein" is a mutant IL27 molecule composed of one or more polypeptide chains (e.g., one, two, three, or four polypeptide chains) comprising an IL27 EBI3 (referred to as "EBI3") portion and an IL27 p28 ("p28") portion associated with each other, which differs from native IL27 by (a) primary amino acid sequence, and / or (b) association with an additional domain not naturally associated with IL27, e.g., (i) a multimerization moiety (e.g., a dimerization domain such as an Fc domain), and / or (ii) a targeting moiety, and / or (iii) a stabilizing moiety.

[0037] In some embodiments, the term mutein refers to structures with or without (a) a targeting moiety, and / or (b) a stabilizing moiety, and / or (c) a multimerizing moiety. In the context of the IL27 agonists of the present disclosure, the term "IL27 mutein" optionally refers to the core components of a mutant IL27 molecule, i.e., the EBI3 and p28 moieties, and optionally also to a multimerizing moiety, e.g., an Fc domain and any / or associated linker moieties, and / or a stabilizing moiety, e.g., human serum albumin, and it is understood that unless the context indicates otherwise, the term "IL27 mutein" also extends to an IL27 molecule comprising additional features, e.g., one or more targeting moieties, one or more stabilizing moieties, one or more multimerizing moieties, one or more linker moieties, and any combination of the foregoing.

[0038] Thus, an IL27 mutein can comprise an EBI3 and / or p28 portion having one or more amino acid substitutions, deletions and / or insertions compared to wild-type EBI3 and / or p28.

[0039] In some embodiments, the IL27 mutein has one or more mutations in its p28 portion. Exemplary mutations, e.g., substitutions, are disclosed, inter alia, in Section 5.3.2 and subparts therein, Table 1, and numbered embodiments 1-23. The EBI3 and p28 subunits of an IL27 mutein may be included in the same or different polypeptide chains. Exemplary configurations of IL27 muteins and agonists of the present disclosure are disclosed, inter alia, in Figures 3-6, Section 5.2, and numbered embodiments 24-318.

[0040] An IL27 mutein can be monovalent for EBI3 and p28 (i.e., has a single EBI3 moiety and a single p28 moiety) or multivalent for EBI3 and p28 (i.e., has multiple EBI3 and p28 moieties). In some embodiments, an IL27 mutein is bivalent for EBI3 and p28 (i.e., has two EBI3 moieties and two p28 moieties). When an IL27 mutein is multivalent for EBI3 and p28, the multiple EBI3 moieties may be the same or different from each other and / or the multiple p28 moieties may be the same or different from each other.

[0041] An IL27 mutein may have altered function (eg, receptor binding, affinity, cytokine activity) and / or altered pharmacokinetics compared to wild-type IL27. Major Histocompatibility Complex and MHC: These terms refer to naturally occurring MHC molecules, the individual chains of MHC molecules (e.g., MHC class I α (heavy) chain, β2 microglobulin, MHC class II α chain, and MHC class II β chain), the individual subunits of such chains of MHC molecules (e.g., α1, α2, and / or α3 subunits of the MHC class I α chain, α1-α2 subunits of the MHC class II α chain, β1-β2 subunits of the MHC class II β chain), as well as portions (e.g., peptide-binding portions, e.g., peptide-binding grooves), mutants, and various derivatives thereof (including fusion proteins), which portions, mutants, and derivatives retain the ability to present antigenic peptides for recognition by a T cell receptor (TCR), e.g., an antigen-specific TCR. MHC class I molecules contain a peptide-binding groove formed by the α1 and α2 domains of the heavy chain that can accommodate peptides of about 8-10 amino acids. Despite the fact that both MHC classes bind to a core of about 9 amino acids (e.g., 5-17 amino acids) in a peptide, the open-ended nature of the MHC class II peptide-binding groove (the α1 domain of a class II MHC α polypeptide associated with the β1 domain of a class II MHC β polypeptide) allows for a wider range of peptide lengths. Peptides that bind to MHC class II are typically 13-17 amino acids long, although shorter or longer lengths are not uncommon. As a result, peptides can shift within the MHC class II peptide-binding groove, and which 9-mers are directly located in the groove can change at any one time. Conventional identification of specific MHC variants is used herein. This term encompasses "human leukocyte antigen" or "HLA."

[0042] Monovalent: The term "monovalent" as used herein with respect to IL27 and / or a targeting moiety in an IL27 receptor agonist refers to an IL27 receptor agonist that has only a single IL27 heterodimer (i.e., one EBI3xp28 heterodimer) and / or a targeting moiety, respectively.

[0043] Operably linked: As used herein, the term "operably linked" refers to a functional relationship between two or more regions of a polypeptide chain, which are linked to provide a functional polypeptide or two or more nucleic acid sequences, e.g., to provide an in-frame fusion of two polypeptide components or to link a regulatory sequence to a coding sequence.

[0044] p28 portion or IL27 p28 portion: The terms "p28 portion" and "IL27 p28 portion" refer to an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity, to the IL27Ra (IL27Rα) binding portion and / or the gp130 binding portion of a mammalian, e.g., human or mouse p28 protein. The sequence of full-length human p28 has the Uniprot identifier Q8NEV9 (uniprot.org / uniprot / Q8NEV9). The sequence of full-length mouse p28 has the Uniprot identifier Q8K3I6 (uniprot.org / uniprot / Q8K3I6).

[0045] In some embodiments, the p28 portion comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to a mature mammalian p28 protein, such as human or mouse EBI3 (e.g., amino acids 29-243 of full length human EBI3).

[0046] Further embodiments of the EBI3 moiety are described in Section 5.3.1. p28 Polypeptide: The term "p28 polypeptide" refers to a polypeptide that includes a p28 moiety (e.g., as described in Section 5.3.2). In some embodiments, a p28 polypeptide is a fusion polypeptide, e.g., a polypeptide that includes an Fc domain in addition to the p28 moiety.

[0047] p28 protein: The term "p28 protein" refers to a monomeric or multimeric (e.g., dimeric) protein that contains a p28 moiety (e.g., an Fc dimer that contains a p28 moiety). The term "p28 protein" encompasses p28 polypeptides.

[0048] Peptide-MHC complex, pMHC complex, intragroove peptide: "Peptide-MHC complex", "pMHC complex", and "intragroove peptide" refer to (i) an MHC domain (e.g., a human MHC molecule or a portion thereof (e.g., the peptide-binding groove thereof and, e.g., the extracellular portion thereof), (ii) an antigenic peptide, and optionally, (iii) a β2 microglobulin domain (e.g., human β2 microglobulin or a portion thereof), where the MHC domain, antigenic peptide, and optional β2 microglobulin domain are complexed in a manner that allows specific binding to a T cell receptor. In some embodiments, a pMHC complex comprises at least the extracellular domain of a human HLA class I / human β2 microglobulin molecule and / or a human HLA class II molecule.

[0049] Single-chain Fv or scFv: As used herein, the term "single-chain Fv" or "scFv" refers to a polypeptide chain comprising the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain.

[0050] Specifically (or selectively) bind: As used herein, the term "specifically (or selectively) bind" means that a targeting moiety, such as an antibody, or an antigen binding domain ("ABD") thereof, forms a complex with a target molecule that is relatively stable under physiological conditions. Specific binding is on the order of about 5×10 -2M or less (e.g., 5×10 -2 Less than M, 10 -2 Less than M, 5×10 -3 Less than M, 10 -3 Less than M, 5×10 -4 Less than M, 10 -4 Less than M, 5×10 -5 Less than M, 10 -5 Less than M, 5×10 -6 Less than M, 10 -6 Less than M, 5×10 -7 Less than M, 10 -7 Less than M, 5×10 -8 Less than M, 10 -8 Less than M, 5×10 -9 Less than M, 10 -9 Less than M or 10 -10 K (less than M) D Methods for determining the binding affinity of an antibody or antibody fragment, e.g., an IL27 agonist or component targeting moiety, to a target molecule are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance (e.g., Biacore assays, fluorescence activated cell sorting (FACS) binding assays, and the like. However, an IL27 agonist of the present disclosure that includes a targeting moiety or its ABD that specifically binds to a target molecule from one species may have cross-reactivity to target molecules from one or more other species.

[0051] Subject: The term "subject" includes human and non-human animals. Non-human animals include all vertebrates, e.g., mammals and non-mammals, e.g., non-human primates, sheep, dogs, cows, chickens, amphibians, and reptiles. Unless otherwise noted, the terms "patient" and "subject" are used interchangeably herein.

[0052] Target molecule: As used herein, the term "target molecule" refers to any biological molecule (e.g., a protein, carbohydrate, lipid, or combination thereof) expressed on a cell surface or in the extracellular matrix that can be specifically bound by a targeting moiety in an IL27 agonist of the present disclosure.

[0053] Targeting moiety: As used herein, the term "targeting moiety" refers to any molecule or binding portion thereof (e.g., an immunoglobulin or antigen-binding fragment) that can bind to a cell surface or extracellular matrix molecule at the site where the IL27 agonist of the present disclosure is localized, e.g., on a lymphocyte involved in an autoimmune condition. A targeting moiety may also have functional activity in addition to localizing the IL27 agonist to a particular site. For example, a targeting moiety that is an anti-PD1 antibody or antigen-binding portion thereof may also enhance the activity of an IL27 mutein, and a targeting moiety that is a component of the IL27 receptor may sequester the IL27 mutein and inhibit its activity until it reaches its target cell or tissue.

[0054] Treat, Treatment, Treating: As used herein, the terms "treat", "treatment", and "treating" refer to the reduction or amelioration of the progression, severity and / or duration of a disorder described herein, or the amelioration of one or more symptoms (preferably one or more identifiable symptoms) of a condition or disorder described herein, e.g., inflammation or immune disorder, resulting from administration of one or more IL27 agonists of the present disclosure. In specific embodiments, the terms "treat", "treatment", and "treating" refer to the improvement of at least one measurable physical parameter of a disorder that is not necessarily identifiable by the patient, e.g., an immune disorder. In other embodiments, the terms "treat", "treatment", and "treating" refer to inhibiting the progression of a disorder physically (e.g., by stabilization of an identifiable symptom), physiologically (e.g., by stabilization of a physical parameter), or both.

[0055] Tumor: The term "tumor" is used interchangeably herein with the term "cancer", e.g., both terms encompass solid and liquid, e.g., diffuse or circulating, tumors. As used herein, the term "cancer" or "tumor" includes pre-malignant and malignant cancers and tumors.

[0056] Tumor-associated antigen: The term "tumor-associated antigen" or "TAA" refers to a molecule (typically a protein, carbohydrate, lipid, or some combination thereof) that is expressed on the surface of cancer cells, either in its entirety or as a fragment (e.g., MHC / peptide), and is useful for preferential targeting of drugs to cancer cells. In some embodiments, a TAA is a marker expressed by both normal cells and cancer cells, such as a lineage marker, e.g., CD19 on B cells. In some embodiments, a TAA is a cell surface molecule that is overexpressed in cancer cells compared to normal cells, e.g., a cell surface molecule that is overexpressed 1-fold, 2-fold, 3-fold, or more compared to normal cells. In some embodiments, a TAA is a cell surface molecule that is inappropriately synthesized in cancer cells, e.g., a molecule that contains a deletion, addition, or mutation compared to the molecule expressed on normal cells. In some embodiments, a TAA is expressed only on the cell surface of cancer cells, either in its entirety or as a fragment (e.g., MHC / peptide), and is not synthesized or expressed on the surface of normal cells. Thus, the term "TAA" encompasses antigens specific to cancer cells, which are sometimes referred to in the art as tumor-specific antigens ("TSAs").

[0057] Universal light chain: The term "universal light chain" as used herein in the context of a targeting moiety refers to a light chain polypeptide that can pair with a heavy chain region of a targeting moiety and also with other heavy chain regions. The universal light chain is also known as the "common light chain."

[0058] VH: The term "VH" refers to the variable region of an antibody immunoglobulin heavy chain, including the heavy chain of an scFv or Fab. VL: The term "VL" refers to the variable region of an immunoglobulin light chain, including the light chain of an scFv or Fab.

[0059] 5.2.IL27 receptor agonists The present disclosure provides an IL27 agonist comprising or consisting of an IL27 monomer and / or an IL27 mutein. The IL27 agonist comprises an EBI3 portion and a p28 portion, which differ from wild-type IL27 by (a) a primary amino acid sequence (e.g., an amino acid insertion, deletion, or substitution compared to EBI3 and / or p28, or any combination of the foregoing), and / or (b) an additional domain not naturally associated with IL27, such as (i) a multimerization moiety (e.g., a dimerization domain such as an Fc domain) domain and / or (ii) a targeting moiety and / or (iii) a stabilization moiety (e.g., association with human serum albumin (HSA)).

[0060] In some embodiments, the IL27 receptor agonists, IL27 muteins, and IL27 monomers of the present disclosure may contain IL27 receptor sequences, such as IL27Ra (IL27Rα) and / or gp130 sequences, as described in Section 5.6 and thereafter, and may attenuate off-site effects of IL27 receptor agonist therapy.

[0061] An IL27 receptor agonist or IL27 mutein may be composed of one or more polypeptides, e.g., one or more IL27 monomers. In some embodiments, an IL27 receptor agonist is composed of multiple (e.g., two) IL27 monomers that include an EBI3 portion and / or a p28 portion, and in some embodiments also includes a multimerization portion and / or a stabilization portion.

[0062] The IL27 receptor agonist, IL27 mutein, or IL27 monomer may further comprise one or more targeting moieties, and / or one or more stabilizing moieties, and / or one or more IL27R1 moieties, and / or one or more gp130 moieties. Exemplary multimerization moieties are described in Section 5.4 and include an Fc domain, which confers homodimerization or heterodimerization capabilities to the IL27 receptor agonist. Exemplary stabilizing moieties are described in Section 5.5 and include human serum albumin (HSA). Free IL27 has poor pharmacokinetics (serum half-life of less than about 2 hours), and without wishing to be bound by theory, it is believed that the inclusion of a multimerization domain such as an Fc domain and / or a stabilizing moiety such as HSA improves the serum stability and pharmacokinetic profile of the IL27 receptor agonist. Thus, the Fc domain may be a dual-purpose domain that confers the stabilizing properties of the stabilizing moiety, as described in Section 5.5.

[0063] Exemplary targeting moieties are described in Section 5.7 and include antigen binding domains (e.g., scFv or Fab) that bind to cell surface molecules, bind to immune cell-associated cell surface molecules, bind to tumor-associated antigens, bind to tumor microenvironment antigens, or bind to tumor lymphocytes, and peptide-MHC complexes that recognize tumor lymphocytes.

[0064] In some embodiments, the IL27 receptor agonist comprises an IL27Ra (IL27Rα) portion, a gp130 portion, or both an IL27Ra (IL27Rα) portion and a gp130 portion. Exemplary IL27Ra (IL27Rα) portions are described in Section 5.6.1. Exemplary gp130 portions are described in Section 5.6.2.

[0065] In some embodiments, the IL27 agonist of the present disclosure is composed of two IL27 monomers, optionally associated with one or more additional polypeptide chains (e.g., a polypeptide chain comprising a light chain of a Fab targeting moiety). The monomers may be identical, thereby forming a homodimer, or the monomers may be different, thereby forming a heterodimer. The multimerization moieties of each monomer of the IL27 receptor agonist can be configured to dimerize together. Exemplary multimerization moieties are described in Section 5.4.

[0066] In some embodiments, an IL27 mutein or IL27 receptor agonist can comprise one or more linker sequences connecting various components of its one or more polypeptide chains, for example, (1) an EBI3 portion and a p28 portion of IL27 via an intra-IL27 portion linker, if present on the same polypeptide chain; (2) an EBI3 portion and a multimerization portion (e.g., an Fc domain) via a multimerization portion linker; (3) a p28 portion and a multimerization domain (e.g., an Fc domain) via a multimerization portion linker; (4) a multimerization domain (e.g., an Fc domain) and a targeting portion or component thereof (e.g., a heavy chain of an scFv or Fab); (5) an EBI3 portion, a p28 portion, a multimerization domain or a targeting portion or component thereof and an IL27Ra (IL27Rα) portion; (6) an EBI3 portion, a p28 portion, a multimerization domain or a targeting portion or component thereof and a gp130 portion; or (8) any combination of the above. Exemplary linkers are described in Section 5.8.

[0067] In some embodiments, the IL27 agonist comprises an EBI3 portion, a p28 portion, and a multimerization portion (e.g., an Fc domain that can homodimerize or heterodimerize with another Fc domain to form an Fc region) and / or a stabilization portion (e.g., HSA), wherein the EBI3 portion and the p28 portion are configured such that they can associate to form a functional IL27 receptor agonist. Exemplary configurations of IL27 receptor agonists, designated IL27M2, IL27M3, IL27M4, IL27M5, IL27M6, IL27M7, IL27M8, IL27M9, IL27M10, IL27M11, IL27M12, IL27M13, IL27M14, IL27M15, IL27M16, IL27M17, IL27M18, IL27M19, IL27M20 and IL27M21, are shown in Figures 3-6.

[0068] When an IL27 agonist includes a multimerization moiety such as an Fc domain, the EBI3 and / or p28 moieties can be fused to the N-terminus or C-terminus of the Fc domain of the Fc region. As shown in Figures 3A-3G, IL27 agonists designated IL27M2, IL27M3, IL27M9, IL27M10, IL27M12, IL27M13, IL27M14, and IL27M15 contain EBI3 and p28 moieties at the N-terminus of the Fc domain. As shown in Figures 4A-4G, IL27 agonists designated IL27M4, IL27M5, IL27M6, IL27M7, IL27M8, IL27M11, IL27M16, IL27M17, IL27M18, and IL27M19 contain EBI3 and p28 moieties at the C-terminus of the Fc domain.

[0069] Most IL27 muteins and IL27 agonists are multimeric, e.g., dimeric, by association of EBI3 and p28 moieties that are present on different polypeptide chains and / or by association of multimerization moieties (e.g., Fc domains) that are configured to associate with one another. In some embodiments, the associated EBI3 and p28 moieties are on the same polypeptide chain (e.g., in IL27M1, IL27M3, IL27M4, IL27M5, IL27M8, IL27M9, IL27M12, IL27M15, IL27M16, and IL27M19, as shown in Figures 3A, 3C, 4A, 4B, 6B, 6C, 3D, 3G, 4D, and 4G, respectively). Furthermore, when the EBI3 domain and the p27 domain are present on the same polypeptide chain, the EBI3 portion can be N-terminal to the p28 portion (e.g., in IL27M4, IL27M8, IL27M12, and IL27M15, as shown in Figures 4A, 6B, 3D, and 3G, respectively) or C-terminal to the p28 portion (e.g., in IL27M3, IL27M5, and IL27M9, as shown in Figures 3C, 4B, and 6C, respectively).

[0070] In other embodiments, the linked EBI3 and p28 moieties are on different polypeptide chains associated via a multimerization moiety (e.g., an Fc domain forming an Fc region) (e.g., in IL27M2, IL27M6 and IL27M7 as shown in Figures 3B, 4C and 6A, respectively).

[0071] In yet other embodiments, the associated EBI3 and p28 portions are present in a bimolecular structure in which the EBI3 and p28 portions are present on different polypeptides, for example by association between an EBI3 portion in an EBI polypeptide or EBI protein and a p28 portion in a p28 polypeptide or p28 protein (e.g., IL27M9, IL27M10, IL27M11, IL27M21 shown in Figures 6C, 6D, 6E, and 5B, respectively).

[0072] The present disclosure generally refers to a polypeptide chain containing an EBI3 portion and / or a p28 portion and / or a multimerization portion (e.g., a first Fc domain) that can associate with another polypeptide chain containing an EBI3 portion and / or a p28 portion and / or a corresponding multimerization portion (e.g., a second Fc domain) as a "monomer" or "IL27 monomer," respectively. The term "monomer" also encompasses a polypeptide chain containing an EBI3 portion and / or a p28 portion and / or a stabilization portion (e.g., a first HSA domain). In some embodiments, a monomer containing a stabilization portion can associate with another monomer containing a stabilization portion (e.g., a second HSA domain) via the EBI3 portion and the p28 portion of the two monomers. Below are some illustrative examples of IL27 monomers of the present disclosure, described in the N-terminal to C-terminal direction. The individual elements of each monomer are described in detail herein, for example, in the following sections and numbered embodiments.

[0073] (1) Exemplary Monomer 1: IL27 p28 portion-optional linker-multimerization portion (see, e.g., FIG. 3B (left monomer), 3E). (2) Exemplary Monomer 2: IL27 EBI3 portion-optional linker-multimerization portion (see, e.g., right monomer in FIG. 3B).

[0074] (3) Exemplary Monomer 3: optional targeting moiety (e.g., scFv) or targeting moiety component (e.g., VH or VL of Fab)-optional linker-multimerization moiety-IL27 p28 moiety (see, e.g., Figures 4C (left monomer), 4E, 6A (left monomer), 6D (right monomer of left construct)).

[0075] (4) Exemplary Monomer 4: optional targeting moiety (e.g., scFv) or targeting moiety component (e.g., VH or VL of Fab)-multimerization moiety-optional linker-IL27 EBI3 moiety (see, e.g., Figures 4C (right monomer), 6A (right monomer), 6D (left monomer of right construct)).

[0076] (5) Exemplary Monomer 5 - IL27 EBI3 portion-optional linker-IL27 P28 portion-optional linker-multimerization portion (see, e.g., Figures 3A (both monomers), 3D (left monomer), and 3G).

[0077] (6) Exemplary Monomer 6: IL27 p28 portion-optional linker-IL27 EBI3 portion-optional linker-multimerization portion (see, e.g., both monomers in FIG. 4C ).

[0078] (7) Exemplary Monomer 7: optional targeting moiety (e.g., scFv) or targeting moiety component (e.g., VH or VL of Fab)-optional linker-multimerization moiety-optional linker-IL27 EBI3 moiety-optional linker-IL27 p28 moiety (see, e.g., Figures 4A (both monomers), 4D, 6B (left monomer)).

[0079] (8) Exemplary Monomer 8: optional targeting moiety (e.g., scFv) or targeting moiety component (e.g., VH or VL of Fab)-optional linker-multimerization moiety-IL27 p28 moiety-optional linker-IL27 EBI3 moiety (see, e.g., FIG. 4B (both monomers)).

[0080] (9) Exemplary Monomer 9: IL27 EBI3 portion-optional linker-stabilizing portion (see, e.g., FIG. 5B, right polypeptide). (10) Exemplary Monomer 10: IL27 p28 portion-optional linker-stabilizing portion (see, e.g., FIG. 5B, right polypeptide).

[0081] (11) Exemplary Monomer 11: stabilizing moiety-optional linker-IL27 EBI3 moiety. (12) Exemplary Monomer 12: Stabilizing Moiety-Optional Linker-IL27 p28 Moiety.

[0082] (13) Exemplary Monomer 13: IL27 EBI3 portion-optional linker-IL27 p28 portion-optional linker-stabilizing portion (see, e.g., FIG. 5A). (14) Exemplary Monomer 14: IL27 p28 portion-optional linker-IL27 EBI3 portion-optional linker-stabilizing portion.

[0083] (15) Exemplary Monomer 15: stabilizing moiety-optional linker-IL27 EBI3 moiety-optional linker-IL27 p28 moiety. (16) Exemplary Monomer 16: stabilizing moiety-optional linker-IL27 p28 moiety-optional linker-IL27 EBI3 moiety.

[0084] Where the present disclosure refers to a monomer comprising a targeting moiety, unless the context dictates otherwise, such reference to a monomer encompasses a monomer associated with another polypeptide chain that comprises the corresponding targeting moiety, e.g., the corresponding VL or VH of a Fab.

[0085] Exemplary combinations of exemplary monomers are provided in numbered embodiments 31-79. In certain aspects, the IL27 agonist comprises an IL27 mutein having the configuration of IL27M2, IL27M3, IL27M4, IL27M5, IL27M6, IL27M12, IL27M13, IL27M14, IL27M15, IL27M16, IL27M17, IL27M18, IL27M19, IL27M20, or IL27M21, with or without an optional targeting moiety. In other aspects, the IL27 agonist comprises an IL27 mutein having the configuration of IL27M7, IL27M8, IL27M10, or IL27M11, and includes a targeting moiety.

[0086] Reference to a particular IL27 mutein or IL27 receptor agonist structure (e.g., IL27M1, IL27M2, etc.) is not intended to be limiting, but rather to serve as an indication of the general structure of a subgenus of IL27 receptor agonists. Thus, reference to a particular IL27 mutein or IL27 receptor agonist structure is not intended to limit, for example, the particular amino acid sequence or pair of amino acid sequences of the polypeptides that form the IL27 mutein or IL27 receptor agonist. For example, IL27M1 comprises two polypeptides (i.e., IL27 monomers), where the first and second polypeptides each have the exemplary monomer 5 configuration (IL27 EBI3 portion-optional linker-IL27 p28 portion-optional linker-multimerization portion). In this example, the EBI3 portion of each monomer can be any EBI3 portion described herein. The EBI3 portions on the two monomers can be the same or different. Similarly, the p28 moiety of each monomer may be any p28 moiety described herein. The p28 moieties on the two monomers may be the same or different. The multimerization moiety of each monomer may be any multimerization moiety described herein. The multimerization moieties (e.g., Fc domains) on the two monomers may be the same (e.g., allowing homodimerization) or different (e.g., allowing heterodimerization). Furthermore, a linker may or may not be present, and if present, may be the same or different. In view of the present disclosure, it will be apparent to one of skill in the art that the IL27M__ nomenclature thereby serves to represent the general structure of a subgenus of IL27 agonists, where individual species share an overall structure but may differ in amino acid sequence, or the presence or absence of optional moieties as provided above in the description of the exemplary monomers (e.g., optional targeting moieties). In some instances, an IL27 agonist that includes one or more optional moieties (e.g., a targeting moiety) is given a separate reference (e.g., IL27M7) to define a further subgenus of IL27 muteins or IL27 receptor agonist constructs. Exemplary IL27 structures are described below with reference to exemplary monomers.

[0087] (1) IL27M1: a first exemplary monomer 5 associated with a second exemplary monomer 5 (e.g., as shown in FIG. 3A). (2) IL27M2: Exemplary monomer 1 associated with exemplary monomer 2 (e.g., as shown in FIG. 3B).

[0088] (3) IL27M3: a first exemplary monomer 6 associated with a second exemplary monomer 6 (e.g., as shown in FIG. 3C). (4) IL27M4: a first exemplary monomer 7 associated with a second exemplary monomer 7 (e.g., as shown in FIG. 4A).

[0089] (5) IL27M5: a first exemplary monomer 8 associated with a second exemplary monomer 8 (e.g., as shown in FIG. 4B). (6) IL27M6: Exemplary monomer 3 associated with exemplary monomer 4 (e.g., as shown in FIG. 4C).

[0090] (7) IL27M7: an exemplary monomer 3 comprising a first targeting moiety or first targeting moiety (e.g., as shown in FIG. 6A ), associated with an exemplary monomer 4 comprising a second targeting moiety or second targeting moiety, optionally when comprising the first and / or second targeting moiety, IL27M7 further comprises a third targeting moiety capable of associating with the first targeting moiety, and / or a fourth targeting moiety capable of associating with the second targeting moiety.

[0091] (8) IL27M8: Exemplary monomer 7 (e.g., as shown in FIG. 6B) comprising a first targeting moiety or first targeting moiety associated with a polypeptide comprising a second targeting moiety or second targeting moiety component and a multimerization moiety, optionally when comprising the first and / or second targeting moiety, IL27M8 further comprises a third targeting moiety capable of associating with the first targeting moiety and / or a fourth targeting moiety capable of associating with the second targeting moiety.

[0092] (9) IL27M9: Exemplary monomer 6 (e.g., shown in FIG. 6C) associated with a first targeting moiety or a polypeptide comprising a first targeting moiety component and a multimerization moiety, optionally, when comprising a first targeting moiety, IL27M9 further comprises a second targeting moiety capable of associating with the first targeting moiety.

[0093] (10) IL27M10: (ii) a first protein (e.g., as shown in FIG. 6D) associated with a second protein comprising (i) exemplary monomer 1 associated with a polypeptide comprising a first targeting moiety or a first targeting moiety component and a multimerization moiety, and (ii) exemplary monomer 2 associated with a polypeptide comprising a second targeting moiety or a second targeting moiety component and a multimerization moiety, optionally when comprising the first and / or second targeting moieties, IL27M10 further comprises a third targeting moiety capable of associating with the first targeting moiety and / or a fourth targeting moiety capable of associating with the second targeting moiety.

[0094] (11) IL27M11: (ii) a polypeptide comprising a first targeting moiety or a first targeting moiety component, associated with a polypeptide comprising a second targeting moiety or a second targeting moiety component and a multimerization moiety, (i) an exemplary monomer 3, and (ii) a polypeptide comprising a third targeting moiety or a third targeting moiety component, associated with a fourth targeting moiety, the fourth targeting moiety component, and a multimerization moiety, associated with a second protein comprising (i) an exemplary monomer 4 (e.g., as shown in FIG. 6E ). When comprising one protein, optionally a first, second, third and / or fourth targeting moiety, IL27M11 further comprises a fifth targeting moiety capable of associating with the first targeting moiety, and / or a sixth targeting moiety capable of associating with the second targeting moiety, and / or a seventh targeting moiety capable of associating with the third targeting moiety, and / or an eighth targeting moiety capable of associating with the fourth targeting moiety.

[0095] (12) IL27M12: Exemplary monomer 5 (e.g., shown in FIG. 3D) associated with a polypeptide chain comprising a multimerization moiety and optionally a first targeting moiety or targeting moiety component, optionally when comprising a first targeting moiety, IL27M12 further comprises a second targeting moiety capable of associating with the first targeting moiety.

[0096] (13) IL27M13: A first exemplary monomer 1 associated with a second exemplary monomer 1 (e.g., as shown in FIG. 3E). (14) IL27M14: a first exemplary monomer 1 having an EBI3 portion capable of associating with a p28 portion of the first exemplary monomer 1, associated with a second exemplary monomer 1 having an EBI3 portion capable of associating with a p28 portion of the second exemplary monomer 1 (e.g., as shown in FIG. 3E).

[0097] (15) IL27M15: exemplary monomer 5 (e.g., shown in FIG. 3G). (16) IL27M16: Exemplary monomer 7 (FIG. 4D) associated with a polypeptide chain comprising a multimerization moiety and optionally a targeting moiety or a first targeting moiety component, optionally when comprising a first targeting moiety, IL27M16 further comprises a second targeting moiety capable of associating with the first targeting moiety.

[0098] (17) IL27M17: a first exemplary monomer 3 associated with a second exemplary monomer 3 (e.g., as shown in FIG. 4E). (18) IL27M18: a first exemplary monomer 3 having an EBI3 portion capable of associating with a p28 portion of the first exemplary monomer 3 associated with a second exemplary monomer 3, and having an EBI3 portion capable of associating with a p28 portion of the second exemplary monomer 3 (e.g., as shown in FIG. 4F).

[0099] (19) IL27M19: exemplary monomer 7 (e.g., shown in FIG. 4G). (20) IL27M20: exemplary monomer 18 or exemplary monomer 21 (e.g., as shown in FIG. 5A).

[0100] (21) IL27M21: IL27M21 generally has the configuration shown in Figure 5B. Particular embodiments of IL27M21 include (1) Exemplary monomer 14 associated with Exemplary monomer 15, (2) Exemplary monomer 14 associated with Exemplary monomer 17, (3) Exemplary monomer 16 associated with Exemplary monomer 15, and (4) Exemplary monomer 16 associated with Exemplary monomer 17.

[0101] In the IL27 receptor agonists of the present disclosure, when the targeting moiety is an antigen binding domain ("ABD") of an antibody, each monomer can include a targeting moiety component, e.g., a heavy chain variable region (VH) or a light chain variable region (VL)) and a corresponding targeting moiety component (e.g., a VL where the targeting moiety is a VH, or a VH where the targeting moiety is a VL). The targeting moiety component can associate with the corresponding targeting moiety component to form the targeting moiety. Thus, a single monomer may be composed of two polypeptide chains, one polypeptide chain having one targeting moiety component (e.g., (VH) and the other polypeptide chain having a corresponding targeting moiety component (e.g., VL). Thus, the targeting moiety itself may comprise a heavy chain variable domain and a light chain variable domain on separate polypeptide chains. For example, for an IL27 receptor agonist monomer comprising a targeting moiety, the monomer may be composed of polypeptide A and polypeptide B. Polypeptide A may comprise, for example, from N-terminus to C-terminus: heavy chain variable domain of the targeting moiety (e.g., targeting moiety component)-optional linker-multimerization moiety-optional linker-IL27 EBI3 moiety-IL27 p28 moiety, and polypeptide B may comprise the light chain variable domain of the targeting moiety (i.e., the corresponding targeting moiety component). Targeting moieties are further described and defined in Section 5.7 and in numbered embodiments 259-315.

[0102] Alternatively, an scFv can be used as a targeting moiety, in which the heavy and light chain variable regions of the targeting moiety are fused to each other in a single polypeptide. In various embodiments, the IL27 receptor agonist does not include: (a) a cytokine other than IL27; (b) an anti-IL27 antibody or antibody fragment; (c) an anti-DNA antibody or antibody fragment; (b) a non-binding antibody variable domain; or any combination of two, three, or all four of these.

[0103] The disclosure further provides EBI3 and p28 protein components of a bimolecular IL27 agonist as shown in Figures 3D and 3E. Such polypeptides are useful, inter alia, in combination with each other for combination therapy, and are also referred to herein as IL27 agonists.

[0104] The IL27 receptor agonists of the present disclosure and / or the IL27 muteins in the IL27 receptor agonists of the present disclosure and / or the IL27 monomers in the IL27 receptor agonists of the present disclosure can have amino acid modifications that result in reduced binding affinity to the IL27 receptor complex (e.g., a receptor complex comprising gp130 and IL27Ra (IL27Rα)) compared to wild-type IL27. Overall, the IL27 receptor agonists of the present disclosure and / or the IL27 muteins in the IL27 receptor agonists of the present disclosure and / or the IL27 monomers in the IL27 receptor agonists of the present disclosure can have normal or reduced binding (i.e., reduced affinity) to the IL27 receptor complex (e.g., up to 10-fold, up to 50-fold, up to 100-fold, up to 200-fold, up to 500-fold, up to 1,000-fold, up to 2,000-fold, or up to 5,000-fold). Binding can be attenuated through one or more amino acid substitutions in the EBI3 and / or p28 sequences and / or the inclusion of one or more IL27Ra (IL27Rα) moieties in the IL27 receptor agonist.

[0105] In certain embodiments, the IL27 receptor agonists, IL27 muteins, and / or IL27 monomers of the present disclosure have one or more amino acid substitutions in the IL27 EBI3 portion, the IL27 p28 portion, or both the IL27 EBI3 and p28 portions that reduce binding to the IL27 receptor complex, e.g., as disclosed in Section 5.6 and therein. For example, in some embodiments, an IL27 mutein can attenuate binding to the human IL27 receptor complex by up to 10- to 1,000-fold compared to wild-type human IL27.

[0106] The binding affinity of IL27 to the receptor complex can be assayed, for example, by surface plasmon resonance (SPR) techniques analyzed on a Biacore instrument (Liljeblad et al., 2000, Glyco J 17:323-329).

[0107] The present disclosure further provides a p28 protein and an EBI3 protein. Some IL27 receptor agonists and muteins of the present disclosure comprise a p28 protein associated with an EBI3 protein.

[0108] In some embodiments, the EBI3 protein is composed of two polypeptides. In some embodiments, the EBI3 protein comprises a first polypeptide comprising (i) a first targeting moiety, (ii) an optional first linker, and (iii) a first multimerization moiety, and a second peptide comprising (i) an EBI3 moiety, (ii) an optional second linker, and (iii) a second multimerization moiety associated with the first multimerization moiety. The heterodimer on the right side of Figure 6D shows a first exemplary EBI3 protein.

[0109] In other embodiments, the EBI3 protein comprises a first polypeptide comprising (i) a first targeting moiety, an optional first linker, and a first multimerization moiety, a second polypeptide comprising (i) a second targeting moiety, (ii) an optional first linker, and (iii) a first multimerization moiety, and a second polypeptide comprising (i) a second targeting moiety, (ii) an optional second linker, (iii) a second multimerization moiety associated with the first multimerization moiety, (iv) an optional third linker, and (v) an EBI3 moiety. The heterodimer on the right side of Figure 6E shows a second exemplary EBI3 protein.

[0110] In certain embodiments, an EBI3 protein of the disclosure lacks a p28 portion (but is capable of binding to a p28 portion, eg, in a p28 protein). In some embodiments, the p28 protein is composed of two polypeptides. In some embodiments, the p28 protein comprises a first polypeptide comprising (i) a first targeting moiety, (ii) an optional first linker, and (iii) a first multimerization moiety, and a second peptide comprising (i) a p28 moiety, (ii) an optional second linker, and (iii) a second multimerization moiety associated with the first multimerization moiety. The heterodimer on the left side of Figure 6D shows a first exemplary p28 protein.

[0111] In other embodiments, the p28 protein comprises: (i) a first polypeptide comprising a first targeting moiety, an optional first linker, and a first multimerization moiety; (i) a second polypeptide comprising a second targeting moiety, (ii) an optional first linker, and (iii) a first multimerization moiety; and (i) a second polypeptide comprising a second targeting moiety, (ii) an optional second linker, (iii) a second multimerization moiety associated with the first multimerization moiety, (iv) an optional third linker, and (v) a p28 moiety. The heterodimer on the left of Figure 6E shows a second exemplary EBI3 protein.

[0112] In certain embodiments, a p28 protein of the present disclosure lacks an EBI3 portion (but is capable of associating with an EBI3 portion, eg, an EBI3 portion in an EBI3 protein). The p28 protein is typically configured to associate with an EBI3 portion, such as the EBI3 portion of an EBI3 protein (see, e.g., Figures 6D and 6E). The EBI3 protein is typically configured to associate with a p28 portion, such as the p28 portion of a p28 protein (see, e.g., Figures 6D and 6E). The EBI3 protein of the present disclosure can associate with a p28 protein of the present disclosure to form an IL27 agonist.

[0113] Further details of the components of the IL27 receptor agonist, EBI3 protein, and p28 protein of the present disclosure are provided below. 5.3.IL27 EBI3 and p28 moieties The present disclosure provides IL27 receptor agonists having an EBI3 portion and a p28 portion having wild-type or mutant EBI3 and p28 sequences. The present disclosure further provides a p28 portion having a mutant p28 sequence. Exemplary EBI3 portions are disclosed in Section 5.3.1 and exemplary p28 portions are disclosed in Section 5.3.2.

[0114] IL27 is a heterodimer consisting of the Epstein-Barr virus-induced gene 3 (EBI3) and p28 subunits. Thus, as used herein, the term "IL27 domain" refers to the EBI3 portion and / or the p28 portion.

[0115] IL27 domains encompass mature human and non-human (e.g., mouse, rat, pig, non-human primate) EBI3 and p28 polypeptides, including homologs, variants, and fragments thereof, as well as EBI3 and p28 polypeptides having, for example, leader sequences (e.g., signal peptides), and modified versions of the foregoing. In certain embodiments, the IL27 agonists of the present disclosure have one or more amino acid modifications, e.g., substitutions, deletions, or insertions, in the EBI3 portion or its p28-binding domain, and / or the p28 portion or its IL27Ra (IL27Rα)-binding domain, and / or the gp130-binding domain, compared to portions or domains in wild-type or naturally occurring IL27 variants. Thus, the terms "EBI3 portion" and "p28 portion" encompass proteins with substantially similar sequences to mature wild-type human, mouse, pig, or rat EBI3 and p28, respectively, and more preferably proteins with substantially similar sequences to mature wild-type human EBI3 and p28, respectively.

[0116] In various embodiments, the EBI3 portion and / or p28 portion comprise an amino acid sequence having at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to a human, mouse, pig, or rat EBI3 portion and / or p28 portion sequence (e.g., those exemplified in Sections 5.3.1 and 5.3.2, respectively).

[0117] 5.3.1.EBI3 part EBI3 was first described as being expressed in B lymphocytes infected with Epstein-Barr virus. The EBI3 structure consists of a tandem pair of modified fibronectin type III (FnIII) ​​domains called cytokine binding domains (CBDs) (see FIG. 1A). This domain typically contains two pairs of cysteine ​​residues involved in disulfide bridge formation and a characteristic WSXWS signature motif. EBI3 is known to exist in three forms, one of which is a heterodimer with p28.

[0118] Each IL27 EBI3 moiety of the IL27 receptor agonist of the present disclosure comprises a p28-binding domain of wild-type or mutant IL27 EBI3. In some embodiments, the IL27 receptor agonist of the present disclosure comprises a single IL27 EBI3 moiety (e.g., an IL27 EBI3 moiety on the first monomer or on the second monomer in embodiments where the IL27 receptor agonist is monovalent for IL27). In some embodiments, the IL27 receptor agonist of the present disclosure comprises two IL27 EBI3 moieties (e.g., a first IL27 EBI3 moiety on the first monomer and a second IL27 EBI3 moiety on the second monomer in embodiments where the IL27 agonist is bivalent for IL27). In such embodiments, the two IL27 EBI3 moieties may be the same or different.

[0119] In some embodiments, the IL27 EBI3 portion is or comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to the p28 binding domain of mammalian, e.g., human or mouse, EBI3.

[0120] In some embodiments, the p28-binding domain of EBI3 comprises amino acids corresponding to F97, E124, E159, and D210 of full-length human EBI3. F97, E124, E159, and D210 are predicted to be involved in binding of EBI3 to p28 (Rousseau et al., 2010, Proc Natl Acad Sci USA. 107(45):19420-19425). Thus, in some embodiments, the p28-binding domain of EBI3 comprises amino acids 97-210 of full-length human EBI3, or the equivalent amino acids of another mammalian, e.g., mouse EBI3.

[0121] In some embodiments, the mammalian EBI3 is full length human EBI3. In other embodiments, the mammalian EBI3 is mature human EBI3. The sequence of human EBI3 has Uniprot identifier Q14213 (uniprot.org / uniprot / Q14213). In some embodiments, the mammalian EBI3 is full length mouse EBI3. In some embodiments, the mammalian EBI3 is mature mouse EBI3. The sequence of mouse EBI3 has Uniprot identifier O35228 (uniprot.org / uniprot / O35228).

[0122] Human EBI3 is synthesized as a 229 amino acid precursor polypeptide from which 20 amino acids are removed to produce mature secreted EBI3. A first fibronectin III domain spans amino acids 24-130 of EBI3 and a second fibronectin III domain spans amino acids 131-227 of EBI3. Thus, in some embodiments, the EBI3 portion of the disclosure comprises full-length human EBI3. In other embodiments, the EBI3 portion of the disclosure comprises mature human EBI3 corresponding to positions 21-229 of the 229 amino acid precursor sequence shown below, or two fibronectin domains corresponding to positions 24-228 of the 229 amino acid precursor sequence shown below.

[0123] [ka]

[0124] Amino acid 24 of full-length human EBI3 is amino acid 1 of mature human EBI3. Naturally occurring sequence variants of EBI3 have been reported. The EBI3 sequence having European Nucleotide Archive accession number AAA93193.1 has a QL→HV substitution at positions 144-145 of the amino acid sequence shown above. SNP variant rs1803524 has an A→V substitution at position 174. SNP variant rs4740 has a V→I substitution at position 201. Thus, the EBI3 portion of the present disclosure may contain any combination of the foregoing variants, for example, one, two, or all of: (1) a QL→HV substitution at positions 144-145, (2) an A→V substitution at position 174, and a V→I substitution at position 201.

[0125] Human EBI3 contains potential N-linked glycosylation sites at amino acids 55 and 105. The present disclosure encompasses EBI3 partial molecules with or without N-linked glycans at N55 and / or N105, or equivalent positions in EBI3 of other species.

[0126] The EBI3 portion may include a peptide tag at its N-terminus or C-terminus, for example a peptide tag that facilitates purification. In some embodiments, the peptide tag is a myc-myc-his (mmh) tag.

[0127] In some embodiments, the EBI3 portion comprises an EBI3 amino acid sequence set forth in Section 5.1.1. 5.3.2.p28 part p28 is a "long-chain" cytokine with a four-helix bundle fold. These four helices are designated AD from the N-terminus to the C-terminus. p28 contains a leucine zipper motif that indicates homo- or heterodimerization (see FIG. 1A). p28 is normally co-expressed with EBI3 in activated macrophages and dendritic cells and has been found to form non-covalent heterodimers.

[0128] Each IL27 p28 moiety of the IL27 receptor agonist of the present disclosure comprises a wild-type or mutant IL27 p28 moiety. In some embodiments, the IL27 receptor agonist of the present disclosure comprises a single IL27 p28 moiety (e.g., an IL27 p28 moiety on a first monomer or on a second monomer in embodiments where the IL27 receptor agonist is monovalent for IL27). In some embodiments, the IL27 receptor agonist of the present disclosure comprises two IL27 p28 moieties (e.g., a first IL27 p28 moiety on a first monomer and a second IL27 p28 moiety on a second monomer in embodiments where the IL27 agonist is bivalent for IL27). In such embodiments, the two IL27 p28 moieties may be the same or different.

[0129] In some embodiments, the IL27 p28 portion is or comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to the IL27Ra (IL27Rα) binding domain of mammalian, e.g., human or mouse p28.

[0130] In some embodiments, the IL27Ra (IL27Rα) binding domain comprises p28 contact site 2 (see, e.g., Rousseau et al., 2010, Proc Natl Acad Sci USA. 107(45): 19420-19425). Contact site 2 comprises solvent exposed residues of the αA and αC helices of p28 (Rousseau et al., 2010, Proc Natl Acad Sci USA. 107(45): 19420-19425). In some embodiments, the IL27Ra (IL27Rα) binding domain of p28 comprises amino acids corresponding to H52, K56, S59, E60, W138, L142, R145, D146, R149, and H150 of full-length human p28. In some embodiments, the IL27Ra (IL27Rα) binding domain of p28 comprises amino acids 52-150 of full-length human p28, or the equivalent amino acids of another mammalian, eg, mouse, p28.

[0131] In some embodiments, the IL27 p28 portion is or comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to the gp130 binding domain of mammalian, e.g., human or mouse p28.

[0132] In some embodiments, the gp130-binding domain comprises p28 contact site 3 (see, e.g., Rousseau et al., 2010, Proc Natl Acad Sci USA. 107(45):19420-19425). Contact site 3 is located at the N-terminus of the αD helix and engages the Ig domain of gp130 (Rousseau et al., 2010, Proc Natl Acad Sci USA. 107(45):19420-19425). In some embodiments, the gp130-binding domain of p28 comprises amino acids corresponding to W197, L200, L201, Y204, and R205 of full-length human p28. In some embodiments, the gp130-binding domain of p28 comprises amino acids 197-205 of full-length human p28, or the equivalent amino acids of another mammalian, e.g., mouse, p28. In certain embodiments, the gp210-binding domain comprises, in addition to W197, L200, L201, Y204, and R205 of full-length human p28, further comprising L73 and V76. Thus, in certain embodiments, the gp130-binding domain of p28 comprises amino acids 73-205 of full-length human p28, or the equivalent amino acids of another mammalian, e.g., mouse, p28.

[0133] In some embodiments, the mammalian p28 is full length human p28. In other embodiments, the mammalian p28 is mature human p28. The sequence of human p28 has the Uniprot identifier Q8NEV9 (uniprot.org / uniprot / Q8NEV9). In some embodiments, the mammalian p28 portion is full length mouse p28. In some embodiments, the mammalian p28 is mature mouse p28. The sequence of mouse p28 has the Uniprot identifier Q8K3I6 (uniprot.org / uniprot / Q8K3I6).

[0134] Human p28 is synthesized as a 243 amino acid precursor polypeptide from which 28 amino acids are removed to produce mature secreted p28. Thus, in some embodiments, the p28 portion of the present disclosure includes mature human p28 corresponding to positions 29-243 of the 243 amino acid precursor sequence shown below.

[0135] [ka]

[0136] Amino acid 29 of full length human p28 is amino acid 1 of mature human p28. The four helices (A, B, C, and D) of p28 are shown in bold font above. In some embodiments, a p28 portion of the present disclosure comprises a region spanning the four helices of p28, corresponding to positions 39-224 of the 243 amino acid precursor sequence shown above.

[0137] Naturally occurring sequence variants of p28 have been reported. SNP variant rs17855740 has an S→A substitution at position 59. SNP variant rs181206 has an L→P substitution at position 119. Thus, the p28 portion of the present disclosure may contain one or both of: (1) an S→A substitution at position 59, and / or (2) an L→P substitution at position 119.

[0138] In certain embodiments, the IL27 p28 portion comprises one or more amino acid substitutions that reduce binding to IL27Ra (IL27Rα) and / or gp130. For example, in some embodiments, the IL27 p28 portion may have up to 1,000-fold reduced binding to human IL27Ra (IL27Rα) and / or gp130 compared to wild-type human IL27 p28. In some embodiments, the IL27 p28 portion may have up to 100-fold, up to 50-fold, up to 25-fold, up to 20-fold, up to 15-fold, up to 10-fold, or up to 5-fold reduced binding to human IL27Ra (IL27Rα) and / or gp130 compared to wild-type human IL27 p28.

[0139] Exemplary amino acid substitutions include, but are not limited to, substitutions at amino acids H52, K56, S59, E60, L73, V76, W138, L142, R145, D146, R149, H150, W197, L200, L201, Y204, and R205, where the amino acid positions are relative to the full-length human IL27 p28 amino acid sequence. The corresponding amino acid positions in the full-length human, full-length mouse, and mature mouse sequences are provided in Table 1. In certain embodiments, the amino acid at each identified residue is substituted with alanine.

[0140] [Table 1]

[0141] An exemplary amino acid substitution in full length human p28 H52 is H52A. An exemplary amino acid substitution in full-length human p28 K56 is K56A. An exemplary amino acid substitution in full length human p28 S59 is S59A.

[0142] An exemplary amino acid substitution in full-length human p28 E60 is E60A. An exemplary amino acid substitution in full length human p28 L73 is L73A. An exemplary amino acid substitution in full length human p28 V76 is V76A.

[0143] An exemplary amino acid substitution in full length human p28 W138 is W138A. An exemplary amino acid substitution in full length human p28 L142 is L142A. An exemplary amino acid substitution in full length human p28 R145 is R145A.

[0144] An exemplary amino acid substitution in full-length human p28 D146 is D146A. An exemplary amino acid substitution in full length human p28 R149 is R149A. An exemplary amino acid substitution in full length human p28 H150 is H150A.

[0145] An exemplary amino acid substitution in full length human p28 HW197 is HW197A. An exemplary amino acid substitution in full length human p28 L200 is L200A. An exemplary amino acid substitution in full-length human p28 L201 is L201A.

[0146] An exemplary amino acid substitution in full length human p28 Y204 is Y204A. An exemplary amino acid substitution in full length human p28 R205 is R205A. In some embodiments, the p28 moiety is fused either directly or indirectly, optionally via a linker (e.g., as described in Section 5.8), to the IL27 p28 binding domain of IL27Ra (IL27Rα) (i.e., the IL27Ra (IL27Rα) moiety). If present, the IL27 p28 binding domain of IL27Ra (IL27Rα) may be N-terminal or C-terminal to the IL27 p28 moiety. When the p28 moiety is fused "directly" to the IL27 p28 binding domain of IL27Ra (IL27Rα), the p28 moiety and the IL27 p28 binding domain of IL27Ra (IL27Rα) are positioned adjacent to each other on the same monomer and are separated only by a linker, if one is present. When the p28 moiety is "indirectly" fused to the IL27 p28-binding domain of IL27Ra (IL27Rα), the p28 moiety and the IL27 p28-binding domain of IL27Ra (IL27Rα) are separated by one or more other domains (e.g., an IL27 EBI3 moiety) on the same monomer or are located on separate monomers.

[0147] In some embodiments, the p28 moiety is fused directly or indirectly to the IL27 p28 binding domain of gp130 (i.e., the gp130 moiety), optionally via a linker (e.g., as described in Section 5.8). If present, the IL27 p28 binding domain of gp130 may be N-terminal or C-terminal to the IL27 p28 moiety. When the p28 moiety is fused "directly" to the IL27 p28 binding domain of gp130, the p28 moiety and the IL27 p28 binding domain of gp130 are adjacently located on the same monomer, separated only by a linker, if present. When the p28 moiety is fused "indirectly" to the IL27 p28 binding domain of gp130, the p28 moiety and the IL27 p28 binding domain of gp130 are separated by one or more other domains (e.g., the IL27 EBI3 moiety) on the same monomer, or are located on separate monomers.

[0148] Human p28 contains several potential O-linked glycosylation sites, but no N-linked glycosylation sites. Mouse p28 contains a potential N-linked glycosylation site at amino acid 85. The present disclosure encompasses p28 portions with or without N-linked and / or O-linked glycans.

[0149] The p28 portion may include a peptide tag at its N-terminus or C-terminus, for example a peptide tag that facilitates purification. In some embodiments, the peptide tag is a myc-myc-his (mmh) tag.

[0150] In some embodiments, the p28 portion comprises a p28 amino acid sequence set forth in Section 5.1.1. 5.4. Multimerization moiety Fc Domain In some embodiments, the IL27 agonists and IL27 monomers of the present disclosure comprise one or more multimerization moieties. In certain embodiments, the IL27 monomers of the present disclosure comprise a single multimerization moiety (e.g., a single Fc domain) and / or the IL27 agonists of the present disclosure comprise two multimerization moieties (e.g., two Fc domains that can associate to form an Fc region).

[0151] The IL27 agonists and IL27 monomers of the present disclosure can comprise an Fc domain, or a pair of Fc domains that associate to form an Fc region, derived from any suitable species. In one embodiment, the Fc domain is derived from a human Fc domain. In a preferred embodiment, the EBI3 and / or p28 portion of the IL27 agonist or IL27 monomer of the present disclosure is fused to an IgG Fc molecule (e.g., an IgG1 or IgG4 Fc domain).

[0152] The EBI3 and / or p28 moieties can be fused to the N-terminus or C-terminus of an Fc molecule, such as an IgG Fc domain (eg, as shown in Figures 3 and 4). One embodiment of the present disclosure relates to a dimer comprising two Fc fusion polypeptides by fusing an IL27 domain (e.g., an EBI3 moiety and / or a p28 moiety) to an Fc region of an antibody, e.g., by fusing an EBI3 moiety and / or a p28 moiety to an Fc domain that can form an IL27 monomer capable of dimerization upon expression, or by fusing an EBI3 moiety to a second Fc domain that forms two different IL27 monomers capable of dimerization upon expression. Dimers can be made, for example, by inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in a host cell transformed with the recombinant expression vector, allowing the expressed fusion protein to assemble in a manner similar to an antibody molecule, and allowing interchain bonds to form between the Fc domains to produce a dimer. In some embodiments, the Fc dimer polypeptide contains an EBI3 moiety or a p28 moiety, and the IL27 agonist is formed by the association of two Fc domains. In other embodiments, the Fc dimeric polypeptide comprises both an EBI3 portion and a p28 portion, either on different Fc polypeptide monomers or on the same Fc polypeptide monomer.Thus, in various embodiments, the IL27 agonists of the present disclosure have a stoichiometric ratio of Fc domain:EBI3 portion or Fc domain:p28 portion of 1:1, 2:1, or 4:1.

[0153] The Fc domain that can be incorporated into the IL27 monomer can be derived from any suitable class of antibody, including IgA (including subclasses IgA1 and IgA2), IgD, IgE, IgG (including subclasses IgG1, IgG2, IgG3 and IgG4), and IgM. In one embodiment, the Fc domain is derived from IgG1, IgG2, IgG3, or IgG4. In one embodiment, the Fc domain is derived from IgG1. In one embodiment, the Fc domain is derived from IgG4.

[0154] The two Fc domains within an Fc region may be the same or different from each other. In natural antibodies, the Fc domains are typically identical, but for purposes of producing multispecific binding molecules, such as the IL27 agonists of the present disclosure, the Fc domains may advantageously be different to allow heterodimerization, as described in Section 5.4.2 below.

[0155] In natural antibodies, the heavy chain Fc domain of IgA, IgD and IgG is composed of two heavy chain constant domains (CH2 and CH3), and the heavy chain Fc domain of IgE and IgM is composed of three heavy chain constant domains (CH2, CH3 and CH4), which dimerize to create the Fc region.

[0156] In the IL27 agonists of the present disclosure, the Fc region and / or Fc domains therein may be chimeric, combining sequences from antibodies of one or more different classes. Thus, the Fc region and / or Fc domains therein may include heavy chain constant domains of one or more different classes of antibodies, e.g., one, two or three different classes.

[0157] In one embodiment, the Fc region comprises CH2 and CH3 domains derived from IgG1. In one embodiment, the Fc region comprises CH2 and CH3 domains derived from IgG2.

[0158] In one embodiment, the Fc region comprises CH2 and CH3 domains derived from IgG3. In one embodiment, the Fc region comprises CH2 and CH3 domains derived from IgG4.

[0159] In one embodiment, the Fc region comprises a CH4 domain from IgM. The IgM CH4 domain is typically located C-terminal to the CH3 domain. In one embodiment, the Fc region comprises a CH2 domain and a CH3 domain derived from an IgG and a CH4 domain derived from an IgM.

[0160] In further embodiments, the chimeric Fc domain may comprise part or all of a CH2 sequence derived from a human IgG1, human IgG2, or human IgG4 CH2 region, and part or all of a CH3 sequence derived from a human IgG1, human IgG2, or human IgG4. The chimeric Fc domain may also contain a chimeric hinge region, as described in Section 5.8.2.1. For example, the chimeric hinge may comprise an "upper hinge" sequence derived from a human IgG1, human IgG2, or human IgG4 hinge region, in combination with a "lower hinge" sequence derived from a human IgG1, human IgG2, or human IgG4 hinge region. A particular example of a chimeric Fc domain that may be included in any of the IL27 muteins described herein comprises, from N-terminus to C-terminus: [IgG4 CH1]-[IgG4 upper hinge]-[IgG2 lower hinge]-[IgG4 CH2]-[IgG4 CH3]. Another example of a chimeric Fc domain that may be included in any of the antigen-binding molecules described herein includes, from N-terminus to C-terminus: [IgG1 CH1]-[IgG1 upper hinge]-[IgG2 lower hinge]-[IgG4 CH2]-[IgG1 CH3]. These and other examples of chimeric Fc domains that may be included in any of the antigen-binding molecules of the invention are described in WO 2014 / 121087. Chimeric Fc regions with these general structural arrangements and variants thereof can have altered Fc receptor binding, which in turn affects Fc effector function.

[0161] It will be understood that the heavy chain constant domain for use in producing the Fc region of the IL27 agonist of the present disclosure may comprise a variant of a naturally occurring constant domain. Such a variant may comprise one or more amino acid variants compared to the wild-type constant domain. In one example, the Fc region of the present disclosure comprises at least one constant domain that differs in sequence from the wild-type constant domain. It will be understood that the variant constant domain may be longer or shorter than the wild-type constant domain. Preferably, the variant constant domain is at least 60% identical or similar to the wild-type constant domain. In another example, the variant constant domain is at least 70% identical or similar. In another example, the variant constant domain is at least 80% identical or similar. In another example, the variant constant domain is at least 90% identical or similar. In another example, the variant constant domain is at least 95% identical or similar.

[0162] IgM and IgA naturally occur in humans as covalently linked multimers of a common H2L2 antibody unit. IgM exists as a pentamer when it incorporates a J chain or as a hexamer when it lacks a J chain. IgA exists as a monomer and a dimer form. The heavy chains of IgM and IgA have an 18 amino acid extension to the C-terminal constant domain, known as the tailpiece. The tailpiece contains cysteine ​​residues that form disulfide bonds between heavy chains in the polymer and is believed to play an important role in polymerization. The tailpiece also contains a glycosylation site. In certain embodiments, the IL27 agonist of the present disclosure does not contain a tailpiece.

[0163] The Fc domain incorporated into the IL27 agonists of the present disclosure may include one or more modifications that alter the functional properties of the protein, for example, binding to an Fc receptor such as FcRn or a leukocyte receptor, binding to complement, modified disulfide bond structures, or modified glycosylation patterns. Exemplary Fc modifications that alter effector function are described in Section 5.4.2.

[0164] The Fc domain can also be engineered to include modifications that improve the manufacturability of asymmetric IL27 agonists, for example, by allowing heterodimerization, which is the preferential pairing of non-identical Fc domains over identical Fc domains. Heterodimerization allows for the production of IL27 agonists in which different polypeptide components are connected to each other by Fc regions that contain Fc domains that differ in sequence. Examples of heterodimerization strategies are illustrated in Section 5.4.2.1.

[0165] Alternatively, the Fc domain may be a soluble monomeric Fc domain with reduced ability to self-associate. See, for example, Helm et al., 1996, J. Biol. Chem. 271:7494-7500 and Ying et al., 2012, J Biol Chem. 287(23): 19399-19408. IL27 agonists can still dimerize via association of the EBI3 and p28 moieties. Examples of soluble monomeric Fc domains include amino acid substitutions at positions corresponding to T366 and / or Y407 in CH3, as described in US Patent Application Publication No. 2019 / 0367611. The monomeric Fc domain may be of any Ig subtype and may include additional substitutions that reduce effector function, as described in Section 5.4.2.

[0166] As used herein, the term "Fc region" can include an Fc domain with or without a hinge sequence. In various embodiments in which the Fc region includes a heavy chain constant region that includes a hinge domain, positions 233-236 in the hinge domain can be G, G, G, and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, with positions numbered according to EU numbering. Optionally, the heavy chain constant region includes, from the N-terminus to the C-terminus, a hinge domain, a CH2 domain, and a CH3 domain. Optionally, the heavy chain constant region includes, from the N-terminus to the C-terminus, a CH1 domain, a hinge domain, a CH2 domain, and a CH3 domain. Optionally, the CH1 region (if present), the remainder of the hinge region (if present), the CH2 region, and the CH3 region are of the same human isotype. Optionally, the CH1 region (if present), remainder of the hinge region (if present), CH2 region, and CH3 region are human IgG1. Optionally, the CH1 region (if present), remainder of the hinge region (if present), CH2 region, and CH3 region are human IgG2. Optionally, the CH1 region (if present), remainder of the hinge region (if present), CH2 region, and CH3 region are human IgG4.

[0167] Optionally, the constant region has a CH3 domain modified to reduce binding to Protein A. These and other examples of Fc regions that may be included in any of the IL27 muteins of the present disclosure are described in WO 2016 / 161010. Exemplary hinge sequences are described in Section 5.8.2 and therein.

[0168] It will be appreciated that any of the above modifications can be combined in any suitable manner to achieve the desired functional properties and / or can be combined with other modifications to alter the properties of the IL27 agonist.

[0169] 5.4.2. Fc Domains with Modified Effector Functions In some embodiments, the Fc domain comprises one or more amino acid substitutions that reduce binding to an Fc receptor and / or effector function.

[0170] In a particular embodiment, the Fc receptor is an Fcγ receptor. In one embodiment, the Fc receptor is a human Fc receptor. In one embodiment, the Fc receptor is an activating Fc receptor. In a specific embodiment, the Fc receptor is an activating human Fcγ receptor, more specifically human FcγRIIIa, FcγRI or FcγRIIa, most specifically human FcγRIIIa. In one embodiment, the effector function is one or more selected from the group of complement-dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and cytokine secretion. In a particular embodiment, the effector function is ADCC.

[0171] In one embodiment, the Fc domain (e.g., the Fc domain of an IL27 monomer) or Fc region (e.g., one or both Fc domains of an IL27 receptor agonist that can associate to form an Fc region) comprises an amino acid substitution at a position selected from the group of E233, L234, L235, N297, P331 and P329 (numbering according to Kabat EU index). In a more specific embodiment, the Fc domain or Fc region comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numbering according to Kabat EU index). In some embodiments, the Fc domain or Fc region comprises the amino acid substitutions L234A and L235A (numbering according to Kabat EU index). In one such embodiment, the Fc domain or Fc region is an Igd Fc domain or Fc region, particularly a human Igd Fc domain or Fc region. In one embodiment, the Fc domain or Fc region comprises an amino acid substitution at position P329. In a more specific embodiment, the amino acid substitution is P329A or P329G, in particular P329G (numbering according to EU index of Kabat). In one embodiment, the Fc domain or Fc region comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331 (numbering according to EU index of Kabat). In a more specific embodiment, the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S. In a particular embodiment, the Fc domain or Fc region comprises amino acid substitutions at positions P329, L234 and L235 (numbering according to EU index of Kabat). In a more specific embodiment, the Fc domain comprises the amino acid mutations L234A, L235A and P329G ("P329G LALA", "PGLALA" or "LALAPG").

[0172] Typically, the same one or more amino acid substitutions are present in each of the two Fc domains of the Fc region. Thus, in a particular embodiment, each Fc domain of the Fc region comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e., in each of the first and second Fc domains of the Fc region, the leucine residue at position 234 is replaced by an alanine residue (L234A), the leucine residue at position 235 is replaced by an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (Kabat EU index numbering).

[0173] In one embodiment, the Fc domain is an IgG1 Fc domain, particularly a human IgG1 Fc. In some embodiments, the IgG1 Fc domain is a mutant IgG1 that includes D265A, N297A mutations (EU numbering) to reduce effector function.

[0174] In another embodiment, the Fc domain is an IgG4 Fc domain with reduced binding to an Fc receptor. An exemplary IgG4 Fc domain with reduced binding to an Fc receptor may comprise an amino acid sequence selected from Table 2 below. In some embodiments, the Fc domain comprises only the bolded portion of the sequence shown below.

[0175] [Table 2-1]

[0176] [Table 2-2]

[0177] [Table 2-3]

[0178] In certain embodiments, the IgG4 with reduced effector function comprises the bolded portion of the amino acid sequence of SEQ ID NO: 6 (SEQ ID NO: 31 of WO 2014 / 121087), and is also sometimes referred to herein as IgG4 or hIgG4.

[0179] For IL27 agonists of the disclosure that are heterodimeric, it is possible to incorporate combinations of the above mutant IgG4 Fc sequences, for example an Fc region comprising an Fc domain comprising the amino acid sequence of SEQ ID NO:5 (or a bolded portion thereof) and an Fc domain comprising the amino acid sequence of SEQ ID NO:7 (or a bolded portion thereof), or an Fc region comprising an Fc domain comprising the amino acid sequence of SEQ ID NO:6 (or a bolded portion thereof) and an Fc domain comprising the amino acid sequence of SEQ ID NO:8 (or a bolded portion thereof) (corresponding to SEQ ID NOs:30, 37, 31, and 38, respectively).

[0180] In a specific embodiment, the Fc domain comprises the amino acid sequence designated hIgG4s in Section 7.1.1. In another specific embodiment, the Fc domain comprises the amino acid sequence designated hIgG1 in Section 7.1.1, which is a mutant IgG1-based Fc sequence containing D265A, N297A mutations (EU numbering) to reduce effector function.

[0181] 5.4.2.1.Fc Heterodimerization Variants Certain IL27 agonists, unlike natural immunoglobulins, involve dimerization between two Fc domains operably linked to non-identical N-terminal regions, for example, one Fc domain is connected to a Fab and the other Fc domain is connected to an IL27 domain. Incorrect heterodimerization of two Fc domains to form an Fc region can be an obstacle to increasing the yield of the desired heterodimerized molecule, presenting a purification challenge. Various approaches available in the art can be used to enhance dimerization of Fc domains that may be present in the IL27 agonists of the present disclosure, and are disclosed, for example, in EP 1870459(A1); U.S. Pat. Nos. 5,582,996; 5,731,168; 5,910,573; 5,932,448; 6,833,441; 7,183,076; U.S. Patent Application Publication No. 2006204493(A1); and WO 2009 / 089004(A1).

[0182] The present disclosure provides IL27 agonists comprising Fc heterodimers, i.e., Fc regions comprising heterologous non-identical Fc domains. Typically, each Fc domain in the Fc heterodimer comprises a CH3 domain of an antibody. The CH3 domain is derived from the constant region of an antibody of any isotype, class or subclass, preferably of the IgG (IgG1, IgG2, IgG3 and IgG4) class, as described in the previous section.

[0183] Heterodimerization of two different heavy chains at the CH3 domains results in the desired IL27 agonist, whereas homodimerization of the same heavy chain results in a lower yield of the desired IL27 agonist. Thus, in a preferred embodiment, the polypeptides that assemble to form the IL27 agonist of the present disclosure contain a CH3 domain with a modification that favors heterodimeric association compared to an unmodified Fc domain.

[0184] In a specific embodiment, the modification that promotes the formation of Fc heterodimers is a so-called "knob-into-hole" or "knob-in-hole" modification, which includes a "knob" modification in one of the Fc domains and a "hole" modification in the other Fc domain. Knob-into-hole technology is described, for example, in U.S. Pat. Nos. 5,731,168; 7,695,936; Ridgway et al., 1996, Prot Eng 9:617-621, and Carter, 2001, Immunol Meth 248:7-15. In general, the method involves introducing a protrusion ("knob") at the interface of a first polypeptide and a corresponding cavity ("hole") at the interface of a second polypeptide, such that the protrusion can be positioned within the cavity to promote heterodimer formation and prevent homodimer formation. The protrusions are constructed by replacing small amino acid side chains from the interface of a first polypeptide with larger side chains (e.g., tyrosine or tryptophan). Compensatory cavities of identical or similar size to the protrusions are created in the interface of a second polypeptide by replacing the large amino acid side chains with smaller amino acid side chains (e.g., alanine or threonine).

[0185] Thus, in some embodiments, amino acid residues in the CH3 domain of a first subunit of an Fc domain are replaced with amino acid residues having a larger side chain volume, thereby generating a protuberance in the CH3 domain of the first subunit that can be positioned in a cavity in the CH3 domain of the second subunit, and amino acid residues in the CH3 domain of a second subunit of an Fc domain are replaced with amino acid residues having a smaller side chain volume, thereby generating a cavity in the CH3 domain of the second subunit that can be positioned in the protuberance in the CH3 domain of the first subunit. Preferably, the amino acid residues having a larger side chain volume are selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W). Preferably, the amino acid residues having a smaller side chain volume are selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V). The protuberances and cavities can be created by modifying a nucleic acid encoding the polypeptide, for example by site-directed mutagenesis or by peptide synthesis. An exemplary substitution is Y470T.

[0186] In a specific such embodiment, in the first Fc domain, the threonine residue at position 366 is replaced by a tryptophan residue (T366W), and in the Fc domain, the tyrosine residue at position 407 is replaced by a valine residue (Y407V), and optionally, the threonine residue at position 366 is replaced by a serine residue (T366S) and the leucine residue at position 368 is replaced by an alanine residue (L368A) (numbering according to the Kabat EU index). In a further embodiment, the first Fc domain further comprises a replacement of the serine residue at position 354 with a cysteine ​​residue (S354C) or a replacement of the glutamic acid residue at position 356 with a cysteine ​​residue (E356C), particularly a replacement of the serine residue at position 354 with a cysteine ​​residue, and the second Fc domain further comprises a replacement of the tyrosine residue at position 349 with a cysteine ​​residue (Y349C) (numbering according to Kabat EU index). In a particular embodiment, the first Fc domain comprises the amino acid substitutions S354C and T366W and the second Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).

[0187] In some embodiments, electrostatic steering (e.g., as described in Gunasekaran et al., 2010, J Biol Chem 285(25):19637-46) can be used to promote association of the first and second Fc domains of the region.

[0188] As an alternative or in addition to the use of modified Fc domains to promote heterodimerization, Fc domains can be modified to allow for purification strategies that allow for the selection of Fc heterodimers. In one such embodiment, one of the polypeptides comprises a modified Fc domain that abolishes binding to Protein A, thus allowing for a purification method to obtain a heterodimeric protein. See, for example, US Pat. No. 8,586,713. Thus, the IL27 agonist comprises a first CH3 domain and a second Ig CH3 domain, the first and second Ig CH3 domains differing from each other in at least one amino acid, the at least one amino acid difference reducing binding of the IL27 agonist to Protein A compared to a corresponding IL27 agonist lacking the amino acid difference. In one embodiment, the first CH3 domain binds Protein A and the second CH3 domain contains a mutation / modification that reduces or eliminates Protein A binding, such as a H95R modification (according to IMGT exon numbering; H435R according to EU numbering). The second CH3 may further comprise a Y96F modification (according to IMGT; Y436F by EU). This class of modifications is referred to herein as a "star" mutation.

[0189] 5.5. Stabilization part The IL27 agonist of the present disclosure may include a stabilizing moiety that can further extend the half-life of the IL27 agonist in vivo. Serum half-life is often divided into an alpha phase and a beta phase. Either or both phases may be significantly improved by adding an appropriate stabilizing moiety. For example, the stabilizing moiety may increase the serum half-life of the IL27 agonist by more than 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%, 400%, 600%, 800%, 1000% or more compared to the corresponding IL27 agonist that does not contain a stabilizing moiety. For the purposes of this disclosure, serum half-life may refer to half-life in humans or other mammals (e.g., mice or non-human primates). It is further recognized that the inclusion of an Fc domain in an IL27 agonist extends the half-life of the IL27 domain. In the context of this disclosure, the term "stabilizing moiety" refers to a moiety other than an Fc domain / Fc region.

[0190] Wild-type IL27 has a serum half-life of less than 2 hours. The IL27 agonist of the present disclosure preferably has a serum half-life of at least about 3 hours, at least about 4 hours, at least about 6 hours, or at least about 8 hours in humans and / or mice. In some embodiments, the IL27 agonist of the present disclosure has a serum half-life of at least 10 hours, at least 12 hours, at least 15 hours, at least 18 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 60 hours, or at least 72 hours.

[0191] Stabilizing moieties include polyoxyalkylene moieties (eg, polyethylene glycol), sugars (eg, sialic acid), and well-tolerated protein moieties (eg, transferrin and serum albumin).

[0192] Other stabilizing moieties that can be used in the IL27 agonists of the present disclosure include those described in Kontermann et al., 2011, Current Opinion in Biotechnology 22:868-76. Such stabilizing moieties include, but are not limited to, human serum albumin fusions, human serum albumin conjugates, human serum albumin binders (e.g., Adnectin PKE, AlbudAb, albumin binding domain from protein G), XTEN fusions, PAS fusions (i.e., recombinant PEG mimics based on the three amino acids proline, alanine, and serine), carbohydrate conjugates (e.g., hydroxyethyl starch (HES)), glycosylations, polysialic acid conjugates, and fatty acid conjugates.

[0193] Thus, in some embodiments, the disclosure provides IL27 agonists that include a stabilizing moiety that is a polymeric sugar. Serum albumin may also be involved in the extension of half-life through modules that have the ability to non-covalently interact with albumin. Thus, the IL27 agonist of the present disclosure may include an albumin binding protein as a stabilizing moiety. The albumin binding protein may be conjugated or genetically fused to one or more other components of the IL27 agonist of the present disclosure. Proteins with albumin binding activity are known from certain bacteria. For example, streptococcal protein G contains several small albumin binding domains consisting of approximately 50 amino acid residues (6 kDa). Further examples of serum albumin binding proteins include those described in US Patent Application Publication Nos. 2007 / 0178082 and 2007 / 0269422. The fusion of albumin binding domains to proteins results in significantly extended half-life (see Kontermann et al., 2011, Current Opinion in Biotechnology 22:868-76).

[0194] In other embodiments, the stabilizing moiety is human serum albumin, as described below in Section 5.5.1. See, e.g., IL27M20 and IL27M21 (Figures 5A and 5B). In other embodiments, the stabilizing moiety is transferrin.

[0195] In yet other embodiments, the stabilizing moiety is a polyethylene glycol moiety or another polymer, as described below in Section 5.5.1. A stabilizing moiety may comprise a peptide tag at its N-terminus or C-terminus, for example a peptide tag that facilitates purification. In some embodiments, the peptide tag is a myc-myc-his (mmh) tag.

[0196] A stabilizing moiety may be connected to one or more other components of an IL27 agonist of the disclosure via a linker, for example, as described in Section 5.8 below. Human serum albumin In some embodiments, the IL27 agonist of the present disclosure comprises human serum albumin (HSA), a naturally occurring variant thereof, an engineered variant thereof, or a fragment of any one of them.

[0197] The EBI3 and / or p28 moieties can be fused to the N-terminus or C-terminus of HSA (e.g., as shown in Figures 5A and 5B). In certain embodiments, the EBI3 and / or p28 moieties are fused to the N-terminus of HSA.

[0198] One embodiment of the present disclosure relates to a dimer comprising two HSA polypeptides created by the association of an EBI3 portion and a p28 portion, wherein each of the EBI3 portion and the p28 portion are fused to a separate HSA polypeptide.

[0199] Another embodiment of the disclosure relates to a monomer that includes a single HSA polypeptide to which both an EBI3 portion and a p28 portion are fused (e.g., as shown in FIG. 5A). In some embodiments, the monomer is arranged from N-terminus to C-terminus in the following order: EBI3 portion-optional linker-p28 portion-optional linker-HSA. In other embodiments, the monomer is arranged from N-terminus to C-terminus in the following order: p28 portion-optional linker-EBI3 portion-optional linker-HSA.

[0200] The HSA polypeptide, or each HSA polypeptide when the IL27 agonist comprises more than one HSA polypeptide, comprises a wild-type or mutant HSA polypeptide, or a fragment thereof. The mutants may be naturally occurring or engineered mutants.

[0201] In some embodiments, the HSA polypeptide is or comprises an amino acid sequence that comprises at least 70% sequence identity to HSA, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity.

[0202] In some embodiments, the HSA polypeptide is full-length HSA. In other embodiments, the HSA polypeptide is mature HSA. The sequence of HSA has Uniprot identifier P02768 (uniprot.org / uniprot / P02768). HSA is synthesized as a precursor polypeptide of 609 amino acids, including a signal peptide (amino acids 1-18) and a propeptide (amino acids 19-24). Mature HSA includes amino acids 25-609. In some embodiments, the HSA of the present disclosure includes full-length HSA. In other embodiments, the HSA of the present disclosure includes mature HSA. The amino acid sequence of HSA is shown below.

[0203] [ka]

[0204] Amino acid 25 of full length HSA is amino acid 1 of mature HSA. A number of naturally occurring variants of HSA have been reported, summarized at uniprot.org / uniprot / P02768, any of which may be used in the stabilization moieties of the present disclosure.

[0205] Polyethylene glycol In some embodiments, the IL27 agonist comprises polyethylene glycol (PEG) or another hydrophilic polymer as a stabilizing moiety, such as ethylene glycol / propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene / maleic anhydride copolymers, polyamino acids (either homopolymers or random copolymers), dextran or poly(n-vinylpyrrolidone) polyethylene glycol, propylene glycol homopolymer, prolypropylene oxide / ethylene oxide copolymer, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. The polymer can be of any molecular weight and can be branched or unbranched.

[0206] Polyethylene glycol is a well-known water-soluble polymer that is either commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161). The term "PEG" is used broadly to encompass any polyethylene glycol molecule, regardless of size or modification at the termini of the PEG, and has the formula: XO(CH2CHO). n-1CH2CH2OH, where n is 20 to 2300, and X is H or a terminal modification, such as C 1-4 The PEG is preferably an alkyl group. PEG can contain additional chemical groups necessary for the conjugation reaction, which may result from the chemical synthesis of the molecule, or act as spacers for optimal distance of the parts of the molecule. Furthermore, such PEG can consist of one or more PEG side chains linked together. PEGs with two or more PEG chains are called multi-arm or branched PEGs. Branched PEGs are described, for example, in EP 473084(A) and U.S. Pat. No. 5,932,462.

[0207] One or more PEG molecules can be attached to different positions on the IL27 agonist, and such attachment can be achieved by reaction with an amine, thiol, or other suitable reactive group. The amine moiety can be, for example, a primary amine found at the N-terminus of the IL27 agonist (or a component thereof), or an amine group present in an amino acid such as lysine or arginine.

[0208] PEGylation may be accomplished by site-directed PEGylation, where a suitable reactive group is introduced into the protein to generate a site at which PEGylation will preferentially occur. In some embodiments, the IL27 agonist is modified to introduce a cysteine ​​residue at a desired position, allowing site-directed PEGylation on the cysteine. To generate a cysteine ​​residue, a mutation may be introduced into the coding sequence of the IL27 agonist of the present disclosure. This may be accomplished, for example, by mutating one or more amino acid residues to cysteine. Preferred amino acids for mutating to cysteine ​​residues include serine, threonine, alanine, and other hydrophilic residues. Preferably, the residue mutated to cysteine ​​is a surface-exposed residue. Algorithms for predicting surface accessibility of residues based on primary sequence or three-dimensional structure are well known in the art. The three-dimensional structure of IL27 is described, for example, in Wang et al., 2005, Science 310(5751):1159-63, and can be used to identify surface-exposed residues that can be mutated to cysteine. Mutations can be selected to avoid disrupting the interaction between IL27 and one or more of its receptors. PEGylation of cysteine ​​residues can be performed, for example, using PEG-maleimide, PEG-vinylsulfone, PEG-iodoacetamide, or PEG-orthopyridyl disulfide.

[0209] PEG is typically activated with a suitable activating group suitable for coupling to a desired site on a polypeptide. PEGylation methods are well known in the art and are further described in Zalipsky et al., "Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides" in Polyethylene Glycol Chemistry: Biotechnical and Biomedical Applications, J.M. Harris, Plenus Press, New York (1992), and Zalipsky, 1995, Advanced Drug Reviews 16:157-182.

[0210] The PEG moiety may vary widely in molecular weight and may be branched or linear. Typically, the weight average molecular weight of PEG is about 100 Daltons to about 150,000 Daltons. Exemplary weight average molecular weights of PEG include about 20,000 Daltons, about 40,000 Daltons, about 60,000 Daltons, and about 80,000 Daltons. In certain embodiments, the molecular weight of PEG is 40,000 Daltons. Branched versions of PEG having any of the foregoing total molecular weights can also be used. In some embodiments, the PEG has two branches. In other embodiments, the PEG has four branches. In another embodiment, the PEG is a bis-PEG (NOF Corporation, DE-200MA) to which two IL27-containing polypeptide chains are conjugated.

[0211] Conventional separation and purification techniques known in the art, such as size exclusion chromatography (e.g., gel filtration) and ion exchange chromatography, can be used to purify the PEGylated IL27 agonist. The products can also be separated using SDS-PAGE. Products that can be separated include mono-, di-, tri-, poly-, and non-PEGylated IL27 agonist, as well as free PEG. The percentage of mono-PEG conjugate can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition. Approximately 90% mono-PEG conjugate represents a good balance between yield and activity.

[0212] In some embodiments, PEGylated IL27 agonists preferably retain at least about 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, or 100% of the biological activity associated with an unmodified IL27 agonist. In some embodiments, biological activity refers to the ability to bind to IL27Ra (IL27Rα), gp130, or an IL27 dimer comprising IL27Ra (IL27Rα) and gp130. Binding to the IL27 receptor or its constituent subunits is associated with K D , k on , or k off It can be evaluated by:

[0213] 5.6. IL27Ra (IL27Rα) and gp130 portion The present disclosure provides IL27 receptor agonists having an IL27Ra (IL27Rα) and / or gp130 moiety capable of binding to a p28 moiety of the present disclosure. Exemplary IL27Ra (IL27Rα) moieties are disclosed in Section 5.6.1, and exemplary gp130 moieties are disclosed in Section 5.6.2.

[0214] The IL27 receptor is a heterodimer consisting of the interleukin-27 receptor subunit alpha (IL27Ra or IL27Rα) and the gp130 subunit. Thus, as used herein, the term "IL27 receptor moiety" refers to the IL27Ra (IL27Rα) moiety and / or the gp130 moiety.

[0215] IL27 receptor moieties encompass mature human and non-human (e.g., mouse, rat, pig, non-human primate) IL27Rα (IL27Rα) and gp130 polypeptides, including homologs, variants, and fragments thereof, as well as IL27Rα (IL27Rα) and gp130 polypeptides having, for example, leader sequences (e.g., signal peptides), and modified versions of the foregoing. In certain embodiments, IL27 receptor moieties of the present disclosure have one or more amino acid modifications, e.g., substitutions, deletions, or insertions, in the p28-binding domain of the IL27Ra (IL27Rα) portion and / or the gp130 portion, compared to wild-type or naturally occurring IL27 variants. Thus, the terms "IL27Rα portion" (also referred to as "IL27Rα moiety") and "gp130 portion" encompass proteins of substantially similar sequence to mature wild-type human, mouse, porcine, or rat IL27Rα and gp130, respectively, more preferably proteins of substantially similar sequence to mature wild-type human IL27Rα and gp130, respectively. In various embodiments, the IL27Rα domain and / or gp130 domain comprises amino acids having at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to human, mouse, porcine, or rat IL27Rα and / or gp130 domain sequences, such as those exemplified in Sections 5.6.1 and 5.6.2, respectively.

[0216] 5.6.1.IL27Ra (IL27Rα) part IL27Ra or IL27Rα (previously called T cell cytokine receptor (TCCR) or WSX-1) was first identified in lymphocytes, including naive T cells, and shown to bind IL27 in vitro. IL27Rα is a single-pass type I cytokine receptor membrane protein whose structure consists of (i) an extracellular domain containing three modified fibronectin type III (FnIII) ​​domains called the cytokine binding domain (CBD) (see FIG. 1B), (ii) a single helical transmembrane domain, and (iii) a cytoplasmic domain containing a Box1 motif required for JAK interaction and / or activation. The CBD typically contains two pairs of cysteine ​​residues involved in disulfide bridge formation and a characteristic WSXWS signature motif. IL27Ra is also known to exist in a soluble form, at least in humans, and is spontaneously released from cells as a 70 / 90 kDa N-glycosylated protein via proteolytic cleavage by metalloproteases. The soluble form is capable of binding to IL27 in vitro and forms a complex with IL27 in vivo, inhibiting IL27 signaling.

[0217] The IL27 receptor agonist of the present disclosure optionally comprises one or more IL27Ra (IL27Rα) moieties, each of which is capable of binding to an IL27 p28 moiety of the present disclosure. An IL27Ra (IL27Rα) portion is or comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to an IL27 p28-binding portion of a mammalian, e.g., human or mouse, IL27 receptor subunit alpha (IL27Ra or IL27Rα). The IL27 p28-binding portion of IL27Ra (IL27Rα) comprises or consists of the extracellular domain of the receptor subunit, or a p28-binding fragment thereof. The sequence of human IL27Ra (IL27Rα) has the Uniprot identifier Q6UWB1 (uniprot.org / uniprot / Q6UWB1), with amino acids 33 to 516 constituting the extracellular domain. The sequence of mouse IL27Ra (IL27Rα) has the Uniprot identifier O70394 (uniprot.org / uniprot / O70394), with amino acids 25 to 510 constituting the extracellular domain.

[0218] The human IL27Ra (IL27Rα) subunit is synthesized as a precursor polypeptide of 636 amino acids from which 32 amino acids are removed to generate mature IL27Ra (IL27Rα). The extracellular domain of IL27Rα (IL27Rα) spans amino acids 33-516 and contains a first fibronectin III domain spanning amino acids 131-231 of IL27Rα (IL27Rα), a second fibronectin III domain spanning amino acids 322-417 of IL27Rα (IL27Rα), and a third fibronectin III domain spanning amino acids 419-511 of IL27Rα (IL27Rα). Thus, in some embodiments, an IL27Rα (IL27Rα) domain of the disclosure comprises the extracellular domain of human IL27Rα (IL27Rα) corresponding to positions 33-516 of the 636 amino acid precursor sequence shown below, or three fibronectin domains corresponding to positions 131-511 of the 636 amino acid precursor sequence shown below.

[0219] [ka]

[0220] In some embodiments, the IL27Ra (IL27Rα) portion comprises the extracellular domain of mammalian, e.g., human or mouse IL27Ra (IL27Rα) (or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the extracellular domain).

[0221] In certain embodiments, the IL27Ra (IL27Rα) portion comprises an amino acid sequence having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to amino acids 33-516 of full-length human IL27Ra (IL27Rα) (i.e., Uniprot identifier Q6UWB1). or consisting of, optionally the binding moiety has an amino acid sequence of (a) at least 160 amino acids, at least 161 amino acids, at least 162 amino acids, at least 164 amino acids or at least 165 amino acids, and / or (b) up to 251, up to 240, up to 230, up to 220, up to 210, up to 200, up to 190, up to 180 or up to 170 amino acids from amino acids 33-516 of full-length human IL27Ra (IL27Rα). In certain embodiments, the portion of human IL27Ra (IL27Rα) is bound by any one of (a) and (b) of the preceding sentence, e.g., at least 160 and up to 180 amino acids from human IL27Rβ1 (IL27Rα), at least 162 and up to 200 amino acids from human IL27Ra (IL27Rα), at least 160 and up to 220 amino acids from human IL27Ra (IL27Rα), at least 164 and up to 190 amino acids from human IL27Ra (IL27Rα), etc.

[0222] In some embodiments, the IL27Ra (IL27Rα) portion comprises or consists of an amino acid sequence having at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to amino acids 33-516 of full-length human IL27Ra (IL27Rα), with or without up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 30 amino acids, or up to 40 additional amino acids C-terminal to amino acid residue 516 of IL27Ra (IL27Rα).

[0223] The IL27Ra (IL27Rα) moiety-containing IL27 receptor agonist of the present disclosure can have the IL27Ra (IL27Rα) extracellular domain at the N-terminus or C-terminus of the IL27 p28 moiety when located on the same monomer. In some embodiments, the IL27Ra (IL27Rα) moiety-containing IL27 receptor agonist of the present disclosure preferably has the IL27Ra (IL27Rα) extracellular domain at the N-terminus of the IL27 p28 moiety.

[0224] Human IL27Ra (IL27Rα) contains potential N-linked glycosylation sites at amino acids 51, 76, 302, 311, 373, 382, ​​and 467. The present disclosure encompasses IL27Rα (IL27Rα) domain molecules with or without N-linked glycans at N51 and / or N76 and / or N302 and / or N311 and / or N373 and / or N382 and / or N467, or the equivalent positions in IL27Rα (IL27Rα) of other species.

[0225] 5.6.2.gp130 part gp130 was identified as a type I cytokine receptor required to mediate intracellular signaling by IL27Ra (IL27Rα) in response to IL27. Class I cytokine receptors are characterized by the presence of at least one cytokine-binding domain (CBM) consisting of two fibronectin type III-like (FNIII) domains. The N-terminal domain contains a set of four conserved cysteine ​​residues, and the C-terminal domain contains a WSXWS motif or a closely related sequence. Receptors belonging to this family are involved in helical cytokines consisting of four tightly packed α-helices. gp130 is a promiscuous cytokine receptor and is involved in the transduction of at least eight cytokines, including IL27. gp130 is the founding member of the IL-6 / IL-12 family of "tall" receptors.

[0226] The extracellular portion of gp130 contains an Ig-like domain (D1), followed by a single CBD (D2 and D3) and three FNIII domains (D4, D5, and D6). Two conserved domains, the CBD, the Ig domain, and the three FNIII domains, are required for activation.

[0227] The IL27 receptor agonist of the present disclosure optionally comprises one or more gp130 moieties. Each of the one or more gp130 moieties can bind to an IL27 p28 moiety of the present disclosure. The gp130 moiety is or comprises an amino acid sequence that comprises at least 70% sequence identity, e.g., at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity, to an IL27 p28 binding portion of a mammalian, e.g., human or mouse, membrane glycoprotein 130 (gp130). The IL27 p28-binding portion of gp130 comprises or consists of the extracellular domain of the receptor subunit, or a p28-binding fragment thereof. The human gp130 sequence has Uniprot identifier P40189 (uniprot.org / uniprot / P40189), with amino acids 23-619 constituting the extracellular domain. The mouse gp130 sequence has Uniprot identifier Q00560 (uniprot.org / uniprot / Q00560), with amino acids 23-617 constituting the extracellular domain.

[0228] Human gp130 is synthesized as a 918 amino acid precursor polypeptide from which 22 amino acids are removed to generate mature gp130. The extracellular domain of gp130 spans amino acids 23-619 of gp130 and includes an IgG-like domain spanning amino acids 26-120, a first fibronectin III domain spanning amino acids 125-216 of gp130, a second fibronectin III domain spanning amino acids 224-324 of gp130, a third fibronectin III domain spanning amino acids 329-424 of gp130, a fourth fibronectin domain spanning amino acids 426-517 of gp130, and a fifth fibronectin domain spanning amino acids 518-613 of gp130. Thus, in some embodiments, a gp130 domain of the disclosure comprises the extracellular domain of human gp130 corresponding to positions 23-619 of the 918 amino acid precursor sequence shown below, or an IgG-like and five fibronectin domains corresponding to positions 26-613 of the 918 amino acid precursor sequence shown below.

[0229] [ka]

[0230] In some embodiments, the gp130 portion comprises an extracellular domain of mammalian, e.g., human or murine, gp130 (or an amino acid sequence comprising at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the extracellular domain).

[0231] In certain embodiments, the gp130 portion can comprise an amino acid sequence having at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to amino acids 23 to 619 of full-length human gp130 (i.e., Uniprot identifier P40189), or or may consist of, optionally the binding moiety has an amino acid sequence of (a) at least 160 amino acids, at least 161 amino acids, at least 162 amino acids, at least 164 amino acids, or at least 165 amino acids, and / or (b) up to 251, up to 240, up to 230, up to 220, up to 210, up to 200, up to 190, up to 180, or up to 170 amino acids from amino acids 33-516 of full-length human gp130. In certain embodiments, the portion of human gp130 is bound by any one of (a) and (b) in the preceding sentence, e.g., at least 160 and up to 180 amino acids from human gp130, at least 162 and up to 200 amino acids from human gp130, at least 160 and up to 220 amino acids from human gp130, at least 164 and up to 190 amino acids from human gp130, etc.

[0232] In some embodiments, the gp130 portion comprises or consists of an amino acid sequence having at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to amino acids 23-619 of full-length human gp130, with or without up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 30 amino acids, or up to 40 additional amino acids C-terminal to amino acid residue 619 of gp130.

[0233] The gp130 moiety-containing IL27 receptor agonist of the present disclosure can have the gp130 extracellular domain at the N-terminus or C-terminus of the IL27 p28 moiety when located on the same monomer. In some embodiments, the gp130 moiety-containing IL27 receptor agonist of the present disclosure preferably has the IL27Ra (IL27Rα) extracellular domain at the N-terminus of the IL27 p28 moiety.

[0234] Multiple naturally occurring sequence variants of gp130 have been reported in the extracellular domain of the protein (see www.uniprot.org / uniprot / EBI3189). Thus, the gp130 domain of the present disclosure may contain amino acid substitutions present in one or more naturally occurring variants. Exemplary sequence variants include SNP variant rs2228044 with a G→R substitution at position 148, SNP variant rs199905033 with an A→G substitution at position 200, and SNP variant rs34417936 with a V→I substitution at position 499.

[0235] Human gp130 contains multiple N-linked glycosylation sites. The present disclosure encompasses gp130 domains with or without N-linked glycans. 5.7. Targeting part Incorporation of one or more targeting moieties in the IL27 agonists of the present disclosure allows for the delivery of high concentrations of IL27 to desired microenvironments or disease-reactive lymphocytes, e.g., CD4+CD8+ T lymphocytes, where they can exert a localized effect.

[0236] Suitable targeting moiety formats are described in Sections 5.7.2 and 5.7.3. The targeting moiety is preferably an antigen-binding portion, e.g., an antibody or an antigen-binding fragment of an antibody, e.g., an scFv as described in Section 5.7.2.1 or a Fab as described in Section 5.7.2.2.

[0237] In other embodiments, the targeting moiety is a peptide-MHC complex as described in Section 5.7.3, eg, a peptide-MHC complex recognized by tumor lymphocytes.

[0238] Some IL27 agonist formats include two or more targeting moieties. When an IL27 agonist of the present disclosure includes two or more different targeting moieties (e.g., an IL27 agonist having a format illustrated in FIG. 3D or FIG. 3E), the different targeting moieties can suitably bind to the same cell (whether to different polypeptides or to different epitopes of the same polypeptide) or tissue type. Alternatively, the different targeting moieties can bind to different cells or tissues and, in doing so, bring them into close proximity to each other.

[0239] Some exemplary targeting moiety targets and formats are described below. 5.7.1.Target molecules Antibodies and antigen-binding fragments generally can bind to a particular antigenic determinant and direct the IL27 agonist to a target site, for example, a particular type of diseased cell that bears the antigenic determinant.

[0240] The target molecules recognized by the targeting moieties of the IL27 agonists of the present disclosure are generally found, for example, on the cell surface of immune cells or on the cell surface on tissues. Non-limiting examples of target molecules found on the cell surface of immune cells include CD2, CD3, CD4, CD7, CD8, XCR1, Clec9a, and CD20.

[0241] Non-limiting examples of target molecules found on the cell surface of tissues include MADCAM, a4b7 integrin, TSHR, and EpCAM. In some embodiments, the targeting moiety binds to a cytokine, such as IL27 or a subunit thereof, hi some embodiments, the targeting moiety is the IL27 binding domain of the IL27 receptor.

[0242] In some embodiments, the targeting moiety is a peptide-MHC complex, for example a peptide-MHC complex that targets autoreactive T cells. Other target molecules recognized by the targeting moiety of the IL27 receptor agonist of the present disclosure can be found, for example, on the surface of activated T cells, tumor cells, virus-infected cells, other diseased cells, and can be released in serum, extracellular matrix (ECM), or immune cells present at the target site, such as tumor-reactive lymphocytes. When immune cells are administered exogenously (e.g., chimeric antigen receptor ("CAR")-expressing T cells), the targeting moiety can recognize the chimeric antigen receptor (CAR) or another molecule found on the surface of the CAR T cell. In various embodiments, the CAR comprises CDRs or VH and VL sequences (e.g., in scFv format) that specifically recognize a TAA or pMHC complex.

[0243] Exemplary target molecules include fibroblast activation protein (FAP), the A1 domain of tenascin-C (TNC A1), the A2 domain of tenascin-C (TNC A2), fibronectin extra domain B (EDB), melanoma-associated chondroitin sulfate proteoglycan (MCSP), MART-1 / Melan-A, gp100, dipeptidyl peptidase IV (DPPIV), adenosine deaminase binding protein (ADAbp), cyclophilin b, colon-related antigen (CRC)-C017-1A / GA733, carcinoembryonic antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, aml1, prostate-specific antigen (PSA) and its immunogenic epitopes PSA-1, PSA-2, and PSA-3, prostate-specific membrane antigen (PSMA), T cell receptor / CD3-zeta chain, MAGE-tumor antigen family (e.g., MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-B10, MAGE-B20, MAGE-B30, MAGE-B40, MAGE-B50, MAGE-B60, MAGE-B70, MAGE-B80, MAGE-B90, MAGE-B110, MAGE-B120, MAGE-B130, MAGE-B140, MAGE-B150, MAGE-B160, MAGE-B170, MAGE-B180, MAGE-B210, MAGE-B220, MAGE-B230, MAGE-B240, MAGE-B250, MAGE-B310, MAGE-B320, MAGE-B430, MAGE-B440, MAGE-B550, MAGE-B650, MAGE-B760, MAGE-B850, MAGE-B90, MAGE-B15 A7, MAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12, MAGE-Xp2 (MAGE-B2), MAGE-Xp3 (MAGE-B3), MAGE-Xp4 (MAGE-B4), MAGE-C1, MAGE-C2, MAGE-C3, MAGE-C4, MAGE-C5), GAGE-tumor antigen family (e.g., GAGE-1, GAGE-2, GAGE-A ... GAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12, MAGE-Xp2 (MAGE-B2), MAGE-Xp3 (MAGE-B3), MAGE-Xp4 (MAGE-B4), MAGE-C1, MAGE-C2, MAGE-C3, MAGE-C4, MAGE-C5), GAGE-tumor antigen family (e.g., 3, GAGE-4, GAGE-5, GAGE-6, GAGE-7, GAGE-8, and GAGE-9), BAGE, RAGE, LAGE-1, NAG, GnT-V, MUM-1, CDK4, tyrosinase, p53, MUC family, HER2 / neu, p21ras, RCAS1, α-fetoprotein, E-cadherin, α-catenin, β-catenin, and γ-catenin, p120ctn, and gp100Pmel117, PRAME, NY-ESO-1, cdc27, adenomatous polyposis coli protein (APC), fodrin, connexin 37, Ig-idiotypes, p15, gp75, GM2, and GD2 gangliosides, viral products such as human papillomavirus proteins, the Smad family of tumor antigens, Imp-1, P1A, EBV-encoded nuclear antigen (EBNA)-1, brain glycogen phosphorylase, SSX-1, SSX-2 (HOM-MEL-40), SSX-1, SSX-4, SSX-5, SCP-1, and CT-7, c-erbB-2, Her2, EGFR, IGF-1R, CD2 (T cell surface antigen), CD3 (T CR-associated heteromultimer), CD22 (B cell receptor), CD23 (low affinity IgE receptor), CD30 (cytokine receptor), CD33 (myeloid cell surface antigen), CD40 (tumor necrosis factor receptor), IL-6R- (IL6 receptor), CD20, MCSP, PDGFβR (β-platelet derived growth factor receptor), ErbB2 epithelial cell adhesion molecule (EpCAM), EGFR variant III (EGFRvIII), CD19, disialoganglioside GD2, ductal epithelial mucin, gp36, TAG-72, glioma-associated antigen, β-human chorionic gonadotropin, alpha fetoprotein (AFP), lectin-reactive AFP, thyroglobulin, MN-CA IX, human telomerase reverse transcriptase, RU1, RU2 (AS), intestinal carboxylesterase, mut hsp70-2, M-CSF, prostase, prostase specific antigen (PSA), PAP, LAGA-1a, p53, prostein, PSMA, survival and telomerase, prostate cancer tumor antigen-1 (PCTA-1), ELF2M, neutrophil elastase, ephrin B2, insulin growth factor (IGF1)-I, IGF-II, IGFI receptor, 5T4, ROR1, Nkp30, NKG2D, tumor stromal antigen, CA166-9, extra domain A (EDA) and extra domain B (EDB) of fibronectin, and the A1 domain of tenascin-C (TnC A1).

[0244] Non-limiting examples of viral antigens include EBV antigens (e.g., Epstein-Barr virus LMP-1), Hepatitis C virus antigens (e.g., Hepatitis C virus E2 glycoprotein), HIV antigens (e.g., HIV gp160, and HIV gp120), CMV antigens, HPV-specific antigens, or influenza virus antigens (e.g., influenza virus hemagglutinin).

[0245] Non-limiting examples of ECM antigens include syndecans, heparanase, integrins, osteopontin, link, cadherins, laminins, laminin-type EGFs, lectins, fibronectin, fibronectin extra domain B (ED-B), notch, tenascin, collagens, and matrixins.

[0246] Other target molecules are cell surface molecules of tumor or viral lymphocytes, for example, T cell costimulatory proteins such as CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, and B7-H3.

[0247] In certain embodiments, the target molecule is a checkpoint inhibitor, such as CTLA-4, PD1, PDL1, PDL2, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK1, CHK2. In certain embodiments, the target molecule is PD1. In other embodiments, the target molecule is LAG3.

[0248] In some embodiments, the targeting moiety targets an exemplary target molecule set forth in Table 3 below, which also lists exemplary antibodies or antibody sequences on which the targeting moiety may be based.

[0249] [Table 3-1]

[0250]

Table 3-2

[0251]

Table 3-3

[0252]

Table 3-4

[0253]

Table 3-5

[0254]

Table 3-6

[0255]

Table 3-7

[0256]

Table 3-8

[0257]

Table 3-9

[0258]

Table 3-10

[0259]

Table 3-11

[0260] [Table 3-12]

[0261] In some embodiments, the targeting moiety competes with the above antibodies contained in Table 3 for binding to the target molecule. In further embodiments, the targeting moiety comprises a CDR having the CDR sequence of the above antibodies contained in Table 3. In some embodiments, the targeting moiety comprises all six CDR sequences of the above antibodies, including the antibodies listed in Table 3. In other embodiments, the targeting moiety comprises at least the heavy chain CDR sequences (CDR-H1, CDR-H2, CDR-H3) of such an antibody and the light chain CDR sequence of a universal light chain. In further embodiments, the targeting moiety comprises a VH comprising the amino acid sequence of the VH of the antibody listed above, e.g., listed in Table 3. In some embodiments, the targeting moiety further comprises a VL comprising the amino acid sequence of the VL of the antibody listed above, e.g., listed in Table 3. In other embodiments, the targeting moiety further comprises a universal light chain VL sequence.

[0262] In some embodiments, the checkpoint inhibitor targeting moiety is a non-blocking or low blocking ligand-receptor binding. Examples of non-blocking or low blocking anti-PD1 antibodies include antibodies having the VH / VL amino acid sequences of SEQ ID NOs: 2 / 10 in WO 2015 / 112800(A1); SEQ ID NOs: 16 / 17 in U.S. Pat. No. 11,034,765(B2); SEQ ID NOs: 164 / 178, 165 / 179, 166 / 180, 167 / 181, 168 / 182, 169 / 183, 170 / 184, 171 / 185, 172 / 186, 173 / 187, 174 / 188, 175 / 189, 176 / 190 and 177 / 190 in U.S. Pat. No. 10,294,299(B2). Examples of non-blocking or low blocking anti-LAG 3 antibodies include antibodies having the VH / VL amino acid sequences of SEQ ID NOs: 23 / 24, 3 / 4 and 11 / 12 of U.S. Patent Application Publication No. 2022 / 0056126(A1).

[0263] 5.7.2. Antibodies and Antigen-Binding Domains In certain aspects, the targeting moiety can be any type of antibody or fragment thereof that retains specific binding to an antigenic determinant. In one embodiment, the antigen-binding moiety is a full-length antibody. In one embodiment, the antigen-binding moiety is an immunoglobulin molecule, specifically an IgG class immunoglobulin molecule, more specifically an IgG1 or IgG4 immunoglobulin molecule. Antibody fragments include VH (or V H ) fragment, VL (or V L Antibody antigen-binding fragments include, but are not limited to, scFv fragments, Fab fragments, F(ab')2 fragments, scFv fragments, Fv fragments, minibodies, diabodies, triabodies, and tetrabodies. In certain embodiments, the antigen-binding fragment of an antibody is an scFv or Fab, such as an scFv or Fab that binds to CD2, CD3, CD4, CD7, CD8, XCR1, Clec9a, CD20, MADCAM, a4b7 integrin, TSHR, and EpCAM.

[0264] 5.7.2.1.scFv Single-chain Fv or "scFv" antibody fragments comprise the VH and VL domains of an antibody in a single polypeptide chain, can be expressed as single-chain polypeptides, and retain the specificity of the intact antibody from which they are derived. Generally, the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for target binding. Examples of suitable linkers for linking the VH and VL chains of an scFv are the linkers identified in Section 5.8.

[0265] Unless specified, as used herein, an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminus and C-terminus of the polypeptide, and an scFv may comprise a VL-linker-VH or a VH-linker-VL.

[0266] The scFv may comprise VH and VL sequences from any suitable species, such as murine, human or humanized VH and VL sequences. To generate nucleic acids encoding scFvs, the DNA fragments encoding the VH and VL are operably linked to another fragment encoding a linker, such as any of the linkers described in Section 5.8 (typically a repeating sequence containing the amino acids glycine and serine, such as the amino acid sequence (Gly4 to Ser)3), such that the VH and VL sequences can be expressed as a contiguous single-chain protein in which the VL and VH regions are linked by a flexible linker (see, e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990, Nature 348:552-554).

[0267] 5.7.2.2.Fab Fab domains have traditionally been produced by proteolytic cleavage of immunoglobulin molecules using enzymes such as papain. In the IL27 agonists of the present disclosure, the Fab domain is typically recombinantly expressed as part of the IL27 agonist.

[0268] The Fab domain may comprise constant domain and variable region sequences from any appropriate species, and may thus be murine, chimeric, human or humanized. A Fab domain typically comprises a CH1 domain bound to a VH domain, which is paired with a CL domain bound to a VL domain. In wild-type immunoglobulins, the VH domain is paired with the VL domain to form the Fv region, and the CH1 domain is paired with the CL domain to further stabilize the binding module. Disulfide bonds between the two constant domains can further stabilize the Fab domain.

[0269] For the IL27 agonists of the present disclosure, particularly where IL27 comprises two different Fab domains and the light chain is not a common or universal light chain, it is advantageous to use a Fab heterodimerization strategy to allow correct association of Fab domains belonging to the same Fab and minimize aberrant pairing of Fab domains belonging to different Fabs. For example, the Fab heterodimerization strategy shown in Table 4 below can be used:

[0270] [Table 4]

[0271] Thus, in certain embodiments, correct association between the two polypeptides of a Fab is facilitated by swapping the VL and VH domains of the Fab with one another, or swapping the CH1 and CL domains with one another, as described, for example, in WO 2009 / 080251.

[0272] Correct Fab pairing can also be promoted by introducing one or more amino acid modifications in the CH1 domain and one or more amino acid modifications in the CL domain of the Fab, and / or one or more amino acid modifications in the VH domain and one or more amino acid modifications in the VL domain of the Fab. The modified amino acids are typically part of the VH:VL and CH1:CL interfaces, such that the Fab components preferentially pair with each other rather than with other components of the Fab.

[0273] In one embodiment, the one or more amino acid modifications are restricted to conserved framework residues of the variable (VH, VL) and constant (CH1, CL) domains as indicated by the Kabat numbering of the residues. Almagro, 2008, Frontiers In Bioscience 13:1619-1633 provides definitions of framework residues based on the Kabat, Chothia, and IMGT numbering schemes.

[0274] In one embodiment, the modifications introduced in the VH and CH1 and / or VL and CL domains are complementary to each other. Complementarity at the heavy and light chain interface can be achieved based on steric and hydrophobic contacts, electrostatic / charge interactions or a combination of different interactions. Complementarity between protein surfaces has been widely described in the literature in terms of lock and key fit, knob into hole, protrusion and cavity, donor and acceptor, etc., all of which suggest the nature of the structural and chemical correspondence between the two interacting surfaces.

[0275] In one embodiment, the one or more introduced modifications introduce new hydrogen bonds across the interface of the Fab component. In one embodiment, the one or more introduced modifications introduce new salt bridges across the interface of the Fab component. Exemplary substitutions are described in WO 2014 / 150973 and WO 2014 / 082179, the contents of which are incorporated herein by reference.

[0276] In some embodiments, the Fab domain comprises a 192E substitution in the CH1 domain and a 114A and 137K substitution in the CL domain, which introduces a salt bridge between the CH1 and CL domains (see, e.g., Golay et al., 2016, J Immunol 196:3199-211).

[0277] In some embodiments, the Fab domain comprises 143Q and 188V substitutions in the CH1 domain and 113T and 176V substitutions in the CL domain, which serve to exchange hydrophobic and polar regions of contact between the CH1 and CL domains (see, e.g., Golay et al., 2016, J Immunol 196:3199-211).

[0278] In some embodiments, the Fab domain can contain modifications in some or all of the VH, CH1, VL, and CL domains to introduce an orthogonal Fab interface that promotes correct assembly of the Fab domain (Lewis et al., 2014 Nature Biotechnology 32:191-198). In one embodiment, a 39K, 62E modification is introduced in the VH domain, an H172A, F174G modification is introduced in the CH1 domain, a 1R, 38D, (36F) modification is introduced in the VL domain, and an L135Y, S176W modification is introduced in the CL domain. In another embodiment, a 39Y modification is introduced in the VH domain and a 38R modification is introduced in the VL domain.

[0279] Fab domains can also be modified to replace the native CH1:CL disulfide bond with an engineered disulfide bond to increase the pairing efficiency of the Fab component. For example, engineered disulfide bonds can be introduced by introducing 126C into the CH1 domain and 121C into the CL domain (see, e.g., Mazor et al., 2015, MAbs 7:377-89).

[0280] Fab domains can also be modified by replacing the CH1 and CL domains with alternative domains that promote correct assembly. For example, Wu et al., 2015, MAbs 7:364-76, describe replacing the CH1 domain with the constant domain of a T cell receptor, replacing the CL domain with the b domain of a T cell receptor, and pairing these domain replacements with additional charge-charge interactions between the VL and VH domains by introducing a 38D modification in the VL domain and a 39K modification in the VH domain.

[0281] Instead of or in addition to using a Fab heterodimerization strategy to promote correct VH-VL pairing, a VL of a common light chain (also called a universal light chain) can be used for each Fab VL region of the IL27 agonist of the present disclosure. In various embodiments, the use of a common light chain as described herein reduces the number of irrelevant species of the IL27 agonist compared to using the original cognate VL. In various embodiments, the VL domain of the IL27 agonist is identified from a monospecific antibody that includes a common light chain. In various embodiments, the VH region of the IL27 agonist includes human heavy chain variable gene segments rearranged in vivo in mouse B cells that have been previously engineered to express a limited human light chain repertoire or a single human light chain that is cognate to a human heavy chain, and that, in response to exposure to an antigen of interest, generate an antibody repertoire that contains one of two possible human VLs or multiple human VHs that are cognate to one of the antibody repertoires that are specific for the antigen of interest. The common light chain is derived from a rearranged human Vκ1-39Jκ5 sequence or a rearranged human Vκ3-20Jκ1 sequence, including somatically mutated (e.g., affinity matured) versions. See, e.g., U.S. Patent No. 10,412,940.

[0282] 5.7.3. Peptide-MHC fusion The targeting moiety of the IL27 agonist of the present disclosure may be a peptide-MHC complex ("pMHC complex"), such as a peptide complexed with an MHC class I domain, or a peptide complexed with an MHC class II domain, optionally with a β2 microglobulin domain.

[0283] Naturally occurring MHC is encoded by a cluster of genes on human chromosome 6. MHC includes, but is not limited to, HLA specificities such as A (e.g., A1-A74), B (e.g., B1-B77), C (e.g., C1-C11), D (e.g., D1-D26), DR (e.g., DR1-DR8), DQ (e.g., DQ1-DQ9), and DP (e.g., DP1-DP6). HLA specificities include A1, A2, A3, A11, A23, A24, A28, A30, A33, B7, B8, B35, B44, B53, B60, B62, DR1, DR2, DR3, DR4, DR7, DR8, and DR11.

[0284] Naturally occurring MHC class I molecules bind peptides derived from proteolytically degraded proteins, and the resulting small peptides are transported to the endoplasmic reticulum, where they associate with nascent MHC class I molecules, are routed through the Golgi apparatus, and are presented on the cell surface for recognition by cytotoxic T lymphocytes.

[0285] Naturally occurring MHC class I molecules consist of an α (heavy) chain associated with β2 microglobulin. The heavy chain consists of subunits α1-α3. The β2 microglobulin protein and the α3 subunit of the heavy chain are associated. In certain embodiments, the β2 microglobulin and the α3 subunit are covalently associated. In certain embodiments, the β2 microglobulin and the α3 subunit are non-covalently associated. The α1 and α2 subunits of the heavy chain fold together to form a groove through which peptides, e.g., antigenic determinants, are presented and recognized by the TCR.

[0286] Class I molecules generally associate with, e.g., bind to, peptides that are about 8-9 amino acids in length (e.g., 7-11 amino acids). Every human has 3-6 different class I molecules, each of which can bind many different types of peptides. In a specific embodiment, the class I MHC polypeptide is a human class I MHC polypeptide selected from the group consisting of HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, and HLA-G.

[0287] In some embodiments, the targeting moiety comprises an MHC class I alpha heavy chain extracellular domain (human alpha 1, alpha 2, and / or alpha 3 domains) without the transmembrane domain. In some embodiments, the class I alpha heavy chain polypeptide is HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, HLA-K, or HLA-L. In some embodiments, the HLA-A sequence is HLA-A * 0201 sequence.

[0288] A peptide in a pMHC complex can have an amino acid sequence of a peptide that can associate with, e.g., be presented by, an MHC class I molecule. In certain embodiments, the sequence can comprise 6-20 contiguous amino acids. In certain embodiments, the peptide sequence can be the sequence of a protein fragment, e.g., a protein derived from a portion of, e.g., a cell surface protein, e.g., a protein associated with an immune cell or tissue, and the peptide can bind to an MHC class I heavy chain.

[0289] In some embodiments, the pMHC complex targeting moiety comprises (i) an antigenic peptide, (ii) a class I MHC polypeptide or a fragment, variant, or derivative thereof (e.g., the extracellular domain), and, optionally, (iii) a β2 microglobulin polypeptide or a fragment, variant, or derivative thereof. For example, the pMHC complex can comprise, from N-terminus to C-terminus, (i) an antigenic peptide, (ii) a β2M sequence, and (iii) a class I α (heavy) chain sequence. Alternatively, the pMHC complex can comprise, from N-terminus to C-terminus, (i) an antigenic peptide, (ii) a class I α (heavy) chain sequence, and (iii) a β2M sequence.

[0290] In a specific embodiment, the antigenic peptide and the MHC sequence and / or the MHC sequence and the β2M domain are linked together via a peptide linker, e.g., as described in Section 5.8. In some embodiments, the single-chain pMHC complex can include a first flexible linker between the peptide segment and the β2 microglobulin segment. For example, the linker can extend from the carboxy terminus of the peptide and connect to the amino terminus of the amino terminal segment of the β2 microglobulin segment. In some embodiments, the linker is structured to allow the peptide to fold into the binding groove to provide a functional pMHC complex. In some embodiments, the linker can include at least 3 amino acids and up to about 15 amino acids (e.g., 20 amino acids). The pMHC linker can include a second flexible linker inserted between the β2 microglobulin and the MHC I heavy chain segment. For example, the linker can extend from the carboxy terminus of the β2 microglobulin segment and connect to the amino terminus of the MHC I heavy chain segment. In certain embodiments, β2 microglobulin and an MHC I heavy chain can fold into the binding groove to result in a molecule that can function in promoting T cell proliferation.

[0291] When β2M is present, the pMHC complex may contain mutations in the β2M and MHC class I α heavy chain domains such that a disulfide bond may form between them. Exemplary amino acid pairs that may be substituted with cysteines to allow disulfide bonds between the two domains are identified in Table 5 below or described in WO2015195531, which is incorporated by reference in its entirety.

[0292] [Table 5]

[0293] In further embodiments, the single chain pMHC complex may comprise a peptide covalently linked to the MHC class I α (heavy) chain via a disulfide bridge (i.e., a disulfide bond between two cysteines). See, for example, U.S. Patent Nos. 8,992,937 and 8,895,020, each of which is incorporated by reference in its entirety. In certain embodiments, the disulfide bond comprises a first cysteine ​​located in a linker extending from the carboxy terminus of the peptide and a second cysteine ​​located in the MHC class I heavy chain (e.g., the MHC class I α (heavy) chain having the non-covalent binding site for the antigenic peptide). In certain embodiments, the second cysteine ​​may be a mutation (addition or substitution) in the MHC class I α (heavy) chain. Preferably, the pMHC complex may comprise a disulfide bridge in addition to one continuous polypeptide chain. Alternatively, the pMHC complex may comprise two continuous polypeptide chains linked via a disulfide bridge as the only covalent bond. In some embodiments, the linking sequence can include at least one amino acid, including one or more glycines, one or more alanines, and / or one or more serines, in addition to cysteine. In some embodiments, the single chain molecule includes, from N-terminus to C-terminus, an MHC class I peptide (e.g., an antigenic peptide), a first linker including a first cysteine, a β2-microglobulin sequence, a second linker, and an MHC class I heavy chain sequence including a second cysteine, wherein the first cysteine ​​and the second cysteine ​​comprise a disulfide bridge. In some embodiments, the second cysteine ​​is a substitution of an amino acid in the MHC class I heavy chain selected from the group consisting of T80C, Y84C, and N86C (Y84C refers to a mutation at position 108 in the mature protein, which lacks a signal sequence; alternatively, if the protein still includes a 24-mer signal sequence, the position is referred to instead as Y108C).

[0294] In certain embodiments, if the pMHC complex contains a first cysteine ​​in the Gly-Ser linker extending between the C-terminus of the peptide and β2 microglobulin and a second cysteine ​​at the proximal heavy chain position, a disulfide bridge can link the peptide into the class I groove of the pMHC complex.

[0295] When present, the β2 microglobulin sequence can include a full-length (human or non-human) β2 microglobulin sequence. In certain embodiments, the β2 microglobulin sequence lacks a leader peptide sequence. Thus, the β2 microglobulin sequence can include about 99 amino acids. An exemplary human β2 microglobulin sequence is Genbank Accession No. AF072097.1.

[0296] As an alternative to type I MHC-based pMHC complexes, the IL27 agonist of the present disclosure may comprise a class II MHC-based pMHC complex as a targeting moiety. A class II MHC-based pMHC complex generally comprises a class I MHC polypeptide or a fragment, variant, or derivative thereof. In a specific embodiment, the MHC comprises α and β polypeptides of a class II MHC molecule or a fragment, variant, or derivative thereof. In a specific embodiment, the α and β polypeptides are linked by a peptide linker. In a specific embodiment, the MHC comprises α and β polypeptides of a human class II MHC molecule selected from the group consisting of HLA-DP, HLA-DR, HLA-DQ, HLA-DM, and HLA-DO.

[0297] MHC class II molecules generally consist of two polypeptide chains, α and β. The chains can be derived from the DP, DQ, or DR gene clusters. Approximately 40 different human MHC class II molecules are known. All have the same basic structure, but differ slightly in their molecular structure. MHC class II molecules bind peptides that are 13-18 amino acids in length.

[0298] In some embodiments, the pMHC complex comprises one or more MHC class II α chains or extracellular portions thereof, hi some embodiments, the class II α chain is HLA-DMA, HLA-DOA, HLA-DPA, HLA-DQA, or HLA-DRA.

[0299] In other embodiments, the pMHC complex comprises one or more MHC class II β chains or extracellular portions thereof, hi some embodiments, the class II β chain is HLA-DMB, HLA-DOB, HLA-DPB, HLA-DQB, or HLA-DRB.

[0300] The peptide in the pMHC complex can be any peptide that is capable of binding to an MHC protein in such a manner that the pMHC complex is capable of binding, for example, to a TCR in a specific manner.

[0301] Examples include peptides produced by hydrolysis, and most typically, synthetically produced peptides (including randomly generated peptides, specifically designed peptides, and peptides in which at least some of the amino acid positions are conserved among several peptides, with the remaining positions being random).

[0302] In fact, the peptides produced by hydrolysis undergo hydrolysis before the antigen binds to the MHC protein. Class I MHC typically presents peptides derived from proteins that are actively synthesized in the cytoplasm of the cell. In contrast, class II MHC typically presents peptides derived from either exogenous proteins that enter the endocytosis pathway of the cell or proteins that are synthesized in the ER. Intracellular transport allows the peptides to associate with the MHC protein.

[0303] Binding of peptides to the MHC peptide binding groove can control the spatial arrangement of MHC and / or peptide amino acid residues recognized by TCR or pMHC binding proteins produced by genetically modified animals as disclosed herein. Such spatial control is due, in part, to hydrogen bonds formed between the peptide and the MHC protein. Based on knowledge of how peptides bind to various MHC, the key MHC anchor amino acids and surface exposed amino acids that vary between different peptides can be determined. In some embodiments, the length of the MHC binding peptide is 5-40 amino acid residues, e.g., 6-30 amino acid residues, e.g., 8-20 amino acid residues, e.g., 9-11 amino acid residues, including peptides of any size from 5-40 amino acid length in all integer increments (i.e., 5, 6, 7, 8, 9, ... 40). Natural MHC class II binding peptides vary from about 9-40 amino acids, but in almost all cases the peptides can be shortened to the 9-11 amino acid core without loss of MHC binding activity or T cell recognition.

[0304] For the treatment of autoimmune diseases, peptides bound to MHC can be associated with autoimmune antigens. Examples of such peptides include human cartilage glycoprotein-39 peptides associated with rheumatoid arthritis (see, e.g., Steenbakkers et al., 2003, J. Immunol. 170:5719-5727); insulin peptides associated with type I diabetes (see, e.g., Zhang et al., 2014, Proc. Nat'l Acad. Sci. USA 111(7)2656-2661); myelin basic protein peptides associated with multiple sclerosis (Krogsgaard et al., 2000, J Exp Med. 191(8):1395-1412), and gluten peptides associated with celiac disease (see, e.g., Hoydahl et al., 2019, Gastroenterology. 156(5):1428:1439.e10).

[0305] Linker In certain embodiments, the present disclosure provides an IL27 agonist, in which two or more components of the IL27 agonist are connected to each other by a peptide linker.By way of example and not limitation, linker can be used to connect (a) IL27 domain and Fc domain; (b) IL27 domain and HSA polypeptide; (c) IL27 domain and targeting moiety; (d) Fc domain and targeting moiety (e.g., Fab domain or scFv); (e) different domains within targeting moiety (e.g., VH and VL domains in scFv); and / or (f) two IL27 domains (e.g., p28 moiety and EBI3 moiety).

[0306] The peptide linker may be in the range of 2 to 60 or more amino acids, and in certain embodiments, the peptide linker is in the range of 3 to 50 amino acids, 4 to 30 amino acids, 5 to 25 amino acids, 10 to 25 amino acids, 10 to 60 amino acids, 12 to 20 amino acids, 20 to 50 amino acids, or 25 to 35 amino acids in length.

[0307] In certain embodiments, the peptide linker is at least 5 amino acids long, at least 6 amino acids long, or at least 7 amino acids long, and optionally up to 30 amino acids long, up to 40 amino acids long, up to 50 amino acids long, or up to 60 amino acids long.

[0308] In some of the aforementioned embodiments, the linker is in the range of 5 to 50 amino acids in length, for example, 5 to 50, 5 to 45, 5 to 40, 5 to 35, 5 to 30, 5 to 25, or 5 to 20 amino acids in length. In other of the aforementioned embodiments, the linker is in the range of 6 to 50 amino acids in length, for example, 6 to 50, 6 to 45, 6 to 40, 6 to 35, 6 to 30, 6 to 25, or 6 to 20 amino acids in length. In yet other of the aforementioned embodiments, the linker is in the range of 7 to 50 amino acids in length, for example, 7 to 50, 7 to 45, 7 to 40, 7 to 35, 7 to 30, 7 to 25, or 7 to 20 amino acids in length.

[0309] Charged linkers (eg, charged hydrophilic linkers) and / or flexible linkers are particularly preferred. Examples of flexible linkers that may be used in the IL27 receptor agonists of the present disclosure include those disclosed by Chen et al., 2013, Adv Drug Deliv Rev. 65(10):1357-1369 and Klein et al., 2014, Protein Engineering, Design & Selection 27(10):325-330. Particularly useful flexible linkers are or include monomers or polymers of glycine and serine repeats, such as GnS or SGn (n is an integer from 1 to 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10). In one embodiment, the linker is or includes a monomer or polymer of G4S (SEQ ID NO: 38), e.g., (GGGGS)n (SEQ ID NO: 81).

[0310] Polyglycine linkers may be suitably used in the IL27 receptor agonists of the present disclosure. In some embodiments, the peptide linker comprises two consecutive glycines (2Gly), three consecutive glycines (3Gly), four consecutive glycines (4Gly) (SEQ ID NO: 82), five consecutive glycines (5Gly) (SEQ ID NO: 83), six consecutive glycines (6Gly) (SEQ ID NO: 84), seven consecutive glycines (7Gly) (SEQ ID NO: 85), eight consecutive glycines (8Gly) (SEQ ID NO: 86), or nine consecutive glycines (9Gly) (SEQ ID NO: 87).

[0311] 5.8.1.pMHC Linker For pMHC complexes, suitable linkers may range from 1 amino acid (e.g., Gly) to 20 amino acids, 2 amino acids to 15 amino acids, 3 amino acids to 12 amino acids, such as 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, or 7 amino acids. In addition to the above linkers, pMHC linkers include glycine polymers (G)n, glycine-serine polymers (including, for example, (GS)n, (GSGGS)n (SEQ ID NO: 88) and (GGGS)n (SEQ ID NO: 89), where n is an integer of at least 1), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers can be used; both Gly and Ser are relatively unstructured and can therefore function as neutral tethers between components. Glycine polymers can be used; glycine has access to a much broader range of phi-psi space than alanine and is much less restrictive than residues with longer side chains (see Scheraga, 1992, Rev. Computational Chem. 1 1173-142, incorporated herein by reference in its entirety). Exemplary linkers can include amino acid sequences including, but not limited to, GGSG (SEQ ID NO: 12), GGSGG (SEQ ID NO: 13), GSGSG (SEQ ID NO: 14), GSGGG (SEQ ID NO: 15), GGGSG (SEQ ID NO: 16), GSSSG (SEQ ID NO: 17), GCGASGGGGSGGGGS (SEQ ID NO: 18), GGGGSGGGGS (SEQ ID NO: 19), GGGASGGGGSGGGGGS (SEQ ID NO: 20), GGGGSGGGGSGGGGGS (SEQ ID NO: 21), GGGASGGGGS (SEQ ID NO: 22), GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 23), GCGGS (SEQ ID NO: 24), and the like. In some embodiments, the linker polypeptide comprises a cysteine ​​residue capable of forming a disulfide bond with a cysteine ​​residue present in another portion of the pMHC complex, hi certain embodiments, the linker comprises the amino acid sequence GCGGS (SEQ ID NO: 24).Substitution of a glycine in the G4S linker with a cysteine ​​can result in the formation of a disulfide bond, for example an MHC targeting moiety with the corresponding cysteine ​​substitution in HLA.A2, that stabilizes the MHC peptide within the MHC complex.

[0312] 5.8.2. Hinge arrangement In other embodiments, the IL27 agonist of the present disclosure comprises a linker that is a hinge region.In particular, when the IL27 agonist contains an immunoglobulin-based targeting moiety, the hinge can be used to connect the targeting moiety, for example, the Fab domain, to the multimerization domain, for example, the Fc domain.Even if no targeting moiety is present, the hinge sequence can be utilized to stabilize the IL27 agonist dimer.

[0313] The hinge region may be a naturally occurring hinge region or a modified hinge region. Hinge regions are typically found at the N-terminus of the Fc region. A native hinge region is the hinge region that is normally found between the Fab and Fc domains in naturally occurring antibodies. A modified hinge region is any hinge that differs in length and / or composition from the native hinge region. Such hinges may include hinge regions from other species, such as human, mouse, rat, rabbit, shark, pig, hamster, camel, llama or goat hinge regions. Other modified hinge regions may include a complete hinge region derived from an antibody of a different class or subclass than that of the heavy chain Fc domain or Fc region. Alternatively, a modified hinge region may include a portion of a native hinge or a repeating unit in which each unit in the repeat is derived from a native hinge region. In a further alternative, the native hinge region may be modified by converting one or more cysteine ​​or other residues to neutral residues such as serine or alanine, or by converting appropriately placed residues to cysteine ​​residues. By such means, the number of cysteine ​​residues in the hinge region may be increased or decreased. Other modified hinge regions may be entirely synthetic and may be designed to have desired properties such as length, cysteine ​​composition and flexibility.

[0314] A number of modified hinge regions have been previously described, for example, in U.S. Pat. No. 5,677,425, WO 9915549, WO 2005003170, WO 2005003169, WO 2005003170, WO 9825971 and WO 2005003171, which are incorporated herein by reference.

[0315] In various embodiments, positions 233-236 in the hinge domain can be G, G, G, and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, where positions are numbered according to EU numbering.

[0316] In some embodiments, an IL27 mutein of the disclosure comprises a modified hinge domain that reduces binding affinity to an Fcγ receptor compared to a wild-type hinge domain of the same isotype (eg, human IgG1 or human IgG4).

[0317] In one embodiment, the Fc domain of one or both chains of a dimeric IL27 agonist of the present disclosure has an intact hinge region at its N-terminus. In one embodiment, one or both Fc domains of the chain and hinge region of the dimeric IL27 agonist of the present disclosure are derived from IgG4, and the hinge region contains the modified sequence CPPC (SEQ ID NO: 25). The core hinge region of human IgG4 contains the sequence CPSC (SEQ ID NO: 26) compared to IgG1, which contains the sequence CPPC (SEQ ID NO: 25). The serine residues present in the IgG4 sequence increase the flexibility of this region, so that some of the molecules form disulfide bonds within the same protein chain (intrachain disulfides) rather than crosslinking to other heavy chains in the IgG molecule to form interchain disulfides (Angel et al., 1993, Mol Immunol 30(1):105-108). Changing the serine residues to proline to give the same core sequence as IgG1 allows complete formation of interchain disulfides in the IgG4 hinge region, thus reducing heterogeneity in the purified product. This modified isotype is called IgG4P.

[0318] 5.8.2.1. Chimeric hinge sequences The hinge region may be a chimeric hinge region. For example, a chimeric hinge may comprise an "upper hinge" sequence derived from a human IgG1, human IgG2, or human IgG4 hinge region in combination with a "lower hinge" sequence derived from a human IgG1, human IgG2, or human IgG4 hinge region.

[0319] In certain embodiments, the chimeric hinge region comprises the amino acid sequence EPKSCDKTHTCPPCPAPPVA (SEQ ID NO:27) (SEQ ID NO:8 of WO 2014 / 121087, which is incorporated by reference in its entirety) or ESKYGPPCPPCPAPPVA (SEQ ID NO:28) (SEQ ID NO:9 of WO 2014 / 121087). Such a chimeric hinge sequence may be suitably linked to an IgG4 CH2 region (e.g., by incorporation into an IgG4 Fc domain, such as a human or mouse Fc domain, which may be further modified in the CH2 and / or CH3 domains to reduce effector function, e.g., as described in Section 5.4.2).

[0320] 5.8.2.2. Hinge sequences with reduced effector function In further embodiments, the hinge region can be modified to reduce effector function, for example, as described in WO2016161010(A2), which is incorporated by reference in its entirety. In various embodiments, positions 233-236 of the modified hinge region are G, G, G, and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, with positions numbered according to EU numbering (as shown in FIG. 1 of WO2016161010(A2)). These segments can be represented as GGG-, GG--, G---, or ----, with "-" representing an unoccupied position.

[0321] Position 236 is unoccupied in standard human IgG2 but is occupied in other standard human IgG isotypes. Positions 233-235 are occupied by residues other than G in all four human isotypes (as shown in Figure 1 of WO2016161010(A2)).

[0322] Hinge modifications within positions 233-236 can be combined with position 228 being occupied by P. Position 228 is naturally occupied by P in human IgG1 and IgG2, but by S in human IgG4 and by R in human IgG3. The S228P mutation in IgG4 antibodies is advantageous to stabilize IgG4 antibodies and reduce exchange of heavy-light chain pairs between exogenous and endogenous antibodies. Preferably, positions 226-229 are occupied by C, P, P and C, respectively.

[0323] Exemplary hinge regions have residues 226-236, sometimes referred to as the middle (or core) and lower hinge, and are occupied by modified hinge sequences designated GGG-(233-236), GG--(233-236), G---(233-236) and no G(233-236). Optionally, the hinge domain amino acid sequence comprises CPPCPAPGGG-GPSVF (SEQ ID NO:29) (SEQ ID NO:1 in WO 2016161010(A2)), CPPCPAPGG--GPSVF (SEQ ID NO:30) (SEQ ID NO:2 in WO 2016161010(A2)), CPPCPAPG---GPSVF (SEQ ID NO:31) (SEQ ID NO:3 in WO 2016161010(A2)), or CPPCPAP----GPSVF (SEQ ID NO:32) (SEQ ID NO:4 in WO 2016161010(A2)).

[0324] The modified hinge regions described above can be incorporated into a heavy chain constant region, which typically includes CH2 and CH3 domains and may have additional hinge segments (e.g., upper hinges) flanking the designated regions. The additional constant region segments thus present are typically of the same isotype, preferably human isotype, but may be hybrids of different isotypes. The isotype of such additional human constant region segments is preferably human IgG4, but may be human IgG1, IgG2, or IgG3, or hybrids thereof, where the domains are of different isotypes. Exemplary sequences of human IgG1, IgG2, and IgG4 are shown in Figures 2 to 4 of WO2016161010(A2).

[0325] In a specific embodiment, a modified hinge sequence may be linked to an IgG4 CH2 region (e.g. by incorporation into an IgG4 Fc domain, such as a human or mouse Fc domain, which may be further modified in the CH2 and / or CH3 domains to reduce effector function, e.g., as described in Section 5.4.2).

[0326] 5.9. Nucleic Acids and Host Cells In another aspect, the present disclosure provides a nucleic acid encoding the IL27 agonist of the present disclosure.In some embodiments, the IL27 agonist is encoded by a single nucleic acid.In other embodiments, for example, in the case of a heterodimeric molecule or a molecule that comprises a targeting moiety composed of two or more polypeptide chains, the IL27 agonist can be encoded by multiple (e.g., two, three, four or more) nucleic acids.

[0327] A single nucleic acid can encode an IL27 agonist comprising a single polypeptide chain, an IL27 agonist comprising two or more polypeptide chains, or a portion of an IL27 agonist comprising three or more polypeptide chains (e.g., a single nucleic acid can encode two polypeptide chains of an IL27 agonist comprising three, four or more polypeptide chains, or three polypeptide chains of an IL27 agonist comprising four or more polypeptide chains). To separately control expression, open reading frames encoding two or more polypeptide chains can be under the control of separate transcriptional regulatory elements (e.g., promoters and / or enhancers). Open reading frames encoding two or more polypeptides can also be controlled by the same transcriptional regulatory elements and separated by an internal ribosome entry site (IRES) sequence that can be translated into separate polypeptides.

[0328] In some embodiments, an IL27 agonist that comprises two or more polypeptide chains is encoded by two or more nucleic acids. The number of nucleic acids encoding the IL27 agonist can be equal to or less than the number of polypeptide chains in the IL27 agonist (e.g., when two or more polypeptide chains are encoded by a single nucleic acid).

[0329] The nucleic acids of the disclosure can be DNA or RNA (eg, mRNA). In another aspect, the disclosure provides host cells and vectors containing the nucleic acids of the disclosure. The nucleic acids may be present in a single vector or in separate vectors present in the same host cell or in separate host cells, as described in more detail herein below.

[0330] Vectors The present disclosure provides a vector comprising a nucleotide sequence encoding one or two of the polypeptide chains of an IL27 agonist or IL27 agonist component described herein, such as a dimeric IL27 agonist. Vectors include, but are not limited to, viruses, plasmids, cosmids, lambda phage, or yeast artificial chromosomes (YACs).

[0331] A number of vector systems can be used. For example, one class of vectors utilizes DNA elements derived from animal viruses such as bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retrovirus (Rous sarcoma virus, MMTV or MOMLV) or SV40 virus. Another class of vectors utilizes RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern equine encephalitis virus and flaviviruses.

[0332] Furthermore, cells that have stably integrated the DNA into their chromosomes can be selected by introducing one or more markers that allow for the selection of transfected host cells. Markers can provide, for example, prototropy for auxotrophic hosts, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper. The selectable marker gene can either be directly linked to the DNA sequence to be expressed or can be introduced into the same cell by co-transformation. Additional elements may also be required for optimal synthesis of mRNA. These elements may include splice signals, as well as transcription promoters, enhancers, and termination signals.

[0333] Once the expression vector or DNA sequence containing the construct is prepared for expression, the expression vector can be transfected or introduced into a suitable host cell. To achieve this, various techniques can be used, such as protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid-based transfection or other conventional techniques. The methods and conditions for culturing the resulting transfected cells and for recovering the expressed polypeptide are known to those skilled in the art and can be modified or optimized based on the present description depending on the specific expression vector and mammalian host cell used.

[0334] 5.9.2.Cells The disclosure also provides a host cell comprising a nucleic acid of the disclosure. In one embodiment, the host cell is genetically modified to contain one or more of the nucleic acids described herein.

[0335] In one embodiment, the host cell is genetically modified by using an expression cassette. The term "expression cassette" refers to a nucleotide sequence that can affect the expression of a gene in a host that is compatible with such a sequence. Such a cassette can include a promoter, an open reading frame with or without introns, and a termination signal. Additional elements (e.g., inducible promoters) necessary or useful for effecting expression can also be used.

[0336] The present disclosure also provides a host cell comprising the vector described herein. The cell may be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell. Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells, and MDCKII cells. Suitable insect cells include, but are not limited to, Sf9 cells.

[0337] Pharmaceutical Compositions 5.10.1. Pharmaceutical Compositions Comprising IL27 Agonist Polypeptides The IL27 agonist of the present disclosure may be in the form of a composition comprising an IL27 agonist and one or more carriers, excipients and / or diluents. The composition may be formulated for a particular use, such as veterinary use or pharmaceutical use in humans. The form of the composition used (e.g., dry powder, liquid formulation, etc.) and the excipients, diluents and / or carriers used will depend on the intended use of the IL27 agonist and, in the case of therapeutic use, the mode of administration.

[0338] For therapeutic use, the composition may be supplied as part of a sterile pharmaceutical composition that includes a pharma- ceutically acceptable carrier. The composition may be in any suitable form (depending on the desired method of administering it to a patient). The pharmaceutical composition may be administered to a patient by a variety of routes, including oral, transdermal, subcutaneous, intranasal, intravenous, intramuscular, intrathecal, topically or locally. The most suitable route of administration in any given case will depend on the particular antibody, the subject, the nature and severity of the disease, and the physical condition of the subject. Typically, the pharmaceutical composition is administered intravenously or subcutaneously.

[0339] The pharmaceutical composition can be conveniently provided in a unit dosage form containing a predetermined amount of the IL27 agonist of the present disclosure per administration. The amount of IL27 agonist contained in the unit dosage depends on the disease to be treated, as well as other factors well known in the art. Such unit dosage can be in the form of a lyophilized powder containing an appropriate amount of IL27 agonist for a single administration, or in the form of a liquid. The dry powder unit dosage form can be packaged in a kit with a syringe, an appropriate amount of diluent, and / or other components useful for administration. The unit dosage in liquid form can be conveniently provided in the form of a syringe pre-filled with an appropriate amount of IL27 agonist for a single administration.

[0340] Pharmaceutical compositions may also be supplied in bulk form containing an amount of IL27 agonist suitable for multiple administrations. Pharmaceutical compositions can be prepared for storage as lyophilized formulations or aqueous solutions by mixing IL27 agonists having the desired purity with any pharma- ceutically acceptable carriers, excipients or stabilizers (all of which are referred to herein as "carriers") typically used in the art, i.e., buffers, stabilizers, preservatives, isotonicity agents, non-ionic surfactants, antioxidants, and various other additives. See Remington's Pharmaceutical Sciences, 16th edition (Osol, ed. 1980). Such additives should be non-toxic to recipients at the dosages and concentrations used.

[0341] Buffering agents help maintain pH in a range close to physiological conditions. They can be present in a wide range of concentrations, but are typically present in concentrations ranging from about 2 mM to about 50 mM. Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and their salts, such as citrate buffers (e.g., monosodium citrate-disodium citrate mixtures, citric acid-trisodium citrate mixtures, citric acid-monosodium citrate mixtures, etc.), succinate buffers (e.g., succinic acid-monosodium succinate mixtures, succinic acid-sodium hydroxide mixtures, succinic acid-disodium succinate mixtures, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixtures, tartaric acid-potassium tartrate mixtures, tartaric acid-sodium hydroxide mixtures, etc.), fumarate buffers (e.g., fumaric acid-monosodium fumarate mixtures, fumaric acid-monosodium fumarate mixtures, fumaric acid-monosodium fumarate mixtures, fumaric acid-monosodium fumarate mixtures, etc.), and the like. Examples of suitable buffers include: malic acid-disodium fumarate mixture, monosodium fumarate-disodium fumarate mixture, etc.), gluconic acid buffer (e.g., gluconic acid-sodium gluconate mixture, gluconic acid-sodium hydroxide mixture, gluconic acid-potassium gluconate mixture, etc.), oxalic acid buffer (e.g., oxalic acid-sodium oxalate mixture, oxalic acid-sodium hydroxide mixture, oxalic acid-potassium oxalate mixture, etc.), lactate buffer (e.g., lactate-sodium lactate mixture, lactate-sodium hydroxide mixture, lactate-potassium lactate mixture, etc.), and acetate buffer (e.g., acetate-sodium acetate mixture, acetate-sodium hydroxide mixture, etc.). In addition, phosphate buffer, histidine buffer and trimethylamine salt (e.g., Tris) may be used.

[0342] Preservatives may be added to retard microbial growth and can be added in amounts ranging from about 0.2% to 1% (w / v). Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, metacresol, methylparaben, propylparaben, octadecyldimethylbenzylammonium chloride, benzalkonium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkylparabens such as methyl or propylparaben, catechol, resorcinol, cyclohexanol, and 3-pentanol. Tonicity agents, sometimes known as "stabilizers," can be added to ensure isotonicity of the liquid compositions of the present disclosure and include polyhydric sugar alcohols, such as trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, and mannitol. Stabilizers refer to a broad category of excipients with a wide range of functions, from bulking agents to additives that help to solubilize the therapeutic agent or prevent denaturation or adhesion to the container wall. Typical stabilizers include polyhydric sugar alcohols (listed above); amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myonistol, galactitol, glycerol, etc. (including cyclitols such as inositol); polyethylene glycols; amino acid polymers; sulfur-containing reducing agents, such as urea, The sugars may be glutathione, thioctic acid, sodium thioglycolate, thioglycerol, α-monothioglycerol and sodium thiosulfate; low molecular weight polypeptides (e.g., peptides of 10 residues or less); proteins, such as human serum albumin, bovine serum albumin, gelatin or immunoglobulins; hydrophilic polymers, such as polyvinylpyrrolidone; monosaccharides, such as xylose, mannose, fructose, glucose; disaccharides, such as lactose, maltose, sucrose and trehalose; and trisaccharides, such as raffinose; and polysaccharides, such as dextran.The stabilizer may be present in an amount ranging from 0.5-10% by weight per weight of IL27 agonist.

[0343] Non-ionic surfactants or detergents (also known as "wetting agents") can be added to aid in solubilizing the glycoprotein, as well as to protect the glycoprotein from agitation-induced aggregation, thereby allowing the formulation to be exposed to shear surface stresses without causing denaturation of the protein. Suitable non-ionic surfactants include polysorbates (20, 80, etc.), poloxamers (184, 188, etc.), and pluronic polyols. The non-ionic surfactants may be present in a range of about 0.05 mg / mL to about 1.0 mg / mL, e.g., about 0.07 mg / mL to about 0.2 mg / mL.

[0344] Further miscellaneous excipients include bulking agents (eg, starch), chelating agents (eg, EDTA), antioxidants (eg, ascorbic acid, methionine, vitamin E), and cosolvents.

[0345] 5.10.2. PHARMACEUTICAL COMPOSITIONS FOR DELIVERY OF IL27 AGONIST ENCODING NUCLEIC ACIDS The IL27 agonist of the disclosure can be delivered by any method useful for gene therapy, for example, as mRNA or via a viral vector encoding the IL27 agonist under the control of a suitable promoter.

[0346] Exemplary viral vectors include recombinant adenovirus vectors and adeno-associated virus vectors (rAAV). rAAV vectors are based on the defective and non-pathogenic parvovirus adeno-associated type 2 virus. Most such vectors are derived from plasmids that carry only AAV inverted terminal repeats flanking the transgene expression cassette. Efficient gene transfer and stable transgene delivery by integration into the genome of transduced cells are key features of this vector system. AAV serotypes AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV8, AAV8.2, AAV9, and AAV rh10, as well as pseudotypes AAV such as AAV2 / 8, AAV2 / 5, and AAV2 / 6, are useful for delivering the IL27 transgene.

[0347] AAV can be produced on a clinical scale by many different processes. Examples of systems that can be used include (1) plasmid DNA transfection in mammalian cells, (2) Ad infection of stable mammalian cell lines, (3) infection of mammalian cells with recombinant herpes simplex viruses (rHSVs), and (4) infection of insect cells (Sf9 cells) with recombinant baculoviruses (reviewed in Penaud-DNAM et al., 2018, Mol Ther Methods Clin Dev. 8:166-180).

[0348] Replication-defective recombinant adenoviral vectors (Ad) can be produced at high titers and can easily infect many different cell types. Most adenoviral vectors are engineered so that the transgene replaces the Ad Ela, Elb, and / or E3 genes, and then the replication-defective vector is propagated in human 293 cells, which supply the deleted gene function in transfer. Ad vectors can transduce multiple types of tissues in vivo, including non-dividing differentiated cells such as those found in liver, kidney, and muscle. Conventional Ad vectors have a large carrying capacity.

[0349] Packaging cells are used to form viral particles capable of infecting host cells. Such cells include 293 cells, which package adenovirus, and w2 or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by producer cell lines that package nucleic acid vectors into viral particles. The vector typically contains minimal viral sequences required for packaging and subsequent integration into the host (if applicable), with other viral sequences being replaced by expression cassettes that code for proteins to be expressed. Missing viral functions are supplied during transfer by the packaging cell line. For example, AAV vectors used in gene therapy typically only have inverted terminal repeat (ITR) sequences from the AAV genome required for packaging and integration into the host genome. The viral DNA is packaged into a cell line that contains a helper plasmid that codes for other AAV genes, namely rep and cap, but lacks ITR sequences. This cell line is also infected with adenovirus as a helper. The helper virus promotes the replication of AAV vectors and the expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to the lack of ITR sequences. Contamination by adenovirus can be reduced, for example, by heat treatment, to which adenovirus is more sensitive than AAV.

[0350] The nucleic acid molecule (e.g., mRNA) or virus can be formulated as the only medicament active ingredient of the pharmaceutical composition, or can be combined with other active agents for the particular disorder to be treated. Optionally, other medicinal agents, pharmaceutical agents, carriers, adjuvants, diluents can be included in the compositions provided herein. For example, any one or more of wetting agents, emulsifying agents and lubricants, such as sodium lauryl sulfate and magnesium stearate, coloring agents, releasing agents, coating agents, sweeteners, flavorings and fragrances, preservatives, antioxidants, chelating agents, and inert gases can be included in the composition. Exemplary other agents and excipients that can be included in the compositions include, for example, water soluble antioxidants, such as ascorbic acid, cysteine ​​hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite; oil soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, α-tocopherol; and metal chelating agents, such as citric acid, ethylenediaminetetraacetic acid (EDTA), sorbitol, tartaric acid, and phosphoric acid.

[0351] 5.11. Treatment Indications and Methods The IL27 agonists of the present disclosure are useful for treating IL27-treatable conditions, such as inflammation and immune-related conditions or disorders, such as autoimmune disorders.

[0352] In some embodiments, the present disclosure relates to a method of treating an inflammatory or immune (e.g., autoimmune) condition with an IL27 receptor agonist that targets a desired microenvironment or disease-reactive lymphocytes, comprising administering to a subject in need thereof an IL27 receptor agonist or pharmaceutical composition described herein, wherein the IL27 receptor agonist comprises a targeting moiety that recognizes a target molecule expressed in the disease microenvironment or on disease-reactive lymphocytes.

[0353] The present disclosure further provides a method of localized delivery of an IL27 protein, comprising administering to a subject an IL27 receptor agonist or pharmaceutical composition described herein, wherein the IL27 receptor agonist comprises a targeting moiety that recognizes a target molecule expressed by the tissue to which the IL27 receptor agonist is to be locally delivered. As used herein, the term "locally delivered / locally delivered" does not require local administration, but rather indicates that the IL27 receptor agonist is selectively localized to the tissue of interest following administration.

[0354] The present disclosure further provides a method of administering an IL27 therapeutic to a subject with reduced systemic exposure and / or reduced systemic toxicity, comprising administering the IL27 therapeutic to a subject in the form of an IL27 receptor agonist or pharmaceutical composition described herein. Thus, the above method allows for an IL27 therapeutic with reduced off-target side effects by preferential targeting of the IL27 receptor agonist to specific target cells or tissues, and / or attenuation and / or masking of the IL27 moiety to the intended activity of the site.

[0355] The present disclosure relates to a method of locally modulating an immune response in a target cell or tissue, comprising administering to a subject an IL27 receptor agonist or pharmaceutical composition described herein having one or more targeting moieties capable of binding to a target molecule expressed in a disease microenvironment or by a disease-reactive lymphocyte. The IL27 receptor agonist can then modulate an immune response against at least one cell type in the target tissue.

[0356] In some embodiments, administration is not local to a tissue, for example, administration can be systemic or subcutaneous. In certain embodiments, the condition treated by an IL27 agonist of the present disclosure is an autoimmune condition, transplant rejection (e.g., organ or bone marrow transplant rejection), a post-traumatic immune response, an infectious disease (e.g., a parasitic infection), or graft-versus-host disease. Specific examples of autoimmune conditions include arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes mellitus, type 1 diabetes, Guillain-Barré syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, ankylosing spondylitis, psoriasis, Sjogren's syndrome, vasculitis, glomerulonephritis, autoimmune thyroiditis, Behcet's disease, Crohn's disease, ulcerative colitis, bullous pemphigoid, sarcoidosis, psoriasis, ichthyosis, Graves' ophthalmopathy, inflammatory bowel disease, Addison's disease, vitiligo, asthma, scleroderma, systemic sclerosis, or allergic asthma.

[0357] The IL27 agonist of the present disclosure is generally used in an amount effective to achieve its intended purpose. When used to treat or prevent a disease state, the IL27 agonist of the present disclosure, or a pharmaceutical composition thereof, is administered or applied in a therapeutically effective amount. The determination of a therapeutically effective amount is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein. Those skilled in the art will readily recognize that in many cases, treatment with an IL27 agonist may not result in a cure, but may only result in a partial benefit. In some embodiments, physiological changes that have some degree of benefit are also considered to be therapeutically beneficial. Thus, the terms "effective amount" and "therapeutically effective amount" encompass dosages and dosing regimens that result in a partial benefit.

[0358] The subject, patient, or individual in need of treatment is typically a mammal, more specifically a human. The appropriate dose of the IL27 agonist of the present disclosure (when used alone or in combination with one or more other additional therapeutic agents) for the prevention or treatment of a disease will vary depending on the type of disease being treated, the route of administration, the patient's weight, the specific IL27 agonist, the severity and course of the disease, whether the antibody is administered for prophylactic or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's medical history and response to the IL27 agonist, and the discretion of the attending physician. The physician responsible for administration will in any case determine the concentration of active ingredient in the composition and the appropriate dose for the individual subject. Various dosing schedules are contemplated herein, including, but not limited to, single administration or multiple administrations over various time points, bolus administration, and pulse infusion.

[0359] A single dose of unconjugated IL27 agonist can range from about 50,000 IU / kg to about 1,000,000 IU / kg or more, more typically about 600,000 IU / kg of IL27 agonist. This can be repeated several times (e.g., 2-3 times) per day for several days (e.g., about 3-5 consecutive days), followed by one or more doses after a rest period (e.g., about 7-14 days). Thus, a therapeutically effective amount may consist of only a single dose, or it may consist of multiple doses over a period of time (e.g., about 20-30 individual doses of about 600,000 IU / kg of IL27 agonist over a period of about 10-20 days).

[0360] Similarly, the IL27 agonist is suitably administered to the patient once or over a series of treatments. Depending on the type and severity of the disease, for example, about 1 μg / kg to 15 mg / kg (e.g., 0.1 mg / kg to 10 mg / kg) of the IL27 agonist may be an initial candidate dose for administration to the patient, whether by one or more separate administrations or by continuous infusion. One typical daily dose may range from about 1 μg / kg to 100 mg / kg or more, depending on the factors mentioned above. In the case of repeated administration over several days or more, depending on the circumstances, treatment is generally continued until a desired suppression of disease symptoms occurs. One exemplary dose of the IL27 agonist would be in the range of about 0.005 mg / kg to about 10 mg / kg. In other non-limiting examples, dosages can also include from about 1 μg / kg / body weight, about 5 μg / kg / body weight, about 10 μg / kg / body weight, about 50 μg / kg / body weight, about 100 μg / kg / body weight, about 200 μg / kg / body weight, about 350 μg / kg / body weight, about 500 μg / kg / body weight, about 1 mg / kg / body weight, about 5 mg / kg / body weight, about 10 mg / kg / body weight, about 50 mg / kg / body weight, about 100 mg / kg / body weight, about 200 mg / kg / body weight, about 350 mg / kg / body weight, about 500 mg / kg / body weight, to about 1000 mg / kg / body weight or more per administration, and any range derivable therein. In non-limiting examples of ranges that can be derived from the numerical values ​​recited herein, ranges such as about 5 mg / kg / body weight to about 100 mg / kg / body weight, about 5 μg / kg / body weight to about 500 mg / kg / body weight, etc., based on the numerical values ​​above can be administered. Thus, one or more doses of about 0.5 mg / kg, 2.0 mg / kg, 5.0 mg / kg, or 10 mg / kg (or any combination thereof) can be administered to the patient. Such doses can be administered intermittently, for example, every week or every three weeks (e.g., such that the patient receives about 2 to about 20, or, for example, about 6 doses of the IL27 agonist). An initial higher loading dose can be followed by one or more lower doses. However, other dosing regimens can also be useful. The progress of this therapy is easily monitored by conventional techniques and assays.

[0361] For systemic administration, the therapeutically effective amount can be estimated initially from in vitro assays, such as cell culture assays. The dose can then be determined based on the EC 50 The compound can be formulated in animal models to achieve a circulating concentration range including . Such information can be used to more accurately determine useful doses in humans.

[0362] Initial doses can also be estimated from in vivo data, e.g., animal models, using techniques well known in the art. Those skilled in the art can readily optimize administration to humans based on the animal data.

[0363] Dosage and dosing intervals may be adjusted individually to obtain plasma levels of IL27 agonist sufficient to maintain therapeutic efficacy. Usual patient doses for administration by injection range from about 0.1 to 50 mg / kg / day, typically about 0.5 to 1 mg / kg / day. Therapeutically effective plasma levels may be achieved by administering multiple doses daily. Plasma levels may be measured, for example, by ELISA HPLC.

[0364] In cases of local administration or selective uptake, the effective local concentration of the IL27 agonist may not be related to the plasma concentration. Those skilled in the art will be able to optimize the therapeutically effective local dose without undue experimentation.

[0365] The therapeutically effective dose of the IL27 agonists described herein generally provides therapeutic benefit without causing significant toxicity. Toxicity and therapeutic efficacy of IL27 agonists can be determined by standard pharmaceutical procedures in cell cultures or experimental animals. LD 50 (the dose that is lethal to 50% of the population) and ED 50 The dose ratio between toxic and therapeutic effects is the therapeutic index, which is the LD 50 / ED 50Therapeutic indices can be expressed as a ratio. IL27 agonists that exhibit large therapeutic indices are preferred. In one embodiment, the IL27 agonists of the present disclosure exhibit a large therapeutic index. The data obtained from cell culture assays and animal studies can be used in formulating a suitable dosage range for use in humans. The dosage can be determined so as to be within the range of ED 50 It is preferred that the circulating concentration of the compound is within a range including the range of 0.1 to 1.0 mg / kg / day. The dosage may vary within this range depending on various factors, such as the dosage form employed, the route of administration utilized, the condition of the subject, etc. The exact formulation, route of administration, and dosage can be selected by the individual physician in consideration of the patient's condition. (See, for example, Fingl et al., 1975, In: The Pharmacological Basis of Therapeutics, Ch.1, p.1, which is incorporated herein by reference in its entirety).

[0366] The attending physician of a patient treated with an IL27 agonist of the present disclosure will know how and when to terminate, interrupt, or adjust administration due to toxicity, organ dysfunction, etc. Conversely, the attending physician will also know to adjust treatment to higher levels if clinical response is not sufficient (excluding toxicity). The magnitude of the administered dose in managing the disorder of interest will vary depending on the severity of the condition being treated and the route of administration, etc. The severity of the condition can be evaluated, for example, in part, by standard prognostic evaluation methods. Furthermore, the dose and optionally the frequency of administration will also vary according to the age, weight, and response of the individual patient.

[0367] Combination therapy The IL27 agonist according to the present disclosure may be administered in combination with one or more other additional agents in the treatment. For example, the IL27 agonist of the present disclosure may be co-administered with at least one additional therapeutic agent. The term "therapeutic agent" includes any agent administered to treat a condition or disease in a subject in need of such treatment. Such additional therapeutic agents may include any active ingredient suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.

[0368] IL27 agonists are generally used at the same dosages and routes of administration as described herein, or at about 1-99% of the dosages described herein, or at any dosage and by any route empirically / clinically determined to be appropriate.

[0369] For the treatment of immune and inflammatory conditions, the IL27 agonists of the present disclosure can be used in combination with immunosuppressive or immunomodulatory therapies, non-limiting examples of which include immunosuppressive compounds such as cyclosporine A, cyclophosphamide, FK506, tacrolimus, corticosteroids, azathioprine, mycophenolate mofetil, sirolimus, rapamycin, rapamycin analogs, deoxyspergualin, and prednisone.

[0370] Such combination therapy as described above encompasses combined administration (wherein two or more therapeutic agents are included in the same or separate compositions), and separate administration, in which case the administration of an IL27 agonist of the present disclosure may occur prior to, simultaneously with, and / or after administration of the additional therapeutic agent and / or adjuvant.

[0371] 6. Numbered embodiments While various specific embodiments have been illustrated and described, it will be understood that various changes can be made without departing from the spirit and scope of the present disclosure. The present disclosure is illustrated by the numbered embodiments described below. Unless otherwise specified, any of the concepts, aspects, and / or features of the embodiments described in the above detailed description are applicable to any of the numbered embodiments below.

[0372] In preferred aspects of the numbered embodiments below and claims below, the EBI3 portion, the p28 portion, the Fc domain, and variants thereof preferably comprise the amino acid sequences of human EBI3, human p28, the human Fc domain, and variants thereof, e.g. variants having at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% sequence identity to such human sequences.

[0373] 1. A p28 moiety comprising a mutant p28 domain, the mutant p28 domain comprising: (a) having an amino acid sequence that has at least 90%, at least 95%, or at least 97% sequence identity to the IL27Rα-binding domain of mature human or mature mouse p28; (i) amino acid H52 of full-length human p28 or amino acid Y48 of full-length mouse p28 (the substitution is optionally alanine); (ii) amino acid K56 of full-length human p28 or amino acid K52 of full-length mouse p28 (the substitution is optionally alanine); (iii) amino acid S59 of full-length human p28 or amino acid S55 of full-length mouse p28 (the substitution is optionally alanine); (iv) amino acid E60 of full-length human p28 or amino acid E56 of full-length mouse p28 (the substitution is optionally alanine); (v) amino acid W138 of full-length human p28 or amino acid W134 of full-length mouse p28 (the substitution is optionally alanine); (vi) amino acid L142 of full-length human p28 or amino acid L138 of full-length mouse p28 (the substitution is optionally alanine); (vii) amino acid R145 of full-length human p28 or amino acid R141 of full-length mouse p28 (the substitution is optionally alanine); (viii) amino acid D146 of full-length human p28 or amino acid D142 of full-length mouse p28 (the substitution is optionally alanine); (ix) amino acid R149 of full-length human p28 or amino acid R145 of full-length mouse p28 (the substitution is optionally alanine); (x) amino acid H150 of full-length human p28 or amino acid H146 of full-length mouse p28 (the substitution is optionally alanine); or (xi) containing one or more amino acid substitutions at positions corresponding to any combination of (a)(i) through (a)(x); and / or (b) having an amino acid sequence that has at least 90%, at least 95%, or at least 97% sequence identity to the gp130-binding domain of mature human or mature mouse p28; (i) amino acid L73 of full-length human p28 or amino acid L69 of full-length mouse p28 (the substitution is optionally alanine); (ii) amino acid V76 of full-length human p28 or amino acid V72 of full-length mouse p28 (the substitution is optionally alanine); (iii) amino acid W197 of full-length human p28 or amino acid W195 of full-length mouse p28 (the substitution is optionally alanine); (iv) amino acid L200 of full-length human p28 or amino acid L198 of full-length mouse p28 (the substitution is optionally alanine); (v) amino acid L201 of full-length human p28 or amino acid L199 of full-length mouse p28 (the substitution is optionally alanine); (vi) amino acid Y204 of full-length human p28 or amino acid Y202 of full-length mouse p28 (the substitution is optionally alanine); (vii) amino acid R205 of full-length human p28 or amino acid Q203 of full-length mouse p28 (the substitution is optionally alanine); or (viii) A p28 portion comprising one or more amino acid substitutions at positions corresponding to any combination of (b)(i) to (b)(vii).

[0374] 2. The p28 portion of embodiment 1, wherein the p28 portion has a single mutant p28 domain. 3. The p28 portion of embodiment 1 or embodiment 2, wherein the p28 portion lacks the EBI3 domain.

[0375] 4. The p28 portion of any one of embodiments 1 to 3, comprising an amino acid substitution at a position corresponding to amino acid H52 of full length human p28 or amino acid Y48 of full length mouse p28, wherein the substitution is optionally an alanine.

[0376] 5. The p28 portion of any one of embodiments 1 to 4, comprising an amino acid substitution at a position corresponding to amino acid K56 of full length human p28 or amino acid K52 of full length mouse p28, wherein the substitution is optionally an alanine.

[0377] 6. The p28 portion of any one of embodiments 1-5, comprising an amino acid substitution at a position corresponding to amino acid S59 of full length human p28 or amino acid S55 of full length mouse p28, wherein the substitution is optionally an alanine.

[0378] 7. The p28 portion of any one of embodiments 1-6, comprising an amino acid substitution at a position corresponding to amino acid E60 of full length human p28 or amino acid E56 of full length mouse p28, wherein the substitution is optionally an alanine.

[0379] 8. The p28 portion of any one of embodiments 1-7, comprising an amino acid substitution at a position corresponding to amino acid L73 of full length human p28 or amino acid L69 of full length mouse p28, wherein the substitution is optionally an alanine.

[0380] 9. The p28 portion of any one of embodiments 1-8, comprising an amino acid substitution at a position corresponding to amino acid V76 of full length human p28 or amino acid V72 of full length mouse p28, wherein the substitution is optionally an alanine.

[0381] 10. The p28 portion of any one of embodiments 1-9, comprising an amino acid substitution at a position corresponding to amino acid W138 of full length human p28 or amino acid W134 of full length mouse p28, wherein the substitution is optionally an alanine.

[0382] 11. The p28 portion of any one of embodiments 1-10, comprising an amino acid substitution at a position corresponding to amino acid L142 of full length human p28 or amino acid L138 of full length mouse p28, wherein the substitution is optionally an alanine.

[0383] 12. The p28 portion of any one of embodiments 1-11, comprising an amino acid substitution at a position corresponding to amino acid R145 of full-length human p28 or amino acid R141 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0384] 13. The p28 portion of any one of embodiments 1-12, comprising an amino acid substitution at a position corresponding to amino acid D146 of full length human p28 or amino acid D142 of full length mouse p28, wherein the substitution is optionally an alanine.

[0385] 14. The p28 portion of any one of embodiments 1-13, comprising an amino acid substitution at a position corresponding to amino acid R149 of full-length human p28 or amino acid R145 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0386] 15. The p28 portion of any one of embodiments 1-14, comprising an amino acid substitution at a position corresponding to amino acid H150 of full-length human p28 or amino acid H146 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0387] 16. The p28 portion of any one of embodiments 1-15, comprising an amino acid substitution at a position corresponding to amino acid W197 of full-length human p28 or amino acid W195 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0388] 17. The p28 portion of any one of embodiments 1-16, comprising an amino acid substitution at a position corresponding to amino acid L200 of full-length human p28 or amino acid L198 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0389] 18. The p28 portion of any one of embodiments 1-17, comprising an amino acid substitution at a position corresponding to amino acid L201 of full-length human p28 or amino acid L199 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0390] 19. The p28 portion of any one of embodiments 1-18, comprising an amino acid substitution at a position corresponding to amino acid Y204 of full-length human p28 or amino acid Y202 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0391] 20. The p28 portion of any one of embodiments 1-19, comprising an amino acid substitution at a position corresponding to amino acid R205 of full-length human p28 or amino acid Q203 of full-length mouse p28, wherein the substitution is optionally an alanine.

[0392] 21. The p28 portion of any one of embodiments 1-3, comprising amino acid substitutions at positions corresponding to amino acid L200 of full length human p28 or amino acid L198 of full length mouse p28, and amino acid L201 of full length human p28 or amino acid L199 of full length mouse p28, each substitution optionally being alanine.

[0393] 22. The p28 portion of any one of embodiments 1-3, comprising amino acid substitutions at a position corresponding to amino acid Y204 of full length human p28 or amino acid Y202 of full length mouse p28, and amino acid R205 of full length human p28 or amino acid Q203 of full length mouse p28, wherein the substitutions are optionally alanine, and each substitution is optionally alanine.

[0394] 23. The p28 portion according to any one of embodiments 1 to 3, comprising amino acid substitutions at positions corresponding to amino acid L142 of full length human p28 or amino acid L138 of full length mouse p28, amino acid R149 of full length human p28 or amino acid R145 of full length mouse p28, and amino acid H150 of full length human p28 or amino acid H146 of full length mouse p28, wherein the substitutions are optionally alanine, and each substitution is optionally alanine.

[0395] 24. An IL27 receptor agonist, (a) a p28 moiety comprising the IL27Rα-binding domain and / or the gp130-binding domain of p28, optionally a p28 moiety according to any one of embodiments 1 to 23; and (b) a portion of EBI3 that comprises the p28-binding domain of EBI3, or (c) An IL27 receptor agonist comprising both a p28 portion as defined in (a) and an EBI3 portion as defined in (b).

[0396] 25. An IL27 receptor agonist comprising one, two or more IL27 monomers, optionally an IL27 receptor agonist as described in embodiment 24. 26. An IL27 receptor agonist comprising two IL27 monomers having the configuration of exemplary monomer 1, optionally an IL27 agonist as described in embodiment 25.

[0397] 27. The IL27 receptor agonist of embodiment 26, wherein each p28 moiety is associated with an EBI3 moiety. 28. The IL27 receptor agonist of embodiment 27, wherein each EBI3 portion comprises a myc-myc-his (mmh) tag.

[0398] 29. The IL27 receptor agonist of embodiment 28, wherein the mmh tag is at the N-terminus of each EBI3. 30. The IL27 receptor agonist of embodiment 28, wherein the mmh tag is C-terminal to each EBI3.

[0399] 31. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 1 and a second IL27 monomer having the configuration of exemplary monomer 2, optionally an IL27 agonist as described in embodiment 25.

[0400] 32. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 1 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 1, optionally an IL27 agonist as described in embodiment 25.

[0401] 33. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or 33. The IL27 receptor agonist of embodiment 32, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0402] 34. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 33, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0403] 35. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 2 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 2, optionally an IL27 agonist as described in embodiment 25.

[0404] 36. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or 36. The IL27 receptor agonist of embodiment 35, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0405] 37. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 36, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0406] 38. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising two IL27 monomers having the configuration of exemplary monomer 3. 39. The IL27 receptor agonist of embodiment 38, wherein each p28 moiety is associated with an EBI3 moiety.

[0407] 40. The IL27 receptor agonist of embodiment 39, wherein each EBI3 portion comprises a myc-myc-his (mmh) tag. 41. The IL27 receptor agonist of embodiment 40, wherein the mmh tag is at the N-terminus of each EBI3.

[0408] 42. The IL27 receptor agonist of embodiment 40, wherein the mmh tag is at the C-terminus of each EBI3. 43. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 3 and a second IL27 monomer having the configuration of exemplary monomer 4, optionally an IL27 agonist as described in embodiment 25.

[0409] 44. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 3 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 3, optionally an IL27 agonist as described in embodiment 25.

[0410] 45. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or The IL27 receptor agonist of embodiment 44, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0411] 46. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 45, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0412] 47. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 4 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 4, optionally an IL27 agonist as described in embodiment 25.

[0413] 48. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or 54. The IL27 receptor agonist of embodiment 53, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or component thereof and the multimerization moiety are separated by a linker.

[0414] 49. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 48, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0415] 50. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 5. 51. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising two IL27 monomers having the configuration of exemplary monomer 5.

[0416] 52. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 5 and a second IL27 monomer having the configuration of exemplary monomer 6, optionally an IL27 agonist as described in embodiment 25.

[0417] 53. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 5 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 5.

[0418] 54. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or 54. The IL27 receptor agonist of embodiment 53, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0419] 55. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 33, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0420] 56. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 6. 57. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising two IL27 monomers having the configuration of exemplary monomer 6.

[0421] 58. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 6 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 6.

[0422] 59. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; 59. The IL27 receptor agonist of embodiment 58, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0423] 60. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 59, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0424] 61. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 7. 62. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising two IL27 monomers having the configuration of exemplary monomer 7.

[0425] 63. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 7 and a second IL27 monomer having the configuration of exemplary monomer 8, optionally an IL27 agonist as described in embodiment 25.

[0426] 64. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 7 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 7.

[0427] 65. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or 65. The IL27 receptor agonist of embodiment 64, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0428] 66. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 33, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0429] 67. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 8. 68. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising two IL27 monomers having the configuration of exemplary monomer 8.

[0430] 69. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 8 and a separate polypeptide chain comprising a multimerization moiety capable of associating with said exemplary monomer 8, optionally an IL27 agonist as described in embodiment 25.

[0431] 70. The separate polypeptide chains are (a) a targeting moiety or targeting moiety component, optionally (i) the targeting moiety or targeting moiety component is N-terminal to the multimerization moiety, and / or (ii) the targeting moiety or targeting moiety component and the multimerization moiety are separated by a linker; or 70. The IL27 receptor agonist of embodiment 69, further comprising (b) a means for binding to a target molecule or a component thereof, optionally wherein (i) the means for binding to the target molecule or a component thereof is N-terminal to the multimerization moiety, and / or (ii) the means for binding to the target molecule or a component thereof and the multimerization moiety are separated by a linker.

[0432] 71. (a) the targeting moiety is associated with a corresponding targeting moiety (e.g., a VH with a VL); or (b) The IL27 receptor agonist of embodiment 70, wherein said component of said means for binding to a target molecule is associated with a corresponding component to form said means for binding to said target molecule.

[0433] 72. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 9 and a second IL27 monomer having the configuration of exemplary monomer 10, optionally an IL27 agonist as described in embodiment 25.

[0434] 73. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 9 and a second IL27 monomer having the configuration of exemplary monomer 12, optionally an IL27 agonist as described in embodiment 25.

[0435] 74. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 11 and a second IL27 monomer having the configuration of exemplary monomer 10, optionally an IL27 agonist as described in embodiment 25.

[0436] 75. An IL27 receptor agonist comprising a first IL27 monomer having the configuration of exemplary monomer 11 and a second IL27 monomer having the configuration of exemplary monomer 12, optionally an IL27 agonist as described in embodiment 25.

[0437] 76. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 13. 77. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 14.

[0438] 78. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 15. 79. An IL27 receptor agonist, optionally an IL27 agonist as described in embodiment 25, comprising an IL27 monomer having the configuration of exemplary monomer 16.

[0439] 80. An IL27 receptor agonist comprising an IL27 receptor agonist according to embodiment 33 and an IL27 receptor agonist according to embodiment 36, wherein the p28 portion of the IL27 receptor agonist according to embodiment 33 is associated with the EBI3 portion of the IL27 receptor agonist according to embodiment 36, and optionally an IL27 agonist according to embodiment 25.

[0440] 81. An IL27 receptor agonist comprising an IL27 receptor agonist according to embodiment 45 and an IL27 receptor agonist according to embodiment 48, wherein the p28 portion of the IL27 receptor agonist according to embodiment 45 is associated with the EBI3 portion of the IL27 receptor agonist according to embodiment 48, and optionally an IL27 agonist according to embodiment 25.

[0441] 82. (a) a first polypeptide chain, (i) optionally a first multimerization moiety, (ii) optionally, (A) a first targeting moiety or a first targeting moiety component, or (B) a first means for binding to a target molecule or a component thereof; and (iii) a first polypeptide chain, optionally comprising a stabilizing moiety; and (b) a second polypeptide, (i) optionally a second multimerization moiety; (ii) optionally, (A) a second targeting moiety or a component of a second targeting moiety, or (B) a second means for binding to the target molecule or a component thereof; and (iii) a second polypeptide, optionally comprising a second stabilizing moiety; and (c) a first p28 moiety, optionally a p28 moiety as defined in any one of embodiments 1 to 23; and (d) a first EBI3 portion; and optionally an IL27 receptor agonist as described in embodiment 25.

[0442] 83. The IL27 receptor agonist of embodiment 82, which is bivalent for IL27. 84. (a) the first polypeptide comprises the first p28 portion and the first EBI3 portion; (b) An IL27 receptor agonist according to embodiment 82 or embodiment 83, wherein the second polypeptide optionally comprises a second p28 moiety which is a p28 moiety as defined in any one of embodiments 1 to 23.

[0443] 85. An IL27 receptor agonist according to any one of embodiments 82 to 84, comprising a first IL27 monomer and a second IL27 monomer. 86. The IL27 receptor agonist of embodiment 85, wherein the first IL27 monomer and the second IL27 monomer are not identical.

[0444] 87. The IL27 receptor agonist of embodiment 85, wherein the first IL27 monomer and the second IL27 monomer are identical. 88. An IL27 receptor agonist according to any one of embodiments 84 to 87, comprising a first multimerization moiety and a second multimerization moiety, wherein the first p28 moiety and the first EBI3 moiety are N-terminal to the first multimerization moiety, and the second p28 moiety and the second EBI3 moiety are N-terminal to the second multimerization moiety.

[0445] 89. An IL27 receptor agonist according to any one of embodiments 84 to 87, comprising a first multimerization moiety and a second multimerization moiety, wherein the first p28 moiety and the first EBI3 moiety are C-terminal to the first multimerization moiety, and the second p28 moiety and the second EBI3 moiety are C-terminal to the second multimerization moiety.

[0446] 90. The IL agonist of any one of embodiments 84-89, wherein the first EBI3 portion is N-terminal to the first p28 portion and the second EBI3 portion is N-terminal to the p28 portion of the second IL27 portion.

[0447] 91. The IL agonist of any one of embodiments 84-89, wherein the first EBI3 portion is C-terminal to the first p28 portion and the second EBI3 portion is C-terminal to the p28 portion of the second IL27 portion.

[0448] 92. A nucleic acid molecule comprising a first multimerization moiety and a second multimerization moiety, (a) the first multimerization moiety and either the first EBI3 moiety or the first p28 moiety are connected via a first multimerization moiety linker; (b) The IL27 receptor agonist according to any one of embodiments 84 to 91, wherein the second multimerization moiety and either the second EBI3 moiety or the second p28 moiety are connected via a second multimerization moiety linker.

[0449] 93. The IL27 receptor agonist of embodiment 92, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is at least 5 amino acids in length or at least 10 amino acids in length.

[0450] 94. The IL27 receptor agonist according to embodiment 92 or embodiment 93, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is or comprises a glycine-serine linker.

[0451] 95. The IL27 receptor agonist of any one of embodiments 92-94, wherein the first multimerization moiety linker and the second multimerization moiety linker each comprise the amino acid sequence G4S (SEQ ID NO: 38).

[0452] 96. The IL27 receptor agonist of any one of embodiments 92 to 95, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is or comprises a repeat of the amino acid sequence G4S (SEQ ID NO: 38).

[0453] 97. The IL27 receptor agonist of embodiment 96, wherein the repeat comprises 2, 3, 4, 5, 6 or more repeats of the amino acid sequence G4S (SEQ ID NO: 38). 98. The IL27 receptor agonist of any one of embodiments 84 to 97, wherein the first EBI3 portion and the first p28 portion are connected via a first intra-IL27 portion linker, and the second EBI3 portion and the second p28 portion are connected via a second intra-IL27 portion linker.

[0454] 99. The IL27 receptor agonist of embodiment 98, wherein each of said first intra-IL27 moiety linker and said second intra-IL27 moiety linker is at least 5 amino acids in length or at least 10 amino acids in length.

[0455] 100. The IL27 receptor agonist according to embodiment 98 or 99, wherein each of the first IL27 intramoiety linker and the second IL27 intramoiety linker is or comprises a glycine-serine linker.

[0456] 101. The IL27 receptor agonist of any one of embodiments 98-100, wherein the first IL27 intramoiety linker and the second IL27 intramoiety linker each comprise the amino acid sequence G4S (SEQ ID NO: 38).

[0457] 102. The IL27 receptor agonist according to any one of embodiments 98 to 101, wherein each of the first intra-IL27 linker and the second linker is or comprises a repeat of the amino acid sequence G4S (SEQ ID NO: 38).

[0458] 103. The IL27 receptor agonist of embodiment 102, wherein the repeat comprises 2, 3, 4, 5, 6, or more repeats of the amino acid sequence G4S (SEQ ID NO: 38). 104. The IL27 receptor agonist according to embodiment 82, which is monovalent for IL27.

[0459] 105. (a) the first polypeptide optionally comprises a first p28 moiety which is a p28 moiety defined in any one of embodiments 1 to 23; (b) The IL27 receptor agonist of embodiment 104, wherein said second polypeptide comprises said first EBI3 portion.

[0460] 106. The IL27 receptor agonist of embodiment 105, comprising a first multimerization portion and a second multimerization portion, wherein the first EBI3 portion is N-terminal to the first multimerization portion and the first p28 portion is N-terminal to the second multimerization portion.

[0461] 107. The IL27 receptor agonist of embodiment 105, comprising a first multimerization portion and a second multimerization portion, wherein the first EBI3 portion is C-terminal to the first multimerization portion and the first p28 portion is C-terminal to the second multimerization portion.

[0462] 108. A nucleic acid molecule comprising a first multimerization moiety and a second multimerization moiety, (a) the first multimerization moiety and the first EBI3 moiety are connected via a first multimerization moiety linker; (b) The IL27 receptor agonist according to any one of embodiments 105 to 107, wherein the second multimerization moiety and the first p28 moiety are connected via a second multimerization moiety linker.

[0463] 109. The IL27 receptor agonist of embodiment 108, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is at least 5 amino acids in length or at least 10 amino acids in length.

[0464] 110. The IL27 receptor agonist according to embodiment 108 or embodiment 109, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is or comprises a glycine-serine linker.

[0465] 111. The IL27 receptor agonist of any one of embodiments 108-110, wherein the first multimerization moiety linker and the second multimerization moiety linker each comprise the amino acid sequence G4S (SEQ ID NO: 38).

[0466] 112. The IL27 receptor agonist according to any one of embodiments 108 to 111, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is or comprises a repeat of the amino acid sequence G4S (SEQ ID NO: 38).

[0467] 113. The IL27 receptor agonist of embodiment 112, wherein the repeat comprises 2, 3, 4, 5, 6 or more repeats of the amino acid sequence G4S (SEQ ID NO: 38). 114. (a) the first polypeptide comprises the first EBI3 portion and the first p28 portion; (b) The IL27 receptor agonist of embodiment 104, wherein said second polypeptide lacks both the EBI3 portion and the p28 portion.

[0468] 115. The IL27 receptor agonist of embodiment 114, comprising a first multimerization portion and a second multimerization portion, wherein the first EBI3 portion and the first p28 portion are N-terminal to the first multimerization portion.

[0469] 116. The IL27 receptor agonist of embodiment 114, comprising a first multimerization portion and a second multimerization portion, wherein the first EBI3 portion and the first p28 portion are C-terminal to the first multimerization portion.

[0470] 117. The IL27 agonist of any one of embodiments 114-116, wherein the first EBI3 portion is N-terminal to the first p28 portion. 118. The IL27 agonist of any one of embodiments 114-116, wherein the first EBI3 portion is C-terminal to the first p28 portion.

[0471] 119. The IL27 receptor agonist according to any one of embodiments 114 to 118, comprising a first multimerization moiety and a second multimerization moiety, wherein the first multimerization moiety and either the first EBI3 moiety or the first p28 moiety are connected via a first multimerization moiety linker.

[0472] 120. The IL27 receptor agonist according to embodiment 119, wherein the first multimerization moiety linker is at least 5 amino acids in length or at least 10 amino acids in length. 121. The IL27 receptor agonist according to embodiment 119 or embodiment 120, wherein the first multimerization moiety linker is or comprises a glycine-serine linker.

[0473] 122. The IL27 receptor agonist according to any one of embodiments 119-121, wherein the first multimerization moiety linker comprises the amino acid sequence G4S (SEQ ID NO: 38). 123. The IL27 receptor agonist according to any one of embodiments 119 to 122, wherein each of the first multimerization moiety linker and the second multimerization moiety linker is or comprises a repeat of the amino acid sequence G4S (SEQ ID NO: 38).

[0474] 124. The IL27 receptor agonist of embodiment 123, wherein the repeat comprises 2, 3, 4, 5, 6 or more repeats of the amino acid sequence G4S (SEQ ID NO: 38). 125. The IL27 receptor agonist according to any one of embodiments 114-124, wherein said first EBI3 moiety and said first p28 moiety are connected via a first intra-IL27 moiety linker.

[0475] 126. The IL27 receptor agonist according to embodiment 125, wherein the intra-IL27 linker is at least 5 amino acids in length or at least 10 amino acids in length. 127. The IL27 agonist according to embodiment 125 or embodiment 126, wherein the first intra-IL27 moiety linker is or comprises a glycine-serine linker.

[0476] 128. The IL27 receptor agonist according to any one of embodiments 125 to 127, wherein the first intra-IL27 linker comprises the amino acid sequence G4S. 129. The IL27 receptor agonist according to any one of embodiments 125 to 128, wherein the first intra-IL27 linker is or comprises a repeat of the amino acid sequence G4S.

[0477] 130. The IL27 receptor agonist of embodiment 129, wherein the repeat comprises 2, 3, 4, 5, 6 or more repeats of the amino acid sequence G4S. 131. The IL27 agonist according to any one of embodiments 82 to 130, having a stoichiometric ratio of multimerization moiety:EBI3 moiety of 1:1.

[0478] 132. The IL27 agonist according to any one of embodiments 82 to 130, having a stoichiometric ratio of multimerization moiety:p28 moiety of 2:1. 133. The IL27 agonist according to any one of embodiments 82 to 130, having a stoichiometric ratio of multimerization moiety:p28 moiety of 4:1.

[0479] 134. An IL27 agonist according to any one of embodiments 82 to 133, having a stoichiometric ratio of Fc domain:p28 moiety of 1:1. 135. The IL27 agonist of any one of embodiments 82 to 133, having a stoichiometric ratio of Fc domain:EBI3 moiety of 2:1.

[0480] 136. The IL27 agonist of any one of embodiments 82 to 133, having a stoichiometric ratio of Fc domain:EBI3 moiety of 4:1. 137. (a) a stabilizing moiety; and (b) an IL27 receptor agonist comprising a polypeptide chain comprising an EBI3 portion, a p28 portion, or both an EBI3 portion and a p28 portion, optionally wherein the p28 portion is as defined in any one of embodiments 1 to 23, and optionally an IL27 agonist as defined in embodiment 25.

[0481] 138. The IL27 receptor agonist according to embodiment 137, which is monovalent for IL27. 139. The IL27 receptor agonist according to embodiment 137 or embodiment 138, wherein the EBI3 portion and the p28 portion are N-terminal to the stabilizing portion.

[0482] 140. The IL27 receptor agonist according to any one of embodiments 137-139, wherein the EBI3 moiety and the p28 moiety are C-terminal to the stabilizing moiety. 141. The IL27 receptor agonist according to any one of embodiments 137-140, wherein the EBI3 portion is N-terminal to the p28 portion.

[0483] 142. The IL27 receptor agonist according to any one of embodiments 137-140, wherein the EBI3 portion is C-terminal to the p28 portion. 143. The IL27 receptor agonist according to any one of embodiments 137-142, wherein the stabilizing moiety and either the EBI3 moiety or the p28 moiety are connected via a stabilizing moiety linker.

[0484] 144. The IL27 receptor agonist according to embodiment 143, wherein the stabilizing moiety linker is at least 5 amino acids in length or at least 10 amino acids in length. 145. The IL27 receptor agonist according to embodiment 143 or embodiment 144, wherein the stabilizing moiety linker is or comprises a glycine-serine linker.

[0485] 146. The IL27 receptor agonist according to any one of embodiments 143 to 145, wherein the stabilizing moiety linker comprises the amino acid sequence G4S (SEQ ID NO: 38). 147. The IL27 receptor agonist according to any one of embodiments 143 to 146, wherein the stabilizing moiety linker is or comprises a repeat of the amino acid sequence G4S (SEQ ID NO: 38).

[0486] 148. The IL27 receptor agonist according to embodiment 147, wherein the repeat comprises 2, 3, 4, 5, 6 or more repeats of the amino acid sequence G4S (SEQ ID NO: 38). 149. The IL27 receptor agonist according to any one of embodiments 137-148, wherein the EBI3 moiety and the p28 moiety are connected via an intra-IL27 moiety linker.

[0487] 150. The IL27 receptor agonist according to embodiment 149, wherein the intra-IL27 linker is at least 5 amino acids in length or at least 10 amino acids in length. 151. The IL27 receptor agonist according to embodiment 149 or embodiment 150, wherein the IL27 intramoiety linker is or comprises a glycine-serine linker.

[0488] 152. The IL27 receptor agonist according to any one of embodiments 149 to 151, wherein the IL27 intramoiety linker comprises the amino acid sequence G4S (SEQ ID NO: 38). 153. The IL27 receptor agonist according to any one of embodiments 143 to 146, wherein the IL27 intramoiety linker is or comprises a repeat of the amino acid sequence G4S (SEQ ID NO: 38).

[0489] 154. The IL27 receptor agonist of embodiment 153, wherein the repeat comprises 2, 3, 4, 5, 6 or more repeats of the amino acid sequence G4S (SEQ ID NO: 38). 155. The IL27 receptor agonist of any one of embodiments 82 to 130, wherein the first EBI3 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the p28-binding domain of mature human or mature mouse EBI3 or a variant thereof.

[0490] 156. The IL27 receptor agonist of any one of embodiments 82 to 155, wherein the first EBI3 portion has an amino acid sequence having at least about 90% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0491] 157. The IL27 receptor agonist of any one of embodiments 82 to 156, wherein the first EBI3 portion has an amino acid sequence having at least about 95% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0492] 158. The IL27 receptor agonist of any one of embodiments 82 to 157, wherein the first EBI3 portion has an amino acid sequence having at least about 97% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0493] 159. The IL27 receptor agonist of any one of embodiments 82 to 158, wherein the first EBI3 portion has an amino acid sequence having at least about 98% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0494] 160. The IL27 receptor agonist of any one of embodiments 82-159, wherein the first EBI3 portion has an amino acid sequence having at least about 99% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0495] 161. The IL27 receptor agonist of any one of embodiments 82 to 160, wherein the first EBI3 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to mature human or mature mouse EBI3 or a variant thereof.

[0496] 162. The IL27 receptor agonist of any one of embodiments 82-161, wherein the first EBI3 portion has an amino acid sequence having at least about 90% sequence identity to mature human or mature mouse EBI3.

[0497] 163. The IL27 receptor agonist of any one of embodiments 82-162, wherein the first EBI3 portion has an amino acid sequence having at least about 95% sequence identity to mature human or mature mouse EBI3.

[0498] 164. The IL27 receptor agonist of any one of embodiments 82-163, wherein the first EBI3 portion has an amino acid sequence having at least about 97% sequence identity to mature human or mature mouse EBI3.

[0499] 165. The IL27 receptor agonist of any one of embodiments 82-164, wherein the first EBI3 portion has an amino acid sequence having at least about 98% sequence identity to mature human or mature mouse EBI3.

[0500] 166. The IL27 receptor agonist of any one of embodiments 82-165, wherein the first EBI3 portion has an amino acid sequence having at least about 99% sequence identity to mature human or mature mouse EBI3.

[0501] 167. The IL27 receptor agonist of any one of embodiments 82 to 166, wherein the first p28 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the IL27Rα-binding domain of mature human or mature mouse p28 and / or the gp130-binding domain of mature human or mature mouse p28, and optionally the p28 portion is defined in any one of embodiments 1 and 23.

[0502] 168. The IL27 receptor agonist of any one of embodiments 82 to 167, wherein the first p28 portion has an amino acid sequence having at least about 90% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0503] 169. The IL27 receptor agonist of any one of embodiments 82 to 168, wherein the first p28 portion has an amino acid sequence having at least about 95% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0504] 170. The IL27 receptor agonist of any one of embodiments 82 to 169, wherein the first p28 portion has an amino acid sequence having at least about 97% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0505] 171. The IL27 receptor agonist of any one of embodiments 82 to 170, wherein the first p28 portion has an amino acid sequence having at least about 98% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0506] 172. The IL27 receptor agonist of any one of embodiments 82 to 171, wherein the first p28 portion has an amino acid sequence having at least about 99% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0507] 173. The IL27 receptor agonist of any one of embodiments 82 to 172, wherein the first p28 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to mature human or mature mouse p28.

[0508] 174. The IL27 receptor agonist of any one of embodiments 82-173, wherein the first p28 portion has an amino acid sequence having at least about 90% sequence identity to mature human or mature mouse p28.

[0509] 175. The IL27 receptor agonist of any one of embodiments 82-174, wherein the first p28 portion has an amino acid sequence having at least about 95% sequence identity to mature human or mature mouse p28.

[0510] 176. The IL27 receptor agonist of any one of embodiments 82-175, wherein the first p28 portion has an amino acid sequence having at least about 97% sequence identity to mature human or mature mouse p28.

[0511] 177. The IL27 receptor agonist of any one of embodiments 82-176, wherein the first p28 portion has an amino acid sequence having at least about 98% sequence identity to mature human or mature mouse p28.

[0512] 178. The IL27 receptor agonist of any one of embodiments 82 to 177, wherein the first p28 portion has an amino acid sequence having at least about 99% sequence identity to mature human or mature mouse p28.

[0513] 179. The IL27 receptor agonist of any one of embodiments 84 to 178, wherein the second EBI3 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the p28-binding domain of mature human or mature mouse EBI3 or a variant thereof.

[0514] 180. The IL27 receptor agonist of any one of embodiments 84-179, wherein the second EBI3 portion has an amino acid sequence having at least about 90% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0515] 181. The IL27 receptor agonist of any one of embodiments 84 to 180, wherein the second EBI3 portion has an amino acid sequence having at least about 95% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0516] 182. The IL27 receptor agonist of any one of embodiments 84 to 181, wherein the second EBI3 portion has an amino acid sequence having at least about 97% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0517] 183. The IL27 receptor agonist of any one of embodiments 84-182, wherein the second EBI3 portion has an amino acid sequence having at least about 98% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0518] 184. The IL27 receptor agonist of any one of embodiments 84 to 183, wherein the first EBI3 portion has an amino acid sequence having at least about 99% sequence identity to the p28-binding domain of mature human or mature mouse EBI3.

[0519] 185. The IL27 receptor agonist of any one of embodiments 84 to 184, wherein the second EBI3 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to mature human or mature mouse EBI3 or a variant thereof.

[0520] 186. The IL27 receptor agonist of any of embodiments 84-185, wherein the second EBI3 portion has an amino acid sequence having at least about 90% sequence identity to mature human or mature mouse EBI3.

[0521] 187. The IL27 receptor agonist of any one of embodiments 84-186, wherein the second EBI3 portion has an amino acid sequence having at least about 95% sequence identity to mature human or mature mouse EBI3.

[0522] 188. The IL27 receptor agonist of any one of embodiments 84-187, wherein the second EBI3 portion has an amino acid sequence having at least about 97% sequence identity to mature human or mature mouse EBI3.

[0523] 189. The IL27 receptor agonist of any one of embodiments 84-188, wherein the second EBI3 portion has an amino acid sequence having at least about 98% sequence identity to mature human or mature mouse EBI3.

[0524] 190. The IL27 receptor agonist of any one of embodiments 84-189, wherein the second EBI3 portion has an amino acid sequence having at least about 99% sequence identity to mature human or mature mouse EBI3.

[0525] 191. The IL27 receptor agonist of any one of embodiments 84 to 190, wherein the second p28 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the IL27Rα-binding domain of mature human or mature mouse p28 and / or the gp130-binding domain of mature human or mature mouse p28, and optionally wherein the p28 portion is defined in any one of embodiments 1 and 23.

[0526] 192. The IL27 receptor agonist of any one of embodiments 84 to 191, wherein the second p28 portion has an amino acid sequence having at least about 90% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0527] 193. The IL27 receptor agonist of any one of embodiments 84 to 192, wherein the second p28 portion has an amino acid sequence having at least about 95% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0528] 194. The IL27 receptor agonist of any one of embodiments 84 to 193, wherein the second p28 portion has an amino acid sequence having at least about 97% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0529] 195. The IL27 receptor agonist of any one of embodiments 84 to 194, wherein the second p28 portion has an amino acid sequence having at least about 98% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0530] 196. The IL27 receptor agonist of any one of embodiments 84 to 195, wherein the second p28 portion has an amino acid sequence having at least about 99% sequence identity to the IL27Rα and / or gp130 binding domain of mature human or mature mouse p28.

[0531] 197. The IL27 receptor agonist of any one of embodiments 84 to 196, wherein the second p28 portion has an amino acid sequence having at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity to mature human or mature mouse p28.

[0532] 198. The IL27 receptor agonist of any one of embodiments 84-197, wherein the second p28 portion has an amino acid sequence having at least about 90% sequence identity to mature human or mature mouse p28.

[0533] 199. The IL27 receptor agonist of any one of embodiments 84 to 198, wherein the second p28 portion has an amino acid sequence having at least about 95% sequence identity to mature human or mature mouse p28.

[0534] 200. The IL27 receptor agonist of any one of embodiments 84-199, wherein the second p28 portion has an amino acid sequence having at least about 97% sequence identity to mature human or mature mouse p28.

[0535] 201. The IL27 receptor agonist of any one of embodiments 84-200, wherein the second p28 portion has an amino acid sequence having at least about 98% sequence identity to mature human or mature mouse p28.

[0536] 202. The IL27 receptor agonist of any one of embodiments 84-201, wherein the second p28 portion has an amino acid sequence having at least about 99% sequence identity to mature human or mature mouse p28.

[0537] 203. The IL27 receptor agonist of any one of embodiments 82-202, wherein neither the first polypeptide nor the second polypeptide comprises a cytokine moiety other than the IL27 (e.g., p28 or EBI3) moiety.

[0538] 204. The IL27 receptor agonist of any one of embodiments 82-203, wherein the first p28 portion, and, if present, the second p28 portion, comprise at least one amino acid substitution.

[0539] 205. The IL27 receptor agonist of any one of embodiments 82-204, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 52 of full-length human p28 (e.g., residue 48 of full-length mouse p28).

[0540] 206. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 52 of full length human p28 (e.g., residue 48 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 52 of full length human p28 (e.g., residue 48 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 205.

[0541] 207. The IL27 receptor agonist of any one of embodiments 82 to 206, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 56 of full-length human p28 (e.g., residue 52 of full-length mouse p28).

[0542] 208. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 56 of full-length human p28 (e.g., residue 52 of full-length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 56 of full-length human p28 (e.g., residue 52 of full-length mouse p28), optionally an IL27 receptor agonist as described in embodiment 207.

[0543] 209. The IL27 receptor agonist of any one of embodiments 82 to 208, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 59 of full-length human p28 (e.g., residue 55 of full-length mouse p28).

[0544] 210. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 59 of full length human p28 (e.g., residue 55 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 59 of full length human p28 (e.g., residue 55 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 209.

[0545] 211. The IL27 receptor agonist of any one of embodiments 82 to 210, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 60 of full-length human p28 (e.g., residue 56 of full-length mouse p28).

[0546] 212. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 60 of full length human p28 (e.g., residue 56 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 60 of full length human p28 (e.g., residue 56 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 211.

[0547] 213. The IL27 receptor agonist of any one of embodiments 82 to 212, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 73 of full-length human p28 (e.g., residue 69 of full-length mouse p28).

[0548] 214. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 73 of full length human p28 (e.g., residue 69 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 73 of full length human p28 (e.g., residue 69 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 213.

[0549] 215. The IL27 receptor agonist of any one of embodiments 82-214, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 76 of full-length human p28 (e.g., residue 72 of full-length mouse p28).

[0550] 216. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 76 of full length human p28 (e.g., residue 72 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 76 of full length human p28 (e.g., residue 72 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 215.

[0551] 217. The IL27 receptor agonist of any one of embodiments 82 to 216, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 138 of full-length human p28 (e.g., residue 134 of full-length mouse p28).

[0552] 218. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 138 of full length human p28 (e.g., residue 134 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 138 of full length human p28 (e.g., residue 134 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 217.

[0553] 219. The IL27 receptor agonist of any one of embodiments 82 to 218, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 142 of full-length human p28 (e.g., residue 138 of full-length mouse p28).

[0554] 220. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 142 of full length human p28 (e.g., residue 138 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 142 of full length human p28 (e.g., residue 138 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 219.

[0555] 221. The IL27 receptor agonist of any one of embodiments 82 to 220, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 145 of full-length human p28 (e.g., residue 141 of full-length mouse p28).

[0556] 222. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 145 of full length human p28 (e.g., residue 141 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 145 of full length human p28 (e.g., residue 141 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 221.

[0557] 223. The IL27 receptor agonist of any one of embodiments 82 to 222, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 146 of full-length human p28 (e.g., residue 142 of full-length mouse p28).

[0558] 224. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 146 of full length human p28 (e.g., residue 142 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 146 of full length human p28 (e.g., residue 142 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 223.

[0559] 225. The IL27 receptor agonist of any one of embodiments 82 to 224, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 149 of full-length human p28 (e.g., residue 145 of full-length mouse p28).

[0560] 226. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 149 of full length human p28 (e.g., residue 145 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 149 of full length human p28 (e.g., residue 145 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 225.

[0561] 227. The IL27 receptor agonist of any one of embodiments 82 to 226, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 150 of full-length human p28 (e.g., residue 146 of full-length mouse p28).

[0562] 228. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 150 of full length human p28 (e.g., residue 146 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 150 of full length human p28 (e.g., residue 146 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 227.

[0563] 229. The IL27 receptor agonist of any one of embodiments 82 to 228, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 197 of full-length human p28 (e.g., residue 195 of full-length mouse p28).

[0564] 230. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 197 of full length human p28 (e.g., residue 195 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 197 of full length human p28 (e.g., residue 195 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 229.

[0565] 231. The IL27 receptor agonist of any one of embodiments 82 to 230, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 200 of full-length human p28 (e.g., residue 198 of full-length mouse p28).

[0566] 232. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 200 of full length human p28 (e.g., residue 198 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 200 of full length human p28 (e.g., residue 198 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 231.

[0567] 233. The IL27 receptor agonist of any one of embodiments 82 to 232, wherein the first p28 portion, and, if present, the second p28 portion, comprise a p28 domain having an amino acid substitution at a position corresponding to residue 201 of full-length human p28 (e.g., residue 199 of full-length mouse p28).

[0568] 234. An IL27 receptor agonist comprising a first p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 201 of full length human p28 (e.g., residue 199 of full length mouse p28), and optionally further comprising a second p28 portion comprising a p28 domain having an alanine substitution at a position corresponding to residue 200 of full length human p28 (e.g., residue 199 of full length mouse p28), optionally an IL27 receptor agonist as described in embodiment 233.

[0569] 235. The IL27 receptor agonist of any one of embodiments 82 to 234, wherein the first p28 portion, and, if present, the secon...

Claims

1. is monovalent for IL27, (a) a p28 portion comprising the IL27Rα-binding domain and / or the gp130-binding domain of p28; (b) an EBI3 portion comprising the p28-binding domain of EBI3; and (c) a first multimerization moiety or a first stabilization moiety; and (d) optionally, a first targeting moiety; and IL27 receptor agonists, comprising:

2. 2. The IL27 receptor agonist of claim 1, comprising a first stabilizing moiety.

3. An IL27 monomer having the structure of exemplary monomer 13, wherein exemplary monomer 13 is (a) the EBI3 moiety; and (b) an optional linker; and (c) the p28 portion; and (d) an optional linker; and (e) the first stabilizing portion; and 3. The IL27 receptor agonist of claim 2, comprising the IL27 monomer comprising:

4. 2. The IL27 receptor agonist of claim 1, comprising a first stabilizing moiety and a second stabilizing moiety.

5. A first IL27 monomer having the structure of exemplary monomer 9 and a second IL27 monomer having the structure of exemplary monomer 10, (a) Exemplary monomer 9 is (i) the EBI3 moiety; and (ii) an optional linker; and (iii) the first stabilizing moiety; and Including, (b) Exemplary Monomer 10 (i) the p28 portion; and (ii) an optional linker; and (iii) the first stabilizing moiety; and 5. The IL27 receptor agonist of claim 4, wherein the first IL27 monomer and the second IL27 monomer comprise:

6. 3. The IL27 receptor agonist of claim 2, wherein the first stabilizing moiety has an amino acid sequence having at least about 90% sequence identity to mature human serum albumin or a naturally occurring variant of mature human serum albumin.

7. IL27 monomers having the structure of exemplary monomer 7, wherein exemplary monomer 7 is (a) optionally, said first targeting moiety or first targeting moiety component associated with a corresponding first targeting moiety component on a separate peptide chain; (b) an optional linker; and (c) the first multimerization moiety; and (d) the EBI3 moiety; and (e) an optional linker; and (f) the p28 portion; 2. The IL27 receptor agonist of claim 1, comprising the IL27 monomer comprising:

8. 2. The IL27 receptor agonist of claim 1, comprising the first multimerization moiety and the second multimerization moiety.

9. (a) the second multimerization moiety capable of associating with the exemplary monomer; (b) optionally a second targeting moiety or a second targeting moiety component that associates with a corresponding second targeting moiety component on a separate peptide chain; 9. The IL27 receptor agonist of claim 8, further comprising a separate peptide chain comprising:

10. 9. The IL27 receptor agonist of claim 8, wherein the first multimerization moiety and the second multimerization moiety each are or comprise an Fc domain.

11. The IL27 receptor agonist of claim 10, wherein the Fc domain comprises a hinge domain.

12. The IL27 receptor agonist of claim 10, wherein the Fc domain is an IgG1, IgG2, IgG3, or IgG4 Fc domain.

13. The IL27 receptor agonist of claim 10, wherein the Fc domain has a reduced effector function.

14. The IL27 receptor agonist of claim 10, wherein the Fc domain is an IgG4 Fc domain.

15. 11. The IL27 receptor agonist of claim 10, wherein the Fc domain comprises the amino acid sequence ESKYGPPCPPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 80) or a portion thereof.

16. The IL27 receptor agonist of claim 1 , wherein the EBI3 portion has an amino acid sequence having at least about 90% sequence identity to the p28-binding domain of mature human EBI3.

17. The IL27 receptor agonist of claim 16, wherein the EBI3 portion has an amino acid sequence having at least about 90% sequence identity to mature human EBI3.

18. The IL27 receptor agonist of claim 1 , wherein the p28 portion has an amino acid sequence having at least about 90% sequence identity to the IL27Rα-binding domain of mature human p28 and / or the gp130-binding domain of mature human p28.

19. 19. The IL27 receptor agonist of claim 18, wherein the p28 portion has an amino acid sequence having at least about 90% sequence identity to mature human p28.

20. The p28 portion is (a) comprising an amino acid sequence that is at least 90% identical to the mature human IL27Rα-binding domain; (i) amino acid H52 of full-length human p28 or amino acid Y48 of full-length mouse p28 (the substitution is optionally alanine); (ii) amino acid K56 of full-length human p28 or amino acid K52 of full-length mouse p28 (the substitution is optionally alanine); (iii) amino acid S59 of full-length human p28 or amino acid S55 of full-length mouse p28 (the substitution is optionally alanine); (iv) amino acid E60 of full-length human p28 or amino acid E56 of full-length mouse p28 (the substitution is optionally alanine); (v) amino acid W138 of full-length human p28 or amino acid W134 of full-length mouse p28 (the substitution is optionally alanine); (vi) amino acid L142 of full-length human p28 or amino acid L138 of full-length mouse p28 (the substitution is optionally alanine); (vii) amino acid R145 of full-length human p28 or amino acid R141 of full-length mouse p28 (the substitution is optionally alanine); (viii) amino acid D146 of full-length human p28 or amino acid D142 of full-length mouse p28 (the substitution is optionally alanine); (ix) amino acid R149 of full-length human p28 or amino acid R145 of full-length mouse p28 (the substitution is optionally alanine); (x) amino acid H150 of full-length human p28 or amino acid H146 of full-length mouse p28 (the substitution is optionally alanine); or (xi) Any combination of (a)(i) to (a)(x) and / or comprising one or more amino acid substitutions at positions corresponding to (b) an amino acid sequence that is at least 90% similar to the mature human gp130 binding domain; (i) amino acid L73 of full-length human p28 or amino acid L69 of full-length mouse p28 (optionally the substitution is alanine); (ii) amino acid V76 of full-length human p28 or amino acid V72 of full-length mouse p28 (the substitution is optionally alanine); (iii) amino acid W197 of full-length human p28 or amino acid W195 of full-length mouse p28 (the substitution is optionally alanine); (iv) amino acid L200 of full-length human p28 or amino acid L198 of full-length mouse p28 (the substitution is optionally alanine); (v) amino acid L201 of full-length human p28 or amino acid L199 of full-length mouse p28 (the substitution is optionally alanine); (vi) amino acid Y204 of full-length human p28 or amino acid Y202 of full-length mouse p28 (the substitution is optionally alanine); (vii) amino acid R205 of full-length human p28 or amino acid Q203 of full-length mouse p28 (the substitution is optionally alanine); or (viii) any combination of (b)(i) to (b)(vii) 2. The IL27 receptor agonist of claim 1, having a mutant p28 domain comprising one or more amino acid substitutions at positions corresponding to:

21. A nucleic acid or nucleic acids encoding an IL27 agonist according to any one of claims 1 to 20.

22. A host cell engineered to express the IL27 agonist of any one of claims 1 to 20.

23. A method for producing an IL27 agonist described in any one of claims 1 to 20, comprising culturing a host cell engineered to express an IL27 agonist described in any one of claims 1 to 20, and recovering the IL27 agonist expressed thereby.

24. A pharmaceutical composition comprising an IL27 agonist according to any one of claims 1 to 20 and an excipient.

25. The pharmaceutical composition of claim 24 for use in a method of (a) modulating an immune response, (b) treating an autoimmune condition, and / or (c) administering to a subject an IL27 therapeutic agent with reduced systemic exposure and / or reduced systemic toxicity.

26. 26. The pharmaceutical composition of claim 25 for treating an autoimmune condition.

27. 27. The pharmaceutical composition of claim 26, wherein the autoimmune condition is arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, type 1 diabetes, Guillain-Barré syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, ankylosing spondylitis, psoriasis, Sjogren's syndrome, vasculitis, glomerulonephritis, autoimmune thyroiditis, Behcet's disease, Crohn's disease, ulcerative colitis, bullous pemphigoid, sarcoma, psoriasis, ichthyosis, Graves' ophthalmopathy, inflammatory bowel disease, Addison's disease, vitiligo, asthma, scleroderma, systemic sclerosis, or allergic asthma.

Images