Optimized biosynthetic pathways for cannabinoid biosynthesis

Abstract

The present disclosure provides cells, enzymes and methods for improved cannabinoid production.Some aspects of the present disclosure relate to a method for producing CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or analogs thereof, comprising contacting the cells disclosed herein with a carbon source, and optionally hexanoic acid or butyric acid, and suitable conditions to produce CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or analogs thereof.

Description

[Technical field]

[0001] Related Applications This application claims the benefit of U.S. Provisional Patent Application No. 63 / 256,388, filed October 15, 2021, the entire teachings of which are incorporated by reference herein. [Background technology]

[0002] 2. Background of the Invention The Cannabaceae family of plants produces many different cannabinoids in varying relative amounts over a 7-10 week flowering period. Many of these cannabinoids have been and are currently being explored as therapeutic agents in chordates (e.g., mammals), and as a result, they are mostly approved for medical and / or recreational use in the United States (Abrams DI Eur J Int Med 2018, 49, 7-11). Specifically, the most sought-after (phyto)cannabinoids are tetrahydrocannabinolic acid (THCA), cannabidiolic acid (CBDA), and cannabichromenic acid (CBCA). These phytocannabinoids and their related chemical analogs are biosynthesized in varying amounts from the same precursor: cannabigerolic acid (CBGA). As a result, achieving high titers in the biosynthesis of THC(A), CBD(A) and CBC(A) in either plants or recombinant host organisms requires (i) increased flux and availability of geranyl diphosphate (GPP) and olivetolic acid (OA), (ii) increased activity of CBGA synthase, and (iii) increased activity and selectivity of THCA / CBDA / CBCA synthase. However, expression of terminal plant synthases (THCAS, CBDAS, CBCAS) in recombinant organisms (yeast, E. coli, etc.) has been less successful, and only small amounts of product have been synthesized in whole cell biotransformations using these expressions, even after extensive engineering of the organisms and proteins (Zirpel B et al., J. Biotechnol 2018, 40-47). There remains a need to improve / modify both the terminal synthase and the host organism (e.g., Yarrowia) for optimal expression and activity of the enzyme, by discovering new sequences and / or improving enzyme activity. [Prior art documents] [Non-patent literature]

[0003] [Non-Patent Document 1] Abrams DI Eur J Int Med (2018) 49, 7~11 [Non-Patent Document 2] Zirpel B et al., J.Biotechnol(2018)40~47 Summary of the Invention [Means for solving the problem]

[0004] Summary of the Invention Some aspects of the disclosure relate to cells expressing an exogenous terminal cannabinoid synthase and one or more chaperones. In some embodiments, the exogenous terminal cannabinoid synthase is selected from the group consisting of BBE1.6, BBE1.20, BBE1.21, BBE1.22, BBE2.1, BBE2.6, BBE2.7, BBE2.8, BBE2.9, BBE2.10, BBE2.11, BBE2.12, BBE2.13, BBE2.14, BBE2.15, BBE2.16, BBE2.17, BBE2.18, BBE2.19, BBE2.20, BBE2.21, BBE2.22, BBE2.23, BBE2.24, BBE2.25, BBE2.26, BBE2.27, BBE2.28, BBE2.29, BBE2.30, BBE2.31, BBE2.32, BBE2.33, BBE2.34, BBE2.35, BBE2.36, BBE2.37, BBE2.38, BBE2.39, BBE2.40, BBE2.41, BBE2.42, BBE2.43, BBE2.44, BBE2.45, BBE2.46, BBE2.47, BBE2.48, BBE2.49, BBE2.50, BBE2.51, BBE2.52, BBE2.53, BBE2.54, BBE2.55, BBE2.56, BBE2.57, BBE2.59, BBE2.60, BBE2.61, BBE2.62, BBE2.63, BBE2.64, BBE2.65, BBE2.66, BBE2.67, B .8, BBE2.16, BBE2.18, BBE2.19, BBE2.20, BBE2.21, BBE2.22, BBE3.1, BBE2.14, BBE25.1, BBE25.4, and BBE25.5, or a functional fragment or derivative thereof having at least 70% sequence identity to one of these sequences.

[0005] In some embodiments, the exogenous terminal cannabinoid synthase has at least one amino acid modification (e.g., an insertion, deletion, or substitution) compared to a wild-type exogenous terminal cannabinoid synthase. In some embodiments, the exogenous terminal cannabinoid synthase has improved solubility, stability, turnover, selectivity, K m , and / or K. cat In some embodiments, the exogenous terminal cannabinoid synthase is preferentially expressed in a location selected from the cytoplasm, ER, Golgi, liposome, vacuole, cell or extracellular membrane, peroxisome, oleosome, and extracellular environment. In some embodiments, the preferential expression is accompanied by a synthetic, heterologous or natural signal peptide, retention sequence, leader peptide, or sorting sequence. In some embodiments, the exogenous terminal cannabinoid synthase is expressed with a signal peptide selected from SP3, SP4, SP7, SP8, or SP11.

[0006] In some embodiments, the exogenous terminal cannabinoid synthase is fused to CBGA synthase, secretory protein, membrane protein, or membrane localization sequence. In some embodiments, the cannabinoid synthase is fused to Lip2 (SEQ ID NO: 100), CWP1 (SEQ ID NO: 103), 1,3-β glucanosyltransferase (e.g., Uniprot Q6C8C9 or Q6CFU7), or any of the functional fragments (e.g., having membrane localization or secretory activity and / or N-terminal functional fragment).

[0007] In some embodiments, the cells also express an HAC1 (e.g., YALI0B12716p), HAC1s (e.g., SEQ ID NO: 105), FADS1 (e.g., YALI0D25564p), FADS1a (e.g., SEQ ID NO: 104), KAR2 (e.g., YALI0E13706p), FMN1 (e.g., YALI0B01826p), CNE1 (e.g., YALI0B13156p), ERO1 (e.g., YALI0D09603p), PDI1 (e.g., YALI0E03036p), IRE (e.g., YALI0A14839p), YAP1 (e.g., YALI0B03762p), ), HYR1 (e.g., YALI0E02310p), CsCHAP1 (e.g., XP_030509412.1 or SEGIDXX), CsCHAP2 (e.g., KAF4389684.1 or SEQ ID NO: 86), CsCHAP3 (e.g., KAF4346992.1 or SEQ ID NO: 87), CsDNAJ (e.g., XP_030510352.1), ClpB1 (e.g., XP_030489210.1), HSP90 (e.g., SRP155904_DN9237), or a functional fragment or derivative thereof. In some embodiments, the cell overexpresses HAC1 (YALI0B12716p) and / or CNE1 (YALI0B13156p), or a functional fragment or derivative thereof. In some embodiments, the chaperone is expressed with a signal protein selected from SP3, SP7, SP8, SP12, and with or without an HDEL motif, which is an ER retention sequence and may be added at the C-terminal sequence of the chaperone.

[0008] In some embodiments, the cell overexpresses a flavin adenine dinucleotide (FAD) chaperone or an enzyme involved in FAD biosynthesis. In some embodiments, the cell overexpresses an exogenous FAD synthetase or FMN synthetase, or overexpresses a native FAD synthetase or FMN synthetase. In some embodiments, the exogenous FAD synthetase is Uniprot ID Q6C7T3 or FADS1 (YALI0D25564p) or FADS1a (SEQ ID NO: 104). In some embodiments, the FMN synthetase is Uniprot ID Q6CG11.

[0009] In some embodiments, YALI0B05654p / AXP1, XPR2 (P09230), YALI0E33363p / AXP1-like, YALI0E28875p / XPR2-like, YALI0F27071p / PEP4, YALI0A06435p / PRB1A, YALI0B16500p / PRB1B, YALI0E34331p, YALI0E29403p, YALI0E28875p, YALI0E26851p, YALI0E21868p, YALI0E13552p, YALI0E13233p, YALI0E05423p, YALI0E04829p, YALI0E02024p, YALI0F 26411p, YALI0F21615p, YALI0F20592p, YALI0F19734p, YALI0F17974p, YALI0F16005p, YALI0F13585p, YALI0F11033p, YALI0F10769p, YALI0F073 59p, YALI0F05940p, YALI0F01859p, YALI0F01540p, YALI0F00396p, YALI0F00176p, YALI0B20834p, YALI0B19228p, YALI0B17072p, YALI0B14641p, YALI0B13310p, YALI0B11594p, YALI0B10934p, YALI0B05522p, YALI0C10648p, YALI0C10494p, YALI0C09438p, YALI0C08283p, YALI0C05280p, YAL I0C02519p, YALI0C00165p, YALI0D04807p, YALI0D07920p, YALI0D10967p, YALI0D13046p, YALI0D15642p, YALI0D16335p, YALI0D18832p, YALI0D1 9910p, YALI0D22957p, YALI0D23309p, YALI0C21604p, YALI0B04158p, YALI0B02574p, YALI0B01386p, YALI0A13277p, YALI0A10615p, YALI0E1438 8p2, YALI0B03718p, YALI0B16500p, YALI0D10835p, YALI0F09163p, YALI0E22374p, YALI0C00803g, YALI0D02024p, YALI0F11803g, YALI0C20273p,The expression of one or more proteases selected from YALI0B14641g, YALI0F11803g, YALI0C20273g and YALI0C10923p is inhibited or inactivated in the cell. In some preferred embodiments, the expression of YALI0F09163p and / or its homologs and / or orthologs is inhibited or inactivated in the cell.

[0010] In some embodiments, the cells are modified to inhibit or inactivate ROT2 glucosidase (YALI0B06600p). In some embodiments, the cells can be supplemented with either hexanoic acid or olivetolic acid to produce CBGA, or the cells can be supplemented with butanoic acid or divarinic acid to produce CBGVA. In some embodiments, the cells can be supplemented with OA to produce CBDA / THCA / CBCA, and / or with DVA to produce CBDVA / THCVA / CBCVA. In some embodiments, the cells can be supplemented with hexanoic acid to produce CBDA / THCA / CBCA, and / or with butyric acid to produce CBDVA / THCVA / CBCVA.

[0011] In some embodiments, the cells are enhanced to enhance expression of the exogenous terminal cannabinoid synthase, where the manipulation comprises one or more of: (1) improved import of the exogenous terminal cannabinoid synthase into the secretory pathway; (2) regulated unfolded protein response; (3) regulated disulfide bond formation activity; (4) regulated FAD biosynthetic activity; (5) regulated levels of FAD covalent attachment to enzymes; (6) regulated or modified N-linked glycosylation, vesicular trafficking, proteolysis, lipolysis, carbohydrate degradation, or heat shock proteins; (7) regulated reactive oxygen species pathway activity; and (8) regulated cellular protein sorting. As used herein, regulated means "increased or decreased."

[0012] In some embodiments, the cells also express a prenyltransferase to produce CBGA or CBGVA by prenylation of OA or DVA with GPP.

[0013] Some aspects of the disclosure relate to methods of producing CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or analogs thereof, comprising contacting a cell disclosed herein with a carbon source, and optionally hexanoic acid or butyric acid, and suitable conditions to produce CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or analogs thereof.

[0014] All patents, patent applications, and other publications (e.g., scientific articles, books, websites, and databases) mentioned herein are incorporated by reference in their entirety. In the event of any discrepancy between this specification and any of the incorporated references, this specification (including any amendments thereto that may be based on the incorporated references) shall prevail. Unless otherwise indicated, the standard art-accepted meanings of terms are used herein. Various standard abbreviations are used herein.

[0015] The above-discussed and many other features and attendant advantages of the present invention will become better understood by reference to the following detailed description of the invention. [Brief description of the drawings]

[0016] BRIEF DESCRIPTION OF THE DRAWINGS The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

[0017] [Figure 1]FIG. 1 shows the biosynthetic pathway of CBGA and all the major cannabinoids derived from it, including THCA, THCVA, CBCA, CBCVA, CBDA, and CBDVA.

[0018] [Diagram 2] FIG. 2 shows a list of cannabinoids that can be synthesized using the CBGA synthase described herein and in combination with CBDA, CBCA, THCA, or other synthases. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0019] Detailed Description of the Invention Some definitions

[0020] "Identity" or "homology" refers to the degree to which two or more nucleic acid or polypeptide sequences are the same. In some embodiments, the percent identity or homology between a sequence of interest and a second sequence over a window of evaluation, e.g., a length of interest, can be calculated by aligning the sequences, determining the number of residues (nucleotides or amino acids) in the window of evaluation that face identical residues, allowing for the introduction of gaps to maximize identity, dividing by the total number of residues in the sequence of interest or the second sequence (whichever is larger) that fall within the window, and multiplying by 100. When calculating the number of identical residues required to achieve a particular percent identity or homology, decimals will be rounded to the nearest whole number. Percent identity or homology can be calculated using various computer programs known in the art. For example, computer programs (e.g., BLAST2, BLASTN, BLASTP, Gapped BLAST, etc.) generate alignments and provide percent identity between sequences of interest. The algorithm of Karlin and Altschul (Karlin and Altschul, Proc. Natl. Acad. Sci. USA 87:22264-2268, 1990), modified as in Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5877, 1993, is incorporated into the NBLAST and XBLAST programs of Altschul et al. (Altschul, et al., J. Mol. Biol. 215:403-410, 1990). To obtain gapped alignments for comparison purposes, Gapped BLAST is utilized as described in Altschul et al. (Altschul et al., Nucleic Acids Res. 25: 3389-3402, 1997). When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs may be used. PAM250 or BLOSUM62 matrices may be used.Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI). For these programs, see URL: ncbi.nlm.nih.gov See the website at http: / / www.ncbi.nlm.nih.gov / . In a specific embodiment, the percent identity or homology is calculated using BLAST2 with the default parameters as provided by NCBI.

[0021] The term "homolog" is intended to mean a nucleic acid sequence that has close sequence identity to the nucleic acid sequence of a described gene, where both nucleic acid sequences are determined to be derived from the same ancestral gene, such as through speciation, either through phylogenetic analysis or statistical analysis of alignment between sequences. When determining that two nucleic acid sequences are homologous through statistical analysis of alignment between sequences, widely known and online available tools (e.g., BLAST) can be utilized to make this determination. For purposes of this definition, a 1×10 -2 The alignment in BLAST that shows a lower expectation value (E value) is considered sufficient to determine that both nucleic acids are derived from the same ancestral gene. The term "homolog" can also be used to identify two amino acid sequences that have close sequence homology and / or function and are similarly determined to be encoded and derived from the same ancestral gene. "Ortholog" is defined similarly to "homolog", with the difference being that nucleic acid sequences that have close sequence identity to the nucleic acid sequence of the described gene are both determined to be derived from the same ancestral gene through speciation.

[0022] The term "exogenous" is intended to mean that the referenced molecule or activity is introduced into the cell. The molecule may be introduced, for example, by introducing an encoding nucleic acid into the host genetic material (e.g., by integration into a host chromosome or as non-chromosomal genetic material (e.g., a plasmid)). Thus, when used with reference to expression of an encoding nucleic acid, the term refers to the introduction of the encoding nucleic acid in an expressible form into the cell. When used with reference to a biosynthetic activity, the term refers to an activity that is introduced into the host. The source may be, for example, a homologous or heterologous encoding nucleic acid that expresses the referenced activity after introduction into the cell. Thus, the term "endogenous" refers to a referenced molecule or activity that is present in the cell. Similarly, when used with reference to expression of an encoding nucleic acid, the term refers to expression of an encoding nucleic acid contained within a microorganism. The term "heterologous" refers to a molecule or activity that is derived from a source other than the referenced species, whereas "homologous" refers to a molecule or activity that is derived from the host microorganism. Thus, exogenous expression of an encoding nucleic acid can utilize expression of either or both a heterologous or homologous encoding nucleic acid.

[0023] The terms "decrease", "reduced", "reduction", "decrease" and "inhibit" are all used herein to generally mean a statistically significant amount of reduction. However, for the avoidance of doubt, "reduced", "reduction" or "reduce" or "inhibit" means at least a 10% reduction when compared to a reference level, for example, at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% reduction, or up to and including a 100% reduction (i.e., a level of non-existence when compared to a reference sample), or any reduction between 10-100% when compared to a reference level.

[0024] The terms "increased," "increase," "enhance," or "activate" are all used herein to generally mean an increase by a statistically significant amount; for the avoidance of any doubt, the terms "increased," "increase," "enhance," or "activate" mean an increase of at least 10% compared to a reference level, for example, at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% increase, or up to and including a 100% increase, or any increase between 10-100% compared to a reference level, or at least about 2-fold, or at least about 3-fold, or at least about 4-fold, or at least about 5-fold, or at least about 10-fold increase, or any increase between 2-fold and 10-fold or more than 10-fold compared to a reference level.

[0025] The term "statistically significant" or "significantly" refers to statistical significance and generally means that the concentration of the marker is less than or equal to 2 standard deviations (2SD) below normal. The term refers to statistical evidence that a difference exists. It is defined as the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true. The decision is often made using a p-value.

[0026] Cells expressing terminal cannabinoid synthase

[0027] Some aspects of the disclosure relate to cells expressing an exogenous terminal cannabinoid synthase and one or more chaperones.

[0028] The cell is not limited and can be any suitable cell. In some embodiments, the cell is a bacteria, algae, yeast, or plant cell. In some embodiments, the yeast is an oleaginous yeast (e.g., a Yarrowia lipolytica strain). In some embodiments, the bacteria is Escherichia coli.

[0029] Suitable cells may include, but are not limited to, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha (now known as Pichia angusta), Kluyveromyces sp., Kluyveromyces lactis, Kluyveromyces marxianus, Schizosaccharomyces pompe, Dekkera bruxellensis, Arxula adeninivorans, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Neurospora crassa, Chlamydomonas reinhardtii, Yarrowia lipolytica, etc. In some embodiments, the cell is a protease-deficient strain of Saccharomyces cerevisiae. In some embodiments, the cell is a eukaryotic cell other than a plant cell. In some embodiments, the cell is a plant cell. In some embodiments, the cell is a plant cell, where the plant cell does not normally produce cannabinoids, cannabinoid derivatives or analogs, cannabinoid precursors, or cannabinoid precursor derivatives or analogs.In some embodiments, the cell is Saccharomyces cerevisiae. In some embodiments, the cells disclosed herein are cultured in vitro.

[0030] In some embodiments, the cell is a prokaryotic cell. Suitable prokaryotic cells may include, but are not limited to, any of a variety of laboratory strains such as Escherichia coli, Lactobacillus sp., Salmonella sp., Shigella sp., etc. See, for example, Carrier et al. (1992) J. Immunol. 148:1176-1181; U.S. Patent No. 6,447,784; and Sizemore et al. (1995) Science 270:299-302. Examples of Salmonella strains that may be used may include, but are not limited to, Salmonella typhi and S. typhimurium. Suitable Shigella strains may include, but are not limited to, Shigella flexneri, Shigella sonnei, and Shigella disenteriae. Typically, the laboratory strains are non-pathogenic. Other suitable non-limiting examples of bacteria may include, but are not limited to, Bacillus subtilis, Pseudomonas putida, Pseudomonas aeruginosa, Pseudomonas mevalonii, Rhodobacter sphaeroides, Rhodobacter capsulatus, Rhodospirillum rubrum, Rhodococcus sp., and the like.

[0031] Said terminal cannabinoid synthase is not limited and can be any suitable terminal cannabinoid synthase or its functional fragment or derivative.As used herein, terminal cannabinoid synthase is a flavin adenine dinucleotide (FAD)-dependent berberine crosslinking enzyme that catalyzes the oxidative cyclization of the monoterpene moiety in CBGA.

[0032] In some embodiments, the exogenous terminal cannabinoid synthase is selected from BBE1.6, BBE1.20, BBE1.21, BBE1.22, BBE2.1, BBE2.6, BBE2.7, BBE2.8, BBE2.16, BBE2.18, BBE2.19, BBE2.20, BBE2.21, BBE2.22, BBE3.1, BBE2.14, BBE25.1, BBE25.4, and BBE25.5, each having an amino acid sequence corresponding to SEQ ID NO: 118, 19, 119, 120, 20, 25-27, 121-126, 34, 33, 59, 62, or 63, or a functional fragment or derivative thereof having at least 70% sequence identity. In some embodiments, the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof is selected from the group consisting of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 109, 109, 109, 100, 101, 102, 103, 10 9, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, or 126. In some embodiments, the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof has an amino acid sequence having at least 85%, 90%, 95%, 99%, or 99.9% identity to SEQ ID NO: 19, 20, 25, 26, 27, 32, 33, 59, 62, 63, 118, 119, 120, 121, 122, 123, 124, 125, or 126.

[0033] In some embodiments, the exogenous terminal cannabinoid synthase has at least one amino acid modification (e.g., insertion, deletion, or substitution) compared to the wild-type exogenous terminal cannabinoid synthase. The amino acid modification can be an amino acid substitution, an amino acid deletion, and / or an amino acid insertion. The amino acid substitution can be a conservative amino acid substitution or a non-conservative amino acid substitution. A conservative substitution (also referred to as a conservative mutation, conservative substitution, or conservative variation) is an amino acid replacement in a protein that changes a given amino acid to a different amino acid with similar biological properties (e.g., charge, hydrophobicity, and size). As used herein, "conservative variation" refers to the replacement of an amino acid residue with another biologically similar residue. Examples of conservative variations include the substitution of one hydrophobic residue (e.g., isoleucine, valine, leucine, or methionine) for another; or the substitution of one polar residue for another (e.g., substitution of arginine with lysine, glutamic acid with aspartic acid, or glutamic acid with asparagine, etc.). Other illustrative examples of conservative substitutions include changes such as alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartic acid to glutamic acid; cysteine ​​to serine; glutamine to asparagine; glutamic acid to aspartic acid; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine, glutamine, or glutamic acid; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine, or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; valine to isoleucine or leucine.

[0034] In some embodiments, the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof has improved solubility, stability, turnover, selectivity, K, or β-terminal domain activity compared to a wild-type terminal cannabinoid synthase. m , or K cat In some embodiments, the solubility of the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof is at least about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 5-fold, or 10-fold greater than the solubility of the wild-type terminal cannabinoid synthase. In some embodiments, the stability of the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof is at least about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 5-fold, or 10-fold greater than the stability of the wild-type terminal cannabinoid synthase. In some embodiments, the turnover of the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof is at most about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 5-fold, or 10-fold lower than the turnover of the wild-type terminal cannabinoid synthase. In some embodiments, the selectivity of the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof is at least about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 5-fold, or 10-fold higher than the selectivity of the wild-type terminal cannabinoid synthase. In some embodiments, the K m is the K of wild-type terminal cannabinoid synthase mIn some embodiments, the K of the exogenous terminal cannabinoid synthase or a functional fragment or derivative thereof is at most about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.5-fold, 5-fold, or 10-fold. cat is the K of wild-type terminal cannabinoid synthase cat At least about 1.1 times, 1.2 times, 1.3 times, 1.4 times, 1.5 times, 1.6 times, 1.7 times, 1.8 times, 1.9 times, 2 times, 2.5 times, 5 times, or 10 times greater.

[0035] In some embodiments, the exogenous terminal cannabinoid synthase is preferentially expressed in a location selected from the cytoplasm, ER, Golgi, liposome, vacuole, cell or extracellular membrane, peroxisome, oleosome, and extracellular environment. In some embodiments, the preferential expression is accompanied by a synthetic, heterologous or natural signal peptide, retention sequence, leader peptide, or sorting sequence. In some embodiments, the exogenous terminal cannabinoid synthase is expressed with a signal peptide selected from SP3 (SEQ ID NO: 92), SP4 (SEQ ID NO: 92), SP7 (SEQ ID NO: 93), SP8 (SEQ ID NO: 95), or SP11 (SEQ ID NO: 96). For example, the exogenous endocannabinoids include SP3-BBE1.6, SP3-BBE1.20, SP3-BBE1.21, SP3-BBE1.22, SP3-BBE2.1, SP3-BBE2.6, SP3-BBE2.7, SP3-BBE2.8, SP3-BBE2.16, SP3-BBE2.18, SP3-BBE2.19, SP3-BBE2.20, SP3-BBE2.21, SP 3-BBE2.22, SP3-BBE3.1, SP3-BBE2.14, SP3-BBE25.1, SP3-BBE25.4, and SP3-BBE25.5, SP4-BBE1.6, SP4 -BBE1.20, SP4-BBE1.21, SP4-BBE1.22, SP4-BBE2.1, SP4BBE2.6, SP4-BBE2.7, SP4-BBE2.8, SP4-BBE2.16 , SP4-BBE2.18, SP4-BBE2.19, SP4-BBE2.20, SP4-BBE2.21, SP4-BBE2.22, SP4-BBE3.1, SP4-BBE2.14, SP4-BBE25.1, SP4-BBE25.4, and SP4-BBE25.5, SP7-BBE1.6, SP7-BBE1.20, SP7-BBE1.21, SP7-BBE1.22, SP7 -BBE2.1, SP7-BBE2.6, SP7-BBE2.7, SP7-BBE2.8, SP7-BBE2.16, SP7-BBE2.18, SP7-BBE2.19, SP7-BBE2.20, SP7-BBE2.21, SP7-BBE2.22, SP7-BBE3.1, SP7-BBE2.14, SP7-BBE25.1, SP7-BBE25.4, and SP7-BBE25.5, SP8-BBE1.6, SP8-BBE1.20, SP8-BBE1.21, SP8-BBE1.22, SP8-BBE2.1, SP8-BBE2.6, SP8-BBE2.7, SP8-BBE 2.8, SP8-BBE2.16, SP8-BBE2.18, SP8-BBE2.19, SP8-BBE2.20, SP8-BBE2.21, SP8-BBE2.22, SP8-BBE3.1, SP SP11-BBE2.14, SP8-BBE25.1, SP8-BBE25.4, and SP8-BBE25.5, SP11-BBE1.6, SP11-BBE1.20, SP11-BBE1.21, SP11-BBE1.22, SP11-BBE2.1, SP11-BBE2.6, SP11-BBE2.7, SP11-BBE2.8, SP11-BBE2.16, SP11-BBE2.18, SP11-BBE2.19, SP11-BBE2.20, SP11-BBE2.21, SP11-BBE2.22, SP11-BBE3.1, SP11-BBE2.14, SP11-BBE25.1, SP11-BBE25.4, and SP11-BBE25.5. .

[0036] In some embodiments, the exogenous terminal cannabinoid synthase is fused to CBGA synthase, secretory protein, or membrane localization sequence. In some embodiments, the cannabinoid synthase is fused to Lip2 (lipase 2, SEQ ID NO: 100), or CWP1 (cell wall protein 1, SEQ ID NO: 103), or 1,3-β-glucanosyltransferase (Uniprot Q6C8C9 or Q6CFU7). In some embodiments, the exogenous terminal cannabinoid synthase is fused to a polyhistidine tag at the n-terminus or c-terminus of the enzyme. In some other embodiments, the exogenous terminal cannabinoid synthase is not fused to a polyhistidine tag. For example, SEQ ID NOs: 19, 20, 25-27, 121-126, 34, 33, 59, 62 and 63, which correspond to the amino acid sequences of BBE1.20, BBE2.1, BBE2.6, BBE2.7, BBE2.8, BBE2.16, BBE2.18, BBE2.19, BBE2.20, BBE2.21, BBE2.22, BBE3.1, BBE2.14, BBE25.1, BBE25.4 and BBE25.5, respectively, contain a c-terminal his tag, although these same enzymes without the polyhis tag are also envisioned. The polyhistidine tag may contain 2 or more consecutive histidine residues, 2-8 consecutive histidine residues, or 2-6 consecutive histidine residues.

[0037] The term "chaperone" refers to a protein that assists in the folding of a protein or the assembly of a complex (e.g., a protein-containing complex), but typically does not otherwise contribute to the final structure or function of the product. In some embodiments, the cells also express HAC1 (YALI0B12716p), HAC1s (SEQ ID NO: 105), FADS1 (YALI0D25564p), FADS1a (SEQ ID NO: 104), KAR2 (YALI0E13706p), FMN1 (YALI0B01826p), CNE1 (YALI0B13156p), ERO1 (YALI0D09603p), PDI1 (YALI0E03036p), IRE (YALI0A14839p), YAP1 (YALI0B03762p), HYR1 (YALI0B03762p), HYR2 (YALI0B03762p), HYR3 (YALI0B03762p), HYR4 (YALI0B03762p), HYR5 (YALI0B03762p), HYR6 (YALI0B03762p), HYR7 (YALI0B03762p), HYR8 (YALI0B03762p), HYR9 (YALI0B03762p), HYR1 (YALI0B03762p), HYR2 ... In some embodiments, the cell overexpresses one or more chaperones selected from CsCHAP1 (XP_030509412.1 or SEQ ID NO: 85), CsCHAP2 (KAF4389684.1 or SEQ ID NO: 86), CsCHAP3 (KAF4346992.1 or SEQ ID NO: 87), CsDNAJ (XP_030510352.1), ClpB1 (XP_030489210.1), HSP90 (SRP155904_DN9237), or a functional fragment or derivative thereof. In some embodiments, the cell overexpresses HAC1 (YALI0B12716p) and / or CNE1 (YALI0B13156p), or a functional fragment or derivative thereof. In some embodiments, the chaperone is selected from SP3 (SEQ ID NO: 92), SP7 (SEQ ID NO: 94), SP8 (SEQ ID NO: 95), or SP-KAR2 (SEQ ID NO: 97), and is expressed together with a signal protein with or without an ER retention HDEL motif.

[0038] In some embodiments, the cell expresses or overexpresses one or more chaperones or homologs thereof involved in the covalent binding of FAD to terminal cannabinoid synthase. In some embodiments, the chaperone or homologs thereof is selected from CsCHAP1, CsCHAP2 CsCHAP3, CsDNAJ1, CsDNAJ2, CsCLB1.1, CsCLB1.2, CsCLB1.3, CsHSP70_1, CsHSP70_2, CsHSP70_3, CsHSP70_4, CsHSP70_5, and FADS. In some embodiments, the chaperone or homologs thereof is selected from the chaperones provided in Table 1 herein.

[0039] In some embodiments, the cell expresses or overexpresses one or more enzymes involved in FAD biosynthesis. In some embodiments, the cell expresses an exogenous FAD synthetase or FMN synthetase, or overexpresses a native FAD synthetase or FMN synthetase. In some embodiments, the exogenous FAD synthetase is Uniprot ID Q6C7T3 or FADS1 (YALI0D25564p) or FADS1a (SEQ ID NO: 104). In some embodiments, the FMN synthetase is Uniprot ID Q6CG11. In some embodiments, the one or more enzymes involved in FAD biosynthesis are FAD synthetase or FMN biosynthetic enzymes provided in Table 1 herein.

[0040] In some embodiments, YALI0B05654p / AXP1, XPR2 (P09230), YALI0E33363p / AXP1-like, YALI0E28875p / XPR2-like, YALI0F27071p / PEP4, YALI0A06435p / PRB1A, YALI0B16500p / PRB1B, YALI0E34331p, YALI0E29403p, YALI0E28875p, YALI0E26851p, YALI0E21868p, YALI0E13552p, YALI0E13233p, YALI0E05423p, YALI0E04829p, YALI0E02024p, YALI0F 26411p, YALI0F21615p, YALI0F20592p, YALI0F19734p, YALI0F17974p, YALI0F16005p, YALI0F13585p, YALI0F11033p, YALI0F10769p, YALI0F073 59p, YALI0F05940p, YALI0F01859p, YALI0F01540p, YALI0F00396p, YALI0F00176p, YALI0B20834p, YALI0B19228p, YALI0B17072p, YALI0B14641p, YALI0B13310p, YALI0B11594p, YALI0B10934p, YALI0B05522p, YALI0C10648p, YALI0C10494p, YALI0C09438p, YALI0C08283p, YALI0C05280p, YAL I0C02519p, YALI0C00165p, YALI0D04807p, YALI0D07920p, YALI0D10967p, YALI0D13046p, YALI0D15642p, YALI0D16335p, YALI0D18832p, YALI0D1 9910p, YALI0D22957p, YALI0D23309p, YALI0C21604p, YALI0B04158p, YALI0B02574p, YALI0B01386p, YALI0A13277p, YALI0A10615p, YALI0E1438 8p2, YALI0B03718p, YALI0B16500p, YALI0D10835p, YALI0F09163p, YALI0E22374p, YALI0C00803g, YALI0D02024p, YALI0F11803g, YALI0C20273p,The expression of one or more proteases selected from YALI0B14641g, YALI0F11803g, YALI0C20273g, YALI0C10923p, and homologs and orthologs thereof, in the cell is inhibited or inactivated. In some embodiments, the expression of YALI0F09163p, and / or homologs and / or orthologs thereof, in the cell is inhibited or inactivated. In some embodiments, the expression of the one or more proteases is inhibited by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or more compared to a reference level.

[0041] In some embodiments, the cells are modified to inactivate or reduce activity / expression of ROT2 glucosidase (YALI0B06600p). In some embodiments, expression or activity of ROT2 glucosidase is reduced by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or more compared to a reference level.

[0042] In some embodiments, the cells may be supplemented with either hexanoic acid or olivetolic acid to produce CBGA. In some embodiments, the cells may be supplemented with butanoic acid or divaleric acid (DVA) to produce CBGVA. In some embodiments, the cells may be supplemented with OA to produce CBDA, THCA, and / or CBCA. In some embodiments, the cells may be supplemented with DVA to produce CBDVA, THCVA, and / or CBCVA. In some embodiments, the cells may be supplemented with hexanoic acid to produce CBDA, THCA, and / or CBCA. In some embodiments, the cells may be supplemented with butyric acid to produce CBDVA, THCVA, and / or CBCVA.

[0043] In some embodiments, the cells have been engineered to enhance expression of the exogenous terminal cannabinoid synthase, wherein the engineering comprises one or more of: (1) improved import of the exogenous terminal cannabinoid synthase into the secretory pathway; (2) regulated unfolded protein response; (3) regulated disulfide bond formation activity; (4) regulated FAD biosynthetic activity; (5) regulated levels of FAD covalent attachment to enzymes; (6) regulated or modified N-linked glycosylation, vesicular trafficking, proteolysis, lipolysis, carbohydrate degradation, or heat shock proteins; (7) regulated reactive oxygen species pathway activity; and (8) regulated cellular protein sorting.

[0044] In some embodiments, the cells also express a prenyltransferase and can produce CBGA or CBGVA by prenylation of OA or DVA with GPP. In some embodiments, the prenyltransferase is a prenyltransferase provided in WO 2021 / 178976, published September 10, 2021, which is incorporated herein by reference.

[0045] Some aspects of the disclosure relate to the production of one or more cannabinoids using the cells disclosed herein. The cannabinoids, cannabinoid derivatives and cannabinoid analogs as described herein are not limited. In some embodiments, the cannabinoids may include, but are not limited to, the following: cannabichromene (CBC) type (e.g., cannabichromene acid), cannabigerol (CBG) type (e.g., cannabigerolic acid), cannabidiol (CBD) type (e.g., cannabidiolic acid), Δ 9 -trans-Tetrahydrocannabinol (Δ 9 -THC) type (e.g., Δ 9 -tetrahydrocannabinolic acid), Δ 8 -trans-Tetrahydrocannabinol (Δ 8-THC type, cannabicyclol (CBL) type, cannabielsoin (CBE) type, cannabinol (CBN) type, cannabinodiol (CBND) type, cannabiditriol (CBT) type, cannabigerolic acid (CBGA), cannabigerolic acid monomethyl ether (CBGAM), cannabigerol (CBG), cannabigerol monomethyl ether (CBGM), cannabigerovaric acid (CBGVA), cannabigerovarin (CBGV), cannabichromene acid (CBCA), cannabichromene (CBC), cannabichromevaric acid (cannabichromevarinic acid)(CBCVA), cannabichromevalin (CBCV), cannabidiolic acid (CBDA), cannabidiol (CBD), cannabidiol monomethyl ether (CBDM), cannabidiol-C4 (CBD-C4), cannabidivarinic acid (CBDVA), cannabidivarin (CBDV), cannabidiorcol (CBD-C1), Δ 9 -Tetrahydrocannabinolic acid A (THCA-A), Δ 9 -Tetrahydrocannabinolic acid B (THCA-B), Δ 9 -Tetrahydrocannabinol (THC), Δ 9 -Tetrahydrocannabinolic acid-C4 (THCA-C4), Δ 9 -Tetrahydrocannabinol-C4 (THC-C4), Δ 9 -Tetrahydrocannabivarinic acid (THCVA), Δ 9 -Tetrahydrocannabivarin (THCV), Δ 9 -Tetrahydrocannabiorcolic acid (THCA-C1), Δ 9 -Tetrahydrocannabidiol (THC-C1), Δ 7 -cis-iso-tetrahydrocannabidivarin, Δ 8 -Tetrahydrocannabinolic acid (Δ 8 -THCA), Δ 8 -Tetrahydrocannabinol (Δ 8-THC), cannabicyclolor acid (CBLA), cannabicyclol (CBL), cannabicyclovaline (CBLV), cannabielsoic acid A (CBEA-A), cannabielsoic acid B (CBEA-B), cannabielsoin (CBE), cannabielsoic acid, cannabicitranic acid acid), cannabinolic acid (CBNA), cannabinol (CBN), cannabinol methyl ether (CBNM), cannabinol-C4 (CBN-C4), cannabivarin (CBV), cannabinol-C2 (CNB-C2), cannabiolkol (CBN-C1), cannabinodiol (CBND), cannabinodivarin (CBVD), cannabidiol (CBT), 10-ethoxy-9-hydroxy-Δ-6a-tetrahydrocannabinol, 8,9-dihydroxyl-Δ-6a-tetrahydrocannabinol, cannabitriolvarin (CBT) VE), dehydrocannabifuran (DCBF), cannabifuran (CBF), cannabichromanone (CBCN), cannabicitran (CBT), 10-oxo-Δ-6a-tetrahydrocannabinol (OTHC), Δ-9-cis-tetrahydrocannabinol (cis-THC), 3,4,5,6-tetrahydro-7-hydroxy-α-α-2-trimethyl-9-n-propyl-2,6-methano-2H-1-benzoxine-5-methanol (OH-iso-HHCV), cannabilipsol (CBR), and trihydroxy-Δ-9-tetrahydrocannabinol (triOH-THC).

[0046] An expression vector or vectors can be constructed to contain an exogenous nucleotide sequence encoding a recombinant polypeptide described herein operably linked to an expression control sequence functional in the cell. Applicable expression vectors include, for example, plasmids, phage vectors, viral vectors, episomes and artificial chromosomes (including vectors and selection sequences or markers operable for stable integration into host chromosomes). In addition, the expression vectors can contain one or more selection marker genes and appropriate expression control sequences. For example, a selection marker gene that provides resistance to antibiotics or enzymes, complements auxotrophic deficiencies, or supplies important nutrients that are not in the culture medium can also be included. Expression control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, etc., well known in the art. When two or more exogenous coding nucleic acids are to be co-expressed, both nucleic acids can be inserted, for example, into a single expression vector or into separate expression vectors. For single vector expression, the coding nucleic acid may be operably linked to one common expression control sequence or may be linked to different expression control sequences (e.g., one inducible promoter and one constitutive promoter). The transformation of the exogenous nucleic acid sequence may be confirmed using methods well known in the art. Such methods include, for example, nucleic acid analysis such as Northern blot or polymerase chain reaction (PCR) amplification for mRNA, or immunoblotting for expression of gene products, or other suitable analysis methods for testing the expression of the introduced nucleic acid sequence or its corresponding gene product. It is understood by those skilled in the art that the exogenous nucleic acid is expressed in sufficient amounts to produce the desired product, and it is further understood that the expression level may be optimized to obtain sufficient expression using methods well known in the art and as disclosed herein.

[0047] In some embodiments, the cells described herein comprise one or more additional metabolic pathway transgenes. In some embodiments, the cells comprise an olivetolic acid pathway. In some embodiments, the olivetolic acid pathway comprises a polyketide cyclase. In some embodiments, the exogenous nucleotide encodes the polyketide cyclase. In some embodiments, the olivetolic acid pathway comprises a polyketide synthase / olivetol synthase (condensation of hexanoyl coenzyme A (CoA) and 3× malonyl CoA). In some embodiments, the cells comprise a geranyl pyrophosphate (GPP) pathway. In some embodiments, the GPP pathway comprises a geranyl pyrophosphate synthase. In some embodiments, the exogenous nucleotide encodes the geranyl pyrophosphate synthase. In some embodiments, the cells comprise a farnesyl pyrophosphate (FPP) pathway. In some embodiments, the FPP pathway comprises a farnesyl pyrophosphate synthase. In some embodiments, the farnesyl pyrophosphate synthase is in a mutant form. In some embodiments, the mutant farnesyl pyrophosphate synthase is described in Jian GZ, et al. Metabolic Engineering, 2017, 41, 57 (incorporated herein). In some embodiments, an exogenous nucleotide encodes the farnesyl pyrophosphate synthase. In some embodiments, the cell comprises a divaleric acid (DVA) pathway. In some embodiments, the DVA pathway comprises a divaleric acid synthase. In some embodiments, the exogenous nucleotide encodes the divaleric acid synthase. In some embodiments, the cell comprises a mevalonate pathway. In some embodiments, the cell expresses HMG-CoA reductase.In some embodiments, the endogenous mevalonate pathway of the cell has been engineered to reduce or increase the production of mevalonate, isopentyl pyrophosphate (IPP) or dimethylallyl pyrophosphate (DMAP), geranyl pyrophosphate (GPP) or farnesyl pyrophosphate (FPP). In some embodiments, the cell comprises a polyketide cyclase that produces OA, DVA, and / or derivatives thereof. In some embodiments, the cell comprises a polyketide synthase that produces a tetraketide substrate for the polyketide cyclase. In some embodiments, the cell comprises a polyketide synthase that can form OA and derivatives directly from acetyl-CoA or hexanoyl-CoA and malonyl-CoA. In some embodiments, the cell has an altered native GPP / FPP synthase that preferentially produces GPP compared to the native GPP / FPP synthase. Examples of modified native GPP / FPP synthases that preferentially produce GPP compared to native GPP / FPP synthases, and cells expressing them, are described in co-owned U.S. Provisional Patent Application No. 63 / 256,398, which is incorporated by reference in its entirety.

[0048] Some aspects of the disclosure are methods of producing CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or analogs thereof, comprising contacting a cell disclosed herein with a carbon source and, optionally, hexanoic acid or butyric acid under suitable conditions to produce CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or analogs thereof.

[0049] Depending on the cell, an appropriate culture medium may be used. For example, a description of various culture media may be found in the "Manual of Methods for General Bacteriology" (Washington DC, USA, 1981) of the American Society for Bacteriology. As used herein, "medium" in relation to a growth source refers to a starting medium in solid or liquid form. On the other hand, and as used herein, "cultured medium" refers to a medium (e.g., liquid medium) containing a microorganism that is grown fermentatively and may contain other cellular biomass. The medium generally contains one or more carbon sources, nitrogen sources, inorganic salts, vitamins and / or trace elements.

[0050] Exemplary carbon sources include sugar carbon, such as sucrose, glucose, galactose, fructose, mannose, isomaltose, xylose, panose, maltose, arabinose, cellobiose, and 3-, 4-, or 5-oligomers thereof. Other carbon sources include alcohol carbon sources (e.g., methanol, ethanol, glycerol). Other carbon sources include acids and esters (e.g., acetate, formate, fatty acids having 4-20 carbon atoms or fatty acid esters thereof). Other carbon sources may include renewable feedstocks and biomass. Exemplary renewable feedstocks include cellulosic biomass, hemicellulose biomass, and lignin feedstocks. Mixed carbon sources may also be used (e.g., fatty acids and sugars as described herein).

[0051] Culture conditions can include, for example, liquid culture procedures, as well as fermentation and other large-scale culture procedures. Useful yields of the above products can be obtained under aerobic culture conditions. Exemplary growth conditions for achieving one or more cannabinoid products include aerobic culture or fermentation conditions. In certain embodiments, the microorganism can be maintained, cultured or fermented under aerobic conditions.

[0052] Substantially aerobic conditions include, for example, cultures, batch fermentations, or continuous fermentations, in which the dissolved oxygen concentration in the medium remains between 5% and 100% saturation. The percentage of dissolved oxygen can be maintained, for example, by aeration with air, pure oxygen, or a mixture of air and oxygen.

[0053] The culture conditions can be expanded and grown continuously to produce cannabinoid products. Exemplary growth procedures include, for example, fed-batch fermentation and batch separation; fed-batch fermentation and continuous separation, or continuous fermentation and continuous separation. All of these processes are well known in the art. Fermentation procedures are particularly useful for the biosynthetic production of commercial quantities of cannabinoid products. In general, and with non-continuous culture procedures, continuous and / or near-continuous production of cannabinoid products involves culturing a cannabinoid-producing organism with sufficient nutrients and medium to maintain and / or nearly maintain growth in the exponential phase. Continuous culture under such conditions can include, for example, 1, 2, 3, 4, 5, 6 or 7 days, or longer days. Furthermore, continuous culture can include 1, 2, 3, 4 or 5 weeks, or longer weeks and up to several months. Alternatively, the desired microorganism can be cultured for several hours, if appropriate for a particular application. It should be understood that continuous and / or quasi-continuous culture conditions can also include all time intervals between these exemplary periods. It is further understood that the time for culturing the microorganism is for a period of time sufficient to produce a sufficient amount of product for a desired purpose.

[0054] Fermentation procedures are well known in the art. Briefly, fermentation for the biosynthetic production of cannabinoid products can be utilized in, for example, fed-batch fermentation and batch separation; fed-batch fermentation and continuous separation, or continuous fermentation and continuous separation. Examples of batch and continuous fermentation procedures are well known in the art.

[0055] In some embodiments, the method further comprises purifying or isolating the cannabinoid, its derivative or analogue from the culture.Isolation method is not limited and can be any suitable method known in the art.Purification method includes, for example, extraction procedure, and method including continuous liquid-liquid extraction, pervaporation, evaporation, filtration, membrane filtration (including reverse osmosis, nanofiltration, ultrafiltration and microfiltration), membrane filtration with dialysis, membrane separation, reverse osmosis, electrodialysis, distillation, extractive distillation, reactive distillation, azeotropic distillation, crystallization and recrystallization, centrifugation, extractive filtration, ion exchange chromatography, size exclusion chromatography, adsorption chromatography, carbon adsorption, hydrogenation, and ultrafiltration or countercurrent centrifugal chromatography (CPC).

[0056] In some embodiments, the cells are grown in a stirred tank fermenter supplemented with feedstock (sugar with or without organic acids) where dissolved oxygen, temperature, and pH are controlled according to optimal growth and production processes. In some embodiments, aqueous immiscible organic solvents are supplemented to dissolve added organic acids or to extract the cannabinoid products as they are synthesized. In some embodiments, these solvents include, but are not limited to, isopropyl myristate (IPM), diisobutyl adipate, decane, dodecane, hexadecane, or another organic solvent with a logP>5. The latter number (logP) is defined as the logarithm of the partition of a compound between water and octanol and is a standard parameter of a compound's hydrophobicity (the higher the logP, the less soluble it is in water). Depending on the fermentation process, the products can be isolated and purified using different methods.

[0057] If no organic co-solvent is used and the target cannabinoids are secreted into the culture supernatant, different methods may be applied. In one embodiment, an aqueous miscible organic solvent (ethanol, acetonitrile, etc.) is added to dissolve the product. In some embodiments, the cells may be removed by simple filtration, ultrafiltration or centrifugation, and the aqueous medium is evaporated to dryness or to a small volume from which the cannabinoid product precipitates or crystallizes. Alternatively, the cell supernatant may be extracted with an aqueous immiscible organic solvent (ethyl acetate, heptane, butyl acetate, propyl acetate, methyl isobutyl ketone, etc.) to extract the cannabinoids. Evaporation of the organic solvent and possible recrystallization produces pure cannabinoids. If the cannabinoid products are not secreted into the medium but are captured inside the cells, different methods for their extraction and purification may be utilized. In some embodiments, cells are disrupted using mechanical methods or by suspension in an appropriate lysis buffer, from which the cannabinoids can be extracted with an organic, aqueous immiscible solvent (ethyl acetate, hexane, decane, methylene chloride, etc.). In other embodiments, cells can be suspended in an organic solvent (ethanol, methanol, methylene chloride, etc.) which extracts the cannabinoids from the cells.

[0058] In some embodiments, an organic solvent is required during growth, which is separated at the end of fermentation. Back-extraction with a basic aqueous solvent or a different organic solvent with a low boiling point and high polarity (ethanol, acetonitrile, etc.) removes the cannabinoids. Isolation can then involve a simple pH shift if water is used, or evaporation if an organic solvent is used. In both cases, a final recrystallization step may be required to improve the purity of the product.

[0059] Specific examples of certain aspects of the invention disclosed herein are set forth below in the Examples.

[0060] Those skilled in the art will readily appreciate that the present invention is fully adapted to carry out the objects and obtain the objects and advantages mentioned, as well as those inherent therein. The detailed description and examples herein are representative and illustrative of certain embodiments, and are not intended as limitations on the scope of the present invention. Modifications therein and other uses will occur to those skilled in the art. These modifications are encompassed within the spirit of the present invention. It will be readily apparent to those skilled in the art that various substitutions and modifications can be made to the invention disclosed herein without departing from the scope and spirit of the invention.

[0061] The articles "a" and "an" as used in the specification and claims should be understood to include plural references unless clearly indicated to the contrary. A claim or description including "or" between one or more members of a group is considered to be satisfied if one, more than one, or all of the members of the group are present in, used in, or otherwise relevant to a given product or process, unless indicated to the contrary or otherwise clear from the context. The invention includes embodiments in which exactly one member of the group is present in, used in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one, or all of the members of the group are present in, used in, or otherwise relevant to a given product or process. Furthermore, it should be understood that the present invention provides all variations, combinations, and permutations of one or more limitations, elements, clauses, descriptive terms, etc. from one or more of the enumerated claims that are introduced into another claim that is dependent on the same base claim (or any other claim, if relevant), unless otherwise indicated or unless a contradiction or inconsistency would arise to one of ordinary skill in the art. It is contemplated that all embodiments described herein are applicable to all different aspects of the invention, where appropriate. It is also contemplated that any of the above embodiments or aspects may be freely combined with one or more other such embodiments or aspects, where appropriate. When elements are presented as a list, for example, in a Markush group or similar format, it should be understood that each subgroup of elements is also disclosed and any element may be removed from the group. In general, when the invention or aspects of the invention are referred to as including certain elements, features, etc., it should be understood that a particular embodiment of the invention or aspect of the invention consists of or consists essentially of such elements, features, etc. For the sake of simplicity, those embodiments have not in every instance been specifically set forth in too much language herein.It should also be understood that any embodiment or aspect of the invention may be explicitly excluded from the claims, regardless of whether the specific exclusion is set forth herein. For example, any one or more nucleic acids, polypeptides, cells, species or types of organisms, disorders, subjects, or combinations thereof may be excluded.

[0062] Where a claim or description is directed to a composition of matter (e.g., a nucleic acid, a polypeptide, or a cell), it should be understood that methods of making or using the composition according to any of the methods disclosed herein, as well as methods of using the composition for any of the purposes disclosed herein, are aspects of the invention unless otherwise indicated or it would be obvious to one of ordinary skill in the art that a contradiction or inconsistency would arise. Where a claim or description is directed to, for example, a method, it should be understood that methods of making compositions useful for carrying out said method, as well as products produced according to said method, are aspects of the invention unless otherwise indicated or it would be obvious to one of ordinary skill in the art that a contradiction or inconsistency would arise.

[0063] When a range is stated herein, the invention includes embodiments in which both endpoints are included, in which both endpoints are excluded, and in which one endpoint is included and the other is excluded. Unless otherwise indicated, it should be assumed that both endpoints are included. Furthermore, unless otherwise indicated or otherwise clear from the context and the understanding of one of ordinary skill in the art, it should be understood that values ​​expressed as ranges may assume any specific value or subrange within the stated range, up to 1 / 10 of the unit of the lower limit of said range, in different embodiments of the invention, unless the context clearly indicates otherwise. When a series of numerical ranges is stated herein, it is also understood that the invention includes embodiments that are similarly related to the range defined by any intervening value or any two values ​​in that series, and that the lowest value may be taken as the minimum and the highest value may be taken as the maximum. Many values, as used herein, include values ​​expressed as percentages. For any embodiment of the invention in which a numerical value is preceded by "about" or "approximately," the invention includes embodiments in which that exact value is stated. For any embodiment of the invention where a numerical value is not preceded by "about" or "approximately," the invention includes embodiments where the value is preceded by "about." "Approximately" or "about" generally includes numbers that fall within 1%, or in some embodiments within 5% of the number, or in some embodiments within 10% in either direction (greater or less than the number), unless otherwise stated or otherwise clear from the context (except where such number would unacceptably exceed 100% of the possible value). Unless clearly indicated to the contrary, in any method claimed herein that includes more than one act, the order of the acts of the method is not necessarily limited to the order in which the acts of the method are described, but it should be understood that the invention encompasses embodiments in which the order is so limited. It should also be understood that any product or composition described herein may be considered to be "isolated," unless otherwise stated or otherwise clear from the context. EXAMPLES

[0064] Working Example Introduction

[0065] Terminal synthases (CBDAS, THCAS, and CBCAS) convert CBGA and its analogs to the end products, CBDA, THCA, and CBCA and analogs (Figure 1). These synthases from Cannabis plants are highly homologous (>70% sequence identity), contain two covalently bound FADs (6-S-cysteinyl, 8α-N1-histidyl FAD bonds), and belong to the berberine bridging enzyme (BBE)-like family, as determined when the crystal structure of THCAS was solved (Shoyama Y, et al. J. Mol Biol 2012, 423, 96-105; [PDB: 3VTE]). In addition to Cannabis, BBE-like enzymes from other sources, including other eukaryotes or prokaryotes, are described herein.

[0066] So far, recombinant expression of these enzymes in yeast (Saccharomyces or Pichia) has been problematic and requires significant modification / upregulation of certain chaperones of the ER / secretion and FAD biosynthesis pathways (Zirpel B, et al. J. Biotechnol 2018, 40-47). Extensive mutagenesis of CBDA and THCA synthase genes showed only modest improvements in the activity and corresponding titers of cannabinoids when expressed in yeast (WO2020236789).

[0067] Thus, available information suggests that expression of terminal synthases is problematic in microorganisms. Applicant notes that expression may require accessory proteins and conditions present in Cannabis plants, such as (1) folding and stabilizing chaperones, and (2) adequate / increased amounts of intracellular FAD (Table 1).

[0068] Approximately 10% of known FAD-containing enzymes have this cofactor covalently bound to one amino acid of the protein. Enzymes with two covalent bonds are very few, as is the case with the synthase from Cannabis (Starbird, CA et al. eLS John Wiley & Sons, Ltd 2015 DOI: 10.1002 / 9780470015902.a0026073). Due to this peculiarity, Cannabis terminal synthase may require specific chaperones present in Cannabis plants. These chaperones may play a role in stabilizing the conformation of the protein during or after protein folding that allows FAD binding. They may also play an active role in catalyzing covalent FAD binding. Chaperones involved in the covalent binding of FAD have been identified in the flavinylation of succinate dehydrogenase. These are small enzymes (~10KDa) present in all species (bacteria, yeast and mammals) that have been shown to facilitate the covalent attachment of the 8a-methyl of FAD to the active site histidine (McNeil MB, Fineran PC Biochemistry 2013, 52(43), 7628-7640).

[0069] To identify similar sequences or related chaperones that may aid in FAD binding to terminal synthase in Cannabis, the proteomes and transcriptomes of various Cannabis cultivars were searched with a focus on proteins expressed in trichomes. From this approach, several chaperones co-expressed with terminal synthase were identified.

[0070] These enzymes contain homologs to chaperones that aid in FAD binding to succinate dehydrogenase (CsCHAP1, CsCHAP2 CsCHAP3). Other related chaperones from Cannabis include CsDNAJ1, CsDNAJ2, CsCLB1.1, CsCLB1.2, CsCLB1.3, CsHSP70_1, CsHSP70_2, CsHSP70_3, CsHSP70_4 and CsHSP70_5 and FADS. The equivalent enzymes from Yarrowia are also overexpressed (Table 1).

[0071] Functional expression of terminal synthases may require or be improved through manipulation of the secretory pathway of the host organism. There are many proteins and enzymes in the secretory pathway that can be targets for enzyme manipulation, altered gene expression (up- or down-regulation), functional inactivation, and / or heterologous gene expression. These target enzymes may be involved in, but are not limited to, import of CBDAS into the secretory pathway, endoplasmic reticulum stress response, disulfide bond formation, FAD biosynthesis and covalent attachment to enzymes, N-linked glycosylation / modification, vesicular trafficking, proteolysis, lipid degradation, carbohydrate degradation, protein folding chaperones, heat shock proteins, reactive oxygen species pathway (ROS signaling up-regulation / down-regulation), cellular protein sorting, etc. A list of these enzymes is shown in Table 1.

[0072] Furthermore, terminal synthases can be targeted to different locations in the host cell, including the cytoplasm, ER, Golgi, liposomes, vacuoles, plasma membranes, peroxisomes, or the extracellular environment. Targeting can be achieved by adding signal peptides, retention or sorting sequences that can be native to a wide range of hosts, heterologous to the host, and / or synthetic and / or engineered sequences.

[0073] Table 1: Enzymes targeted for expression [Table 1-1] [Table 1-2] *CsCHAP1 and CsCHAP2 are expressed using four different signal peptides (SP3, SP7, SP8, SP-KAR2) and ±HDEL motifs.

[0074] Table 2: Inactivated proteases [Table 2]

[0075] In addition to up-regulating or down-regulating native chaperones or expressing chaperones from yeast, the amino acid sequences of CBDA, THCA and CBCA synthases are also modified. Many isozymes of each of these enzymes are present in sequenced Cannabis plants, and various of these enzymes are tested for expression in modified strains. In addition, BBE family enzymes with potential CBGA cyclization activity from plants, fungi and microorganisms were identified using various bioinformatics and AI techniques. The list of synthases to be tested includes, but is not limited to, the enzymes in the BBE family described herein (BBE1.1-BBE58; SEQ ID NOs: 1-84 and SEQ ID NOs: 106-126).

[0076] Mutagenesis of these enzymes at selected positions (at the protein surface, adding / removing glycosylation sites, adding disulfide bonds, active sites, etc.) has also been shown to improve the physical (solubility, stability) and catalytic (turnover, K m , K cat ) characteristics.

[0077] Various methods have been employed to increase activity or improve targeting of synthases. In one approach, the enzymes were fused with various lead sequences that target proteins to specific compartments of the cell (peroxisomes, oleosomes, etc.), cell membranes, or extracellular space or medium. Secondly, the synthases were fused with various proteins (e.g., CBGA synthase) to increase activity by substrate (CBGA) channeling, or with proteins that can target the enzymes in various compartments (e.g., extracellular membranes) or secrete them into the supernatant.

[0078] Example 1: Expression of THCAS in YL and synthesis of THCA from hexanoic acid or OA feeding

[0079] Plasmids pCL-SE-0696 and pCL-SE-0703 to -0706 express BBE2.1 with various signal peptides. These plasmids were linearized with DraI and then transformed into the SB-691 strain, and multiple clones were screened for THCA production. SB-691 was engineered to produce CBGA by supplementation with either hexanoic acid or olivetolic acid.

[0080] THCA formation from hexanoic acid feed

[0081] Patched colonies were used to inoculate 0.5 mL of YPD (20 g / L peptone, 10 g / L yeast extract, 20 g / L glucose) medium in a 96 dw block, which was grown at 30° C. with shaking at 1000 rpm. After 48 h, 5 μL from each preculture was used to inoculate 0.5 mL of YPD medium with 100 mM MES (pH 5.5) and 2.5 mM hexanoic acid in a 96 deep-well plate (2 mL), which was grown at 30° C. with shaking at 1000 rpm. Cultures were further supplemented with 2% glucose and 5 mM hexanoic acid three times by adding 20 μL of 50% glucose and 12 mM hexanoic acid at 24, 48, and 72 h. After another 24 hours (total 96 hours), the cultures were quenched with 0.5 mL ethanol and 0.1% formic acid and 0.1 mg / mL pentyl-benzoic acid and submitted for LC analysis. Table 3 lists the highest concentration of THCA produced among the various transformants screened for each strain.

[0082] Table 3: THCA formation from hexanoic acid feed. Accumulated product (in μM) in in vitro assay. [Table 3-1] [Table 3-2] (1) Detailed descriptions of these enzymes and constructs are described in commonly owned U.S. Provisional Patent Application No. 63 / 188,645, filed May 14, 2021, or commonly owned U.S. Provisional Patent Application No. 63 / 188,648, filed May 14, 2021, both of which are incorporated by reference in their entireties.

[0083] THCA and THCVA formation from OA and DVA feed, respectively

[0084] A patched colony of a strain with the entire cannabinoid biosynthetic pathway, including the terminal synthases described herein that produce the final cannabinoids (e.g., THCA and THCVA), was used to inoculate a culture containing 0.5 mL of YPD medium (2% glucose) in a sterile 96 deep-well (DW) plate. The inoculated culture in the 96DW plate was then sealed with a breathable sterile seal and placed in a high-speed shaker set at 30° C. and a shaking speed of 1000 rpm. The preculture was grown under the same conditions for 48 hours, and 20 μL from each well was used as an inoculum for another plate containing 0.5 mL of YPD (2%) + 100 mM MES pH=5.5 + 250 mg / L thiamine + 0.1 M betaine glycine + 5 μL of protease inhibitor cocktail, and olivetolic acid (OA) or divaleric acid (DVA) at a final concentration of 3 mM. The plates were then placed on a high-speed shaker set at 30° C. and a shaking speed of 1000 rpm. The reaction with OA was terminated at t=48 hours by quenching with 0.5 mL of the following quench buffer: 0.1% formic acid and 0.1 mg / mL pentyl-benzoic acid in ethanol, and then subsequently submitted for LC / MS analysis. The reaction with DVA was quenched at t=96 hours. Clonal variation from random genomic integration was evaluated for each of the related SBs, SPX.BBEX.X. The following results represent the top clones from OA and DVA feeding. Table 4 lists the highest concentration of either THCA or THCVA produced among the various transformants screened for each strain fed with either OA or DVA.

[0085] Table 4: THCA formation from OA and / or DVA feeding. Accumulated product (in μM) in the in vivo assay. [Table 4]

[0086] Example 2: Resting cell assay with OA or CBGA feeding and different pH

[0087] Colonies from the patched plates of SB824 strain were grown in shake flasks (40 mL) containing YPD. After 48 hours of growth at 30° C., 0.5 mL of cell culture was added to a 96-well plate. The cells were pelleted by centrifugation (4,000 rpm for 5 minutes) and the supernatant was decanted. The cell pellet was then resuspended in fresh YPD medium containing 6% glucose and various buffer systems: 100 mM phthalate (Phth) at pH 4.5 or 5.5, or MES at pH 5.5 or 6.5. The cells at these various pHs were then mixed with either 3 mM OA or 3 mM CBGA. The cells were inoculated in a high-speed shaker at 30° C. for 3 days. The THCA and CBCA produced are shown in Table 5.

[0088] Table 5: THCA and CBCA formation from SB824 strain at various pH and OA or CBGA feeding. [Table 5]

[0089] When cells were fed OA, they rapidly accumulated CBGA (results not shown) because this strain also contains CBGA synthase. As seen in Table 5, the pH of the medium had a large effect on both THCA titer and the formation of the CBCA by-product, with pH=5.5 being the best. These results are consistent with literature reports of purified THAS, whose activity was reduced at pH above 6 and was accompanied by the formation of CBCA. The results also indicate that THCAS is either secreted into the supernatant or trapped in the extracellular membrane or periplasmic space, and as a result, its activity is affected by the extracellular pH; if the enzyme is intracellular, both its activity and selectivity would be unaffected at various pHs.

[0090] Example 3: Expression of THCAS in YL and synthesis of THCVA from butyric acid feeding

[0091] The patched colonies were used to inoculate 0.5 mL of YPD medium in a 96 DW block, which was grown in a high speed shaker at 30° C. with the shaking speed set at 1000 rpm. After 48 hours, 20 μL from each preculture was used to inoculate another 96 DW plate pre-loaded with 0.5 mL of YPD medium (2% glucose) with 100 mM MES pH 5.5 + 2.5 mM butyric acid, which was then grown at 30° C. with the shaking speed set at 1000 rpm.

[0092] Cultures were further supplemented with 2% glucose and 5 mM butyric acid three times (after 24 h, 48 h, and 72 h) by adding 20 μl to each well from a stock solution containing 50% glucose and 125 mM butyric acid. 96 h after inoculation, cultures were quenched with 0.5 mL of ethanol with 0.1% formic acid and 0.1 mg / mL pentyl-benzoic acid and submitted for LC / MS analysis. Table 6 lists the highest concentration of THCVA produced among the various transformants screened for each strain using this butyric acid feeding regimen.

[0093] Table 6: THCA formation from butyrate feeding (C4-FFA). Accumulated product (in μM) in in vivo assay. [Table 6] a Total THCVA produced after 96 hours with repeated feeding of 5 mM butyrate with 2% glucose every 24 hours for 3 days (and an initial starting butyrate concentration of 2.5 mM (total 17.5 mM butyrate)).

[0094] Example 4: Expression of THCAS in YL and synthesis of THCVA from butyric acid or DVA feeding

[0095] In this example, THCAS was fused to a protein naturally secreted in Yarrowia, lipase 2 (Lip2; SEQ ID NO: 100), or a protein bound to the outer membrane of the cell, cell wall protein CWP1 (SEQ ID NO: 103). The constructs were cloned into plasmids (Table 7) and tested for THCA formation. Plasmids pCL-SE-0772 and -0797 were linearized with AsiSI and PsilI. Plasmid pCL-SE-0801 was linearized with DraI. The linearized plasmids were transformed into SB-889 strains capable of converting supplemented OA to CBGA, as described in Example 1. Multiple clones per transformation were pre-cultured for 24 hours in 500 μl YPD inoculated into 96 deep-well plates shaking at >900 RPM at 30°C. 2 μl of the above preculture was used to inoculate 500 μl YPD supplemented with 100 mM MES pH 5.5 and 2 mM OA in YPD and incubated in a 96 deep well plate shaking at >900 RPM at 30° C. After 72 hours, the cultures were quenched and THCA was assessed. The results are shown in the table below.

[0096] Table 7: THCA formation from OA feeding using fused or unfused THCAS. Accumulated product (in μM) in in vivo assay. [Table 7] (1) This strain is described in more detail in commonly owned U.S. Provisional Patent Application No. 63 / 256,398, which is incorporated by reference in its entirety.

[0097] The results clearly show that both fusions produced active THCA synthase, although THCA titer was not increased. Further improvement of expression of these constructs by optimizing the host cells, THCAS sequence and linker sequence described herein further improves THCA titer.

[0098] Example 5: Engineering Yarrrowia: Protease knockout

[0099] To test one of the proteases of interest, YALI0F09163p, the gene encoding this protease was disrupted in an A28 CBGA producing strain, SB-1691, to generate SB-2702. The construction of SB-1691, and other A28 strains, is described in more detail in commonly owned U.S. Provisional Patent Application No. 63 / 256,398, which is incorporated by reference in its entirety. A plasmid expressing THCAS using the SP4 signal peptide, pCL-SE-0849, was transformed into each strain, and THCA production was tested using a hexanoic acid feeding assay. The patched colonies were used to inoculate 0.5 mL of YDCM001 (YNB+nitrogen 6.71 g / L, glucose 20 g / L, casamino acids 10 g / L, 100 mM MES (pH 6.5)) medium in a 96 dw block, which was grown at 30° C. with shaking at 1000 rpm. After 24 hours, 2 μl from each preculture was used to inoculate 0.5 mL of YDCM001 medium. After another 24 hours, 15 μl of 100 mM hexanoic acid was added and the cultures were incubated for another 24 hours at 30° C. with shaking at 1000 rpm. The cultures were then quenched with 0.5 mL of ethanol with 0.1 mg / mL pentyl-benzoic acid and submitted for LC analysis. Table 8 lists the concentrations of THCA produced in the various transformants. As can be seen, the YALI0F09163 disrupted strain (SB-2702) was able to produce more THCA than the control (SB-1961).

[0100] Table 8. THCA formation from hexanoic acid feeding in YALI0F09163 disrupted strains. Accumulated product (in μM) in in vivo assay. [Table 8] (1) The construction of this strain is described in detail in commonly owned U.S. Provisional Patent Application No. 63 / 256,398, which is incorporated by reference in its entirety.

[0101] Additional proteases of interest (Table 2) are inactivated in SB-1691 (a strain that produces CBGA from hexanoic acid). These modified strains are transformed with a construct (pCL-SE-0849) that expresses THCAS using the SP4 signal peptide. As a control, SB-1691 is also transformed with the same construct. THCA production is tested as described above.

[0102] Example 6: Engineering of Yarrowia: Expression of chaperones

[0103] SB1008, a strain expressing HCS2, PKS1, PKC1.1, HMGR, ERG20ww, ERG20ww-PKC1.1-MPT4, and THCAS using the SP4 signal peptide, is transformed with various vectors expressing chaperones (Table 9). Transformants were tested for THCA production as described in Example 4, with the modification of adding 1 g / L hygromycin to the medium. The results are shown in Figure 8A. Of the first list of chaperones, IRE overexpression resulted in no growth, while HAC1s resulted in slow growth. To test HAC1s, this gene was expressed with a weaker promoter that allowed growth consistent with the parent strain. The HAC1s transformants were tested for THCA production as described above, but the medium used was adjusted to pH 6.0. The results are shown in Figure 8B. Of all the chaperones tested, overexpression of CNE1, FADS, and HAC1s provided the most robust improvement in THCA production.

[0104] Table 9: THCA formation from OA feeding in THCA-producing strains overexpressing chaperones and other accessory proteins and regulators. Accumulated product (in μM) in in vivo assays. [Table 9]

[0105] Table 10: THCA formation from OA feeding in THCA-producing strains overexpressing chaperones. Accumulated product (in μM) in in vivo assay. [Table 10-1] [Table 10-2]

[0106] Example 7: Yarrowia Modification: Glycosylation Modification

[0107] ROT2 glucosidase is inactivated in SB-691. The modified strain is transformed with a construct expressing THCAS using SP3 signal peptide (pCL-SE-0703) or SP4 signal peptide (pCL-SE-0704). As a control, SB-691 is also transformed with the same construct. THCA production is tested as described in Example 5.

[0108] Example 8: Expression of THCAS / CBDAS homologs from plants, fungi and bacteria

[0109] The approach taken to identify new enzymes for each step relies on three general methods. The first involves identifying sequence homologs to known enzymes with the desired activity. The second method relies on literature searches for enzymes that perform similar reactions using the same substrate or with similar substrates. The third method utilizes artificial intelligence algorithms to identify potential enzymes based on their predicted activity. These methods identified many candidate sequences, which were then manually curated and the selected sequences were cloned and characterized. In addition to the native sequences, several mutants were created using rational and random mutagenesis techniques. The mature sequences of all enzymes as shown in BBE1.1-BBE58 were fused to secretion sequences from SEQ ID NOs: 92-97. Synthetic genes optimized for expression in Yarrowia were created and their expression and activity towards CBGA cyclization was evaluated as described in Example 1.

[0110] Strain SB-1522-4.2, an A28 CBG(V)A producer expressing HCS2, PKS1.1, PKC1.0, ERG20ww, ERG20ww-MPT4, ERG20.A28 and CNE1, with a disruption of ERG20, was transformed with plasmids expressing the BBE variants with the SP4 signal peptide. Four colonies from each transformation were used to inoculate 0.5 mL of YDCM (YNB+Nitrogen 6.71 g / L, Casamino Acids 10 g / L, Glucose 60 g / L, 100 mM MES pH 6.5) medium with 1 mg / mL hygromycin in a 96 dw block, which was grown at 30° C. with shaking at 1000 rpm. After 48 hours, 2 μl from each preculture was used to inoculate 0.5 mL of YDCM medium with 1 mg / mL hygromycin in duplicate 96 dw blocks. Blocks were grown at 30° C. with shaking at 1000 rpm. After 24 hours, cultures were supplemented with 1 mM CBGA or CBGVA by adding 5 μl of 100 mM CBGA or CBGVA in 50% ethanol. After another 24 hours (48 hours total), cultures were quenched with 0.5 mL of ethanol with 0.2 mg / mL pentyl-benzoic acid and submitted for LC analysis. For a more detailed description of the A28 strain, see commonly owned U.S. Provisional Patent Application No. 63 / 256,398, which is incorporated herein by reference in its entirety.

[0111] Table 11: Cannabinoid formation from CBGA using BBE variants with SP4 signal peptide. Accumulated product in in vivo assay (in μM). Error bars represent standard deviation from individual replicates. [Table 11]

[0112] Table 12: Cannabinoid formation from CBGVA using BBE variants with SP4 signal peptide. Accumulated product in in vivo assay (in μM). Error bars represent standard deviation from individual replicates. [Table 12-1] [Table 12-2] ND: Cultures expressing SP4.BBE2.21 did not receive CBGVA.

[0113] The results clearly show that mutations in BBE1.20, BBE1.21, and BBE1.22 improve CBDA and CBDVA (except BBE1.22) production compared to the WT enzyme, BBE1.6. Similarly, mutations in BBE2.6, BBE2.7, BBE2.8, BBE2.16, BBE2.18, BBE2.19, BBE2.20, BBE2.21, and BBE2.22 improve THCA (except BBE2.19) and THCVA (except BBE2.21, which was not tested for CBGVA) production compared to the WT enzyme, BBE2.1. Mutations in BBE2.14 change the product profile of the enzyme compared to the WT enzyme, BBE2.1, completely converting the enzyme from a THCA- and THCVA-producing enzyme to a CBCA- and CBCVA-producing enzyme. BBE25.1, BBE25.4, and BBE25.5 are uncharacterized but naturally occurring sequences annotated as cannabidiolic acid synthase-like, however the results in Tables 11-12 clearly show that these enzymes produce CBCA and CBCVA, whereas the WT CBCAS enzyme, BBE3.1, does not produce any product in our system.

[0114] Methods and Techniques

[0115] Analysis method

[0116] All samples after quenching with an equal volume of EtOH were centrifuged and analyzed by HPLC-MS.

[0117] Column: 2.1×50mm COSMOCORE PBr (Nacalai USA, Inc.)

[0118] Buffer:

[0119] Buffer A: Water, 0.1% formic acid

[0120] Buffer B: acetonitrile, 0.1% formic acid

[0121] Flow rate: 0.45mL / min

[0122] Column temperature: 50℃

[0123] Injection volume: 2μL

[0124] Gradient method: [Table 13]

[0125] Retention times: OA 2.49 min, OL 2.38 min, CBGVA 4.71 min, CBDA 5.2 min, CBGA 5.60 min, THCVA 4.71 min, THCA 7.1 min, CBCA 7.31 min, and F-CBGA 7.52 min.

[0126] All compounds were verified by comparison to authentic standards and / or analysis by LC-MS.

[0127] Process development for producing cannabinoids through fermentation

[0128] The CBGA synthases described above can be used in cell-free reactions (in vitro) or whole cell biotransformation to produce cannabinoids as described in Figure 2. Recombinant cells of yeast, bacteria, fungi, algae, or plants express the terminal synthases (THCAS, CBDAS, CBCAS, etc.) and are contacted under appropriate fermentation / reaction conditions with CBGA, FCBGA, or other CBGA to produce the final cannabinoids. These organisms also contain genes encoding (a) proteins capable of converting various acyl-CoAs (acetyl, butyryl, hexanoyl, etc.) to their corresponding OA derivatives (orsellinic acid, DVA, OA, etc.), and (b) appropriate prenyltransferases capable of prenylating them to the CBGA derivatives shown in Figure 2.

[0129] Genes for OA synthesis may include one or more of the following: acyl-CoA ligase / synthase, polyketide / tetraketide synthase and polyketide cyclase, and prenyltransferase. The latter may be membrane-bound, such as PT4 (Uniprot A0A455ZJC3), soluble, such as nphB (Q4R2T2), or other enzymes with prenylation activity, including enzyme fusions and variants as described in WO 2021 / 178976 published September 10, 2021 (hereby incorporated by reference). Genes that increase mevalonate or MEP pathway flux toward GPP or FPP formation are also overexpressed in the former organism. To increase the intracellular concentration of GPP, mutant farnesyl pyrophosphate synthases can be used as described for yeast (Jian GZ, et al. Metabolic Engineering, 2017, 41, 57) or GPP-specific synthases can be introduced (Schmidt A, Gershenzon J. Phytochemistry, 2008, 69, 49). Other enzymes in the mevalonate pathway (e.g., HMG-CoA reductase) may need to be manipulated (truncated or mutated) or overexpressed. The formation of cannabinoid products can occur when the organism is grown on a simple carbon source (e.g., glucose, sucrose, glycerol, or another simple or complex sugar mixture). Exogenous organic acids with carbon chains (in linear or branched chains) ranging from 4 to more than 12 can also be supplemented during growth.

[0130] To scale the production of these molecules, the cells are then grown in a stirred tank fermenter supplemented with feedstock (sugar with or without organic acids) where dissolved oxygen, temperature, and pH are controlled according to optimal growth and production processes. The addition of aqueous immiscible organic solvents can also be used to dissolve added organic acids or to extract cannabinoid products as they are synthesized. These solvents can include, but are not limited to, isopropyl myristate (IPM), diisobutyl adipate, decane, dodecane, hexadecane, or another organic solvent with a logP>5.

[0131] Depending on the fermentation process, the product can be isolated and purified using different methods. If no organic co-solvent is used, the cannabinoids are insoluble in the fermentation broth and precipitate along with the cells after centrifugation. In such cases, the cell paste (wet, heat-dried, freeze-dried, or spray-dried) is used for isolation. Methods commonly used in the isolation and decarboxylation of cannabinoids can be applied to this material. These methods usually consist of two things: extraction with supercritical CO2 or using an organic solvent (most commonly, ethanol). After extraction, the ethanol mixture can be winterized or incubated at -40 to -50°C to precipitate oils and waxes, followed by evaporation of the ethanol to produce a cannabinoid-containing solid or oil. Final purification steps then include fractional distillation, crystallization, countercurrent centrifugal chromatography, or a combination of these methods.

[0132] Organic solvents (e.g., IPM, dodecane, etc.) may be used during fermentation to continuously extract the cannabinoid product and eliminate any possible toxicity. At the end of fermentation, the mixture is centrifuged and the organic solvent is separated. The cannabinoid acids are then extracted into the aqueous phase using alkaline water, and a basic aqueous solvent extracts the cannabinoids into the aqueous phase. Acidification of the aqueous solution precipitates the cannabinoids, which may be isolated by filtration. Further isolation may involve back-extraction of the acidified aqueous solution with a low boiling organic solvent (e.g., ethyl acetate, hexane, etc.), and evaporation of the organic solvent produces solid cannabinoids, which may be further purified by fractional distillation or recrystallization.

[0133] In some embodiments, cannabinoids in this application are defined as the products resulting from reacting olivetolic acid and its analogs with GPP or FPP, as shown in Figure 2. Cannabinoids are also defined as the cyclization products of previous CBGA analogs to produce CBDA, THCA and CBCA analogs, in addition to producing other novel cyclization products. Some examples of these analogs are shown in Figure 1.

[0134] Sequence Listing

[0135] >BBE1.1

[0136] [ka] [ka]

[0137] >BBE1.2

[0138] [ka]

[0139] >BBE1.3

[0140]

change

[0141] >BBE1.4

[0142]

change

change

[0143] >BBE1.5

[0144]

change

[0145] >BBE1.7

[0146]

change

[0147] >BBE1.8

[0148]

change

change

[0149] >BBE1.9

[0150]

change

[0151] >BBE1.10

[0152]

change

[0153] >BBE1.11

[0154]

change

change

[0155] >BBE1.12

[0156]

change

[0157] >BBE1.13

[0158]

change

[0159] >BBE1.14

[0160]

change

[0161] >BBE1.15

[0162]

change

[0163] >BBE1.16

[0164]

change

[0165] >BBE1.17

[0166]

change

[0167] >BBE1.18

[0168]

change

[0169] >BBE1.19

[0170]

change

[0171] >BBE1.20

[0172]

change

[0173] >BBE2.1

[0174]

change

change

[0175] >BBE2.2

[0176]

change

[0177] >BBE2.3

[0178]

change

[0179] >BBE2.4

[0180]

change

change

[0181] >BBE2.5

[0182]

change

[0183] >BBE2.6

[0184]

change

[0185] >BBE2.7

[0186]

change

change

[0187] >BBE2.8

[0188]

change

[0189] >BBE2.9

[0190]

change

[0191] >BBE2.10

[0192]

change

change

[0193] >BBE2.11

[0194]

change

[0195] >BBE2.12

[0196]

change

[0197] >BBE2.13

[0198]

change

[0199] >BBE2.14

[0200]

change

[0201] >BBE3.1

[0202]

change

[0203] >BBE3.2

[0204]

change

[0205] >BBE3.3

[0206]

change

[0207] >BBE3.4

[0208]

change

[0209] >BBE4.1

[0210]

change

[0211] >BBE5.1

[0212]

change

change

[0213] >BBE6.1

[0214]

change

[0215] >BBE7.1

[0216]

change

[0217] >BBE8.1

[0218]

change

change

[0219] >BBE9.1

[0220]

change

[0221] >BBE10.1

[0222]

change

[0223] >BBE11.1

[0224]

change

change

[0225] >BBE12.1

[0226]

change

[0227] >BBE13.1

[0228]

change

[0229] >BBE14.1

[0230]

change

[0231] >BBE15.1

[0232]

change

[0233] >BBE16.1

[0234]

change

[0235] >BBE17.1

[0236]

change

[0237] >BBE18.1

[0238]

change

change

[0239] >BBE19.1

[0240]

change

[0241] >BBE20.1

[0242]

change

[0243] >BBE21.1

[0244]

change

change

[0245] >BBE22.1

[0246]

change

[0247] >BBE23.1

[0248]

change

[0249] >BBE24.1

[0250]

change

change

[0251] >BBE25.1

[0252]

change

[0253] >BBE25.2

[0254]

change

[0255] >BBE25.3

[0256]

change

change

[0257] >BBE25.4

[0258]

change

[0259] >BBE25.5

[0260]

change

[0261] >BBE26.1

[0262]

change

[0263] >BBE27.1

[0264]

change

[0265] >BBE28.1

[0266]

change

[0267] >BBE29.1

[0268]

change

[0269] >BBE30.1

[0270]

change

change

[0271] >BBE31.1

[0272]

change

[0273] >BBE32.1

[0274]

change

[0275] >BBE33.1

[0276]

change

change

[0277] >BBE34.1

[0278]

change

[0279] >BBE35.1

[0280]

change

[0281] >BBE36.1

[0282]

change

change

[0283] >BBE37.1

[0284]

change

[0285] >BBE38.1

[0286]

change

[0287] >BBE39.1

[0288]

change

change

[0289] >BBE40.1

[0290]

change

[0291] >BBE41.1

[0292]

change

[0293] >BBE42.1

[0294]

change

[0295] >BBE43.1

[0296]

change

[0297] >BBE44.1

[0298]

change

[0299] >BBE45.1

[0300]

change

[0301] >BBE46.1

[0302]

change

change

[0303] >CsCHAP1

[0304]

change

[0305] >CsCHAP2

[0306]

change

[0307] >CsCHAP3

[0308]

change

[0309] >XP_030493922.1_FAD synthase [Cannabis sativa]

[0310] [ka]

[0311] >XP_030510352.1_dnaJ 49 [Cannabis sativa]

[0312] [ka]

[0313] >XP_030489210.1_ClpB1 [Cannabis sativa]

[0314] [ka]

[0315] >SRP155904_DN9237

[0316] [ka] [ka]

[0317] >SP3

[0318] MKSLLLSLLAVPATA (SEQ ID NO:92).

[0319] >SP4

[0320] MKFSAVSIAAALASLVAA (SEQ ID NO:93).

[0321] >SP7

[0322] MKLSTILFTACATLALALA (SEQ ID NO:94).

[0323] >SP8

[0324] MKVLALLVTVCFSVASA (SEQ ID NO:95).

[0325] >SP11

[0326] MIFDGTTMSIAIGLLSTLGIGAEA (SEQ ID NO:96).

[0327] >SP12, SP-KAR2

[0328] MKFSMPSWGVVFYALLVCLLPFLSKAGVQA (SEQ ID NO:97).

[0329] Lip2-THCAS

[0330] [ka]

[0331] THCAS-CWP1

[0332] [ka] [ka]

[0333] >LIP2

[0334] [ka]

[0335] >LIP2_Linker

[0336] GHHHHHHMDSPDLENLYFQS (SEQ ID NO:101).

[0337] >EK_Disconnect

[0338] DDDDK (SEQ ID NO:102).

[0339] >CWP1

[0340] [ka]

[0341] >FADS1a

[0342] [ka]

[0343] >HAC1s

[0344] [ka]

[0345] BBE47

[0346] [ka]

[0347] BBE48

[0348] [ka]

[0349] BBE49

[0350] [ka] [ka]

[0351] BBE50

[0352]

change

[0353] BBE51

[0354]

change

[0355] BBE52

[0356]

change

[0357] BBE53

[0358]

change

[0359] BBE54

[0360]

change

[0361] BBE55

[0362]

change

[0363] BBE56

[0364]

change

change

[0365] BBE57

[0366] [ka]

[0367] BBE58

[0368] [ka]

[0369] BBE1.6

[0370] SEQ ID NO:118

[0371] [ka] [ka]

[0372] BBE1.21

[0373] SEQ ID NO:119

[0374] [ka]

[0375] BBE1.22

[0376] SEQ ID NO:120

[0377] [ka]

[0378] BBE2.16

[0379] SEQ ID NO:121

[0380] [ka] [ka]

[0381] BBE2.18

[0382] SEQ ID NO:122

[0383] [ka]

[0384] BBE2.19

[0385] SEQ ID NO:123

[0386] [ka]

[0387] BBE2.20

[0388] SEQ ID NO:124

[0389] [ka] [ka]

[0390] BBE2.21

[0391] SEQ ID NO:125

[0392] [ka]

[0393] BBE2.22

[0394] SEQ ID NO:126

[0395] [ka]

Claims

1. A cell expressing an exogenous terminal cannabinoid synthase and overexpressing one or more chaperones, wherein the exogenous terminal cannabinoid synthase has at least one amino acid modification compared to a wild-type exogenous terminal cannabinoid synthase.

2. The exogenous terminal cannabinoid synthase is i) a berberine bridging enzyme (BBE)-like family enzyme selected from the group consisting of BBE1.20, BBE1.21, BBE1.22, BBE2.6, BBE2.7, BBE2.8, BBE2.16, BBE2.18, BBE2.19, BBE2.20, BBE2.21, BBE2.22, and BBE2.14, having amino acid sequences corresponding to SEQ ID NOs: 19, 119, 120, 25-27, 121-126, and 33, respectively; ii) The cell of claim 1, wherein the cell is selected from iii) a berberine cross-linking enzyme-like enzyme having at least one amino acid modification compared to one of the amino acid sequences of BBE1.6 (SEQ ID NO: 118), BBE2.1 (SEQ ID NO: 20), BBE3.1 (SEQ ID NO: 34), BBE25.1 (SEQ ID NO: 59), BBE25.4 (SEQ ID NO: 62) and BBE25.5 (SEQ ID NO: 63), and iii) a functional fragment or derivative of any of the foregoing having at least 70% sequence identity thereto.

3. The exogenous terminal cannabinoid synthase has improved solubility, stability, turnover, selectivity, K ｍ , or K ｃａｔ The cell of claim 1 ,

4. 2. The cell of claim 1, wherein the exogenous terminal cannabinoid synthase is preferentially expressed in a location selected from the group consisting of the cytoplasm, ER, Golgi, liposome, vacuole, cell membrane or extracellular membrane, peroxisome, oleosome, and extracellular environment.

5. The cell of claim 4 , wherein the preferential expression is accompanied by a synthetic, heterologous, or naturally occurring signal peptide, retention sequence, leader peptide, or sorting sequence.

6. The cell of claim 5, wherein the exogenous terminal cannabinoid synthase is expressed with a signal peptide selected from the group consisting of SP3, SP4, SP7, SP8, and SP11.

7. The cell of claim 1, wherein the exogenous terminal cannabinoid synthase is fused to a secreted protein or a membrane-localizing sequence.

8. 8. The cell of claim 7, wherein the cannabinoid synthase is fused to a 1,3-beta glucanosyltransferase selected from the group consisting of lipase 2 (Lip2) having the amino acid sequence of SEQ ID NO: 100, cell wall protein 1 (CWP1) having the amino acid sequence of SEQ ID NO: 103, Uniprot Q6C8C9 and Q6CFU7, or a functional fragment of any of the above having membrane-localized or secreted activity.

9. The cell of claim 1, wherein the cell also overexpresses one or more chaperones selected from HAC1, HAC1s, FADS1, FADS1a, KAR2, FMN1, CNE1, ERO1, PDI1, IRE, YAP1, HYR1, CsCHAP1, CsCHAP2, CsCHAP3, CsDNAJ, ClpB1, HSP90, or functional fragments or derivatives thereof.

10. The cell of claim 9, wherein the one or more overexpressed chaperones are HAC1, CNE1, or functional fragments or derivatives thereof.

11. 10. The cell of claim 9, wherein the chaperone is overexpressed together with a signaling protein selected from SP3, SP7, SP8, and SP12, optionally with an HDEL motif.

12. The cell of claim 1, wherein the cell overexpresses one or more chaperones or homologs thereof involved in the covalent attachment of FAD to terminal cannabinoid synthase and / or enzymes involved in FAD biosynthesis.

13. 13. The cell of claim 12, wherein the cell expresses exogenous FAD synthetase or FMN synthetase or overexpresses native FAD synthetase or FMN synthetase.

14. 14. The cell of claim 13, wherein the exogenous FAD synthetase is Uniprot ID Q6C7T3, FADS1 or FADS1a, and / or the FMN synthetase is Uniprot ID Q6CG11.

15. The method of claim 1, wherein the expression of one or more proteases is inhibited or inactivated, and wherein the one or more proteases inhibited or inactivated are AXP1, XPR2, YALI0E33363p, YALI0E28875p, PEP4, PRB1A, PRB1B, YALI0E34331p, YALI0E29403p, YALI0E28875p, YALI0E26851p, Y ALI0E21868p, YALI0E13552p, YALI0E13233p, YALI0E05423p, YALI0E04829p, YALI0E02024p, YALI0F26411p, YALI0F21615p, YALI0F20592p, YALI0F19734p, YALI0F17974p, YALI0F16005p, YALI0F13585p, YALI0F11033p , YALI0F10769p, YALI0F07359p, YALI0F05940p, YALI0F01859p, YALI0F01540p, YALI0F00396p, YALI0F00176 p, YALI0B20834p, YALI0B19228p, YALI0B17072p, YALI0B14641p, YALI0B13310p, YALI0B11594p, YALI0B1093 4p, YALI0B05522p, YALI0C10648p, YALI0C10494p, YALI0C09438p, YALI0C08283p, YALI0C05280p, YALI0C025 19p, YALI0C00165p, YALI0D04807p, YALI0D07920p, YALI0D10967p, YALI0D13046p, YALI0D15642p, YALI0D16335p, YALI0D18832p, YALI0D19910p, YALI0D22957p, YALI0D23309p, YALI0C21604p, YALI0B04158p, YALI0B02 574p, YALI0B01386p, YALI0A13277p, YALI0A10615p, YALI0E14388p2, YALI0B03718p, YALI0B16500p, YALI0D1 2. The cell of claim 1, wherein the gene is selected from the group consisting of YALI0F11803g, YALI0C20273p, YALI0B14641g, YALI0F11803g, YALI0C20273g and YALI0C10923p, and homologs and orthologs thereof.

16. The cell of claim 15, wherein expression of YALI0F09163p, and / or its homologs and / or orthologs, is inhibited or inactivated in the cell.

17. The cell of claim 1 , wherein the cell has been modified to inactivate ROT2 glucosidase.

18. The cells are engineered to enhance expression of the exogenous terminal cannabinoid synthase, the engineering comprising: a. improved import of the exogenous terminal cannabinoid synthase into the secretory pathway; b. Regulated unfolded protein response, c. Modulated disulfide bond forming activity; d. Regulated FAD biosynthetic activity; e. Regulated levels of FAD covalent binding to the enzyme; f. Modulated or altered N-linked glycosylation, vesicular transport, proteolytic, lipolytic, carbohydrate-degrading, or heat shock proteins; g. Modulated reactive oxygen species pathway activity, and h. Regulated cellular protein sorting; including one or more of The cell of claim 1.

19. The cell of claim 1, wherein the cell also expresses a prenyltransferase and produces CBGA or CBGVA by prenylation of OA or DVA with GPP.

20. 10. A method for producing CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or an analog thereof, the method comprising contacting the cell of claim 1 with a carbon source, and optionally hexanoic acid or butyric acid, and suitable conditions to produce CBDA, THCA, CBCA, CBDVA, THCVA, CBCVA, or an analog thereof.

Images