AKT3 Modulators
Patent Information
- Application Number
- JP2024525414
- Authority / Receiving Office
- JP · JP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2021-11-05
- Filing Date
- 2022-11-04
- Publication Date
- 2025-11-12
AI Technical Summary
There is an unmet need for more effective and acceptable treatments and preventive therapeutic interventions for chronic diseases such as neurodegenerative diseases and their complications, including cachexia, which current treatments often have negative side effects and cannot prevent or cure the diseases.
Development of Akt3 modulators, such as compounds with specific structures, to modulate Akt3 signaling, which can be used alone or in combination with other agents to treat or prevent conditions like neurodegenerative diseases, cachexia, and other chronic illnesses.
The Akt3 modulators provide a potential for more effective treatment and prevention of chronic diseases by modulating Akt3 signaling, offering improved outcomes with reduced side effects compared to existing treatments.
Smart Images

Figure 00000000_0000_ABST
Abstract
Description
[Technical field]
[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of and priority to U.S. Provisional Application No. 63 / 276,115, filed November 5, 2021, the contents of which are incorporated by reference herein in their entirety.
[0002] Incorporation by Reference Any patents, patent publications, scientific publications or other documents cited herein are expressly incorporated herein by reference in their entirety.
[0003] The present invention relates generally to Akt3 modulators and methods for treating and preventing disease by modulating Akt3 signaling. [Background technology]
[0004] Chronic illnesses and diseases are long-lasting conditions that require ongoing medical attention and usually negatively impact the patient's quality of life. Chronic diseases are the leading cause of disability and death in the United States. Common chronic diseases include, but are not limited to, heart disease, cancer, neurodegenerative diseases, diabetes, obesity, eating disorders, and arthritis. It is estimated that six in 10 adults in the United States have a chronic disease, and four in 10 have two or more chronic diseases. Chronic diseases are also the leading cause of annual health care costs in the United States, leading to $3.3 trillion (see "About Chronic Disease," National Center for Chronic Disease Prevention, Centers for Disease Control and Prevention; updated October 23, 2019). These statistics highlight the need for new and improved treatments and preventative interventions for diseases such as cancer, inflammatory diseases, neurodegenerative diseases, pathogenic infections, immunodeficiency disorders, weight gain disorders, weight loss disorders, hormone imbalances, tuberous sclerosis, retinitis pigmentosa, and congestive heart failure.
[0005] Neurodegenerative diseases are debilitating conditions characterized by the progressive degeneration and disappearance of nerve cells, also called neurons. Neurons are components of the nervous system and do not normally self-replenish after injury or death. In patients with neurodegenerative diseases, the loss or dysfunction of neurons can affect physical movement and brain function. Neurodegenerative diseases include, but are not limited to, Alzheimer's disease, amyotrophic lateral sclerosis, Huntington's disease, Parkinson's disease, multiple sclerosis, prion disease, motor neuron disease, spinocerebellar degeneration, and spinal muscular atrophy. The symptoms of advanced neurodegenerative diseases can be severe, with patients losing memory, movement control, and personality. Existing treatments for neurodegenerative diseases can address symptoms, but generally cannot prevent or cure the disease. Such existing treatments usually have negative side effects that result in further deterioration of the patient's quality of life.
[0006] A serious complication of chronic diseases, such as neurodegenerative diseases and cancer, is cachexia, also called wasting syndrome. Cachexia is defined as a loss of body weight of more than 5% in 12 months or less in the presence of chronic disease. Other symptoms of cachexia include muscle atrophy, fatigue, weakness, and often anorexia. Weight loss associated with cachexia is due to loss of muscle mass as well as fat. Patients with cachexia often lose weight even if they eat a normal diet. There is currently no effective treatment for cachexia, which is the cause of death associated with many chronic diseases, such as neurodegenerative diseases. Summary of the Invention [Problem to be solved by the invention]
[0007] Thus, there is an unmet need for more effective and acceptable therapeutic and prophylactic interventions for these diseases, as well as other diseases and complications associated with these diseases. [Means for solving the problem]
[0008] As used herein, Akt3 is RAC-gamma serine / threonine-protein kinase, which in humans is an enzyme encoded by the Akt3 gene. [ka] or salts thereof, with various substituents defined herein. In certain embodiments, the compounds can modulate the properties or effects of Akt3 in vitro or in vivo and / or can be used individually or in combination with other agents in the prevention or treatment of various conditions. In other embodiments, methods for synthesizing the compounds are provided. In another aspect, pharmaceutical compositions comprising the compounds and methods of using these compositions individually or in combination with other agents or compositions in the prevention or treatment of various conditions are also described herein.
[0009] In one embodiment, the compound of formula I: [ka] [During the ceremony, [ka] teeth, [ka] and each occurrence of X1, X2, X3, X4, X5, X6, X7, X8, and X9 is independently CR1 or N; Each occurrence of R1 is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C 10 ) Bicycloalkyl, (C4-C 14 )tricycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 14 )Heterotricycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 ) Heterotricycloalkenyl, aryl, heteroaryl, -OR a , -SR a , -N(R a )2, -COR a , -CO2R a , -CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] and one or more of (C1-C6) alkyl, halogenated (C1-C6) alkyl, -SO2R a or -SO2N(R a ) 2 is optionally substituted with a partially saturated bicyclic heteroaryl; R1 is (C3-C7)cycloalkyl, (C4-C 10 ) Bicycloalkyl, (C4-C 14 )tricycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 14 )Heterotricycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 ) Heterotricycloalkenyl, aryl and heteroaryl are each selected from one or more of (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a )2, each of which is appropriately replaced, n is an integer of 0 to 4 permitted by the valence; Q is C(R a )2, O, NR a , N(C=O)R a or NSO2R a and Y1, Y2, Y3, Y4 and Y5 are each independently N or CR2, as permitted by valence, provided that the moiety [ka] is bonded to Y3 or Y5 and the moiety [ka] when bonded to, Y3 or Y5 is C; Each occurrence of R2 is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C 10 )bicycloalkyl, (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 10 )Heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, heteroaryl, -OR a , -SR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] is selected from the group consisting of Each occurrence of R4 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, heteroaryl, -OR a and -N(R a ) 2 selected from the group consisting of Each occurrence of R5 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, heteroaryl, -ORa and -N(R a ) 2 or or any two R groups bonded to two adjacent carbon atoms, taken together with the two adjacent carbon atoms to which they are bonded, form an optionally substituted (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, or halogenated (C3-C7)heterocycloalkyl; m is an integer from 0 to 3; R6 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl or heteroaryl; [ka] teeth, [ka] and Z is CR3 or N; W is O, NR8 or S, and R8 is H, (C1-C6)alkyl, (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, aryl or heteroaryl; Each occurrence of R3 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, -ORa, -N(R a )2, -COR a , -CO2R a , -CON(R a )2, -CN, -NC or -NO2; Each occurrence of R7 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, -ORa, -SR a , -N(R a )2, -COR a , -CO2R a , -CON(Ra )2, -CN, -NC, -NO2, -N3, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] selected from the group consisting of optionally substituted aryl and optionally substituted heteroaryl; or any two R7 groups together with the carbon atoms to which they are attached form a (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, or heteroaryl; p is an integer of 0 to 3 allowed by the valence; R a Each occurrence of is independently H, (C1-C6) alkyl, (C2-C6) alkenyl, (C3-C7) cycloalkyl, aryl, or heteroaryl, or two R a together form a 4- to 6-membered ring optionally substituted with halogen or (C1-C6) alkyl. or a pharma- ceutically acceptable salt thereof.
[0010] In any one of the embodiments disclosed herein, the compound has formula Ia: [ka] It has the structure:
[0011] In any one of the embodiments disclosed herein, the compound has formula Ib: [ka] It has the structure:
[0012] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0013] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0014] In any one of the embodiments disclosed herein, n is 0, 1 or 2.
[0015] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0016] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0017] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0018] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0019] In any one of the embodiments disclosed herein, n is 0, 1 or 2.
[0020] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0021] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0022] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0023] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0024] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0025] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0026] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0027] In any one of the embodiments disclosed herein, Q is O.
[0028] In any one of the embodiments disclosed herein, Q is NH.
[0029] In any one of the embodiments disclosed herein, each occurrence of R is independently selected from H, D, halogen, -ORa, -N(R a )2, (C1-C6) alkyl, (C1-C6) alkynyl, (C3-C7) heterocycloalkyl, (C4-C 10 )Heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, (C4-C 10 ) Bicycloalkyl, -CN, -N3, -NO2, -COR a , -CO2R a , -CON(R a )2, -SO2R a or -SO2N(R a )2, wherein the (C3-C7)heterocycloalkyl is optionally substituted with one or more (C1-C6)alkyl.
[0030] In any one of the embodiments disclosed herein, each occurrence of R is independently selected from H, halogen, (C1-C6) alkyl, (C3-C7) heterocycloalkyl, (C4-C 10 )heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, -N(R a )2 or -CN, and the (C3-C7)heterocycloalkyl is optionally substituted with one or more (C1-C6)alkyl.
[0031] In any one of the embodiments disclosed herein, each occurrence of R1 is independently H, (C1-C6)alkyl, (C3-C7)heterocyclohaloalkyl, or (C3-C7)heterocycloalkyl, wherein the (C3-C7)heterocycloalkyl is optionally substituted with one or more (C1-C6)alkyl.
[0032] In any one of the embodiments disclosed herein, each occurrence of R1 is independently H, D, F, Cl, Br, CH3, OCH3, NH2, NHCH3, N(CH3)2, [ka] It is.
[0033] In any one of the embodiments disclosed herein, each occurrence of R is independently H, D, F, CH, NH, NHCH, N(CH), [ka] It is.
[0034] In any one of the embodiments disclosed herein, at least one occurrence of R is [ka] It is.
[0035] In any one of the embodiments disclosed herein, at least one occurrence of R is [ka] and X is CR 15 , O, N.R. 14 or S, and each occurrence of R9 is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a )2, and R 14 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl or heteroaryl; R 15 each occurrence is independently selected from H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a ) 2 and q is 0, 1, 2 or 3.
[0036] In any one of the embodiments disclosed herein, X is O.
[0037] In any one of the embodiments disclosed herein, each occurrence of R9 is independently H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, or halogen.
[0038] In any one of the embodiments disclosed herein, each occurrence of R9 is independently H, F, Cl, Br, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2.
[0039] In any one of the embodiments disclosed herein, each occurrence of R9 is independently H, F, Cl, Br, or CH3.
[0040] In any one of the embodiments disclosed herein, R 15 Each occurrence of is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, or halogen.
[0041] In any one of the embodiments disclosed herein, R 15 Each occurrence is independently H, F, Cl, Br, or CH3.
[0042] In any one of the embodiments disclosed herein, q is 0.
[0043] In any one of the embodiments disclosed herein, q is 1.
[0044] In any one of the embodiments disclosed herein, q is 2 or 3.
[0045] In any one of the embodiments disclosed herein, X is NR 14 and R 14 is H or (C1-C6) alkyl.
[0046] In any one of the embodiments disclosed herein, at least one occurrence of R is [ka] and X is O or NR 14 and R 14 is H or (C1-C6) alkyl.
[0047] In any one of the embodiments disclosed herein, at least one occurrence of R is [ka] It is.
[0048] In any one of the embodiments disclosed herein, [ka] teeth, [ka] and R 12 is (C3-C7) cycloalkenyl, (C3-C7) heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) tricycloalkenyl or (C4-C 14 )heterotricycloalkenyl, each of which is selected from one or more of (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a )2 as appropriate.
[0049] In any one of the embodiments disclosed herein, R 12 teeth, [ka] and X is CR 15 , O, N.R. 14 or S, and each occurrence of R9 is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a )2, and R 14is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl or heteroaryl; R 15 each occurrence is independently selected from H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a ) 2 and q is 0, 1, 2 or 3.
[0050] In any one of the embodiments disclosed herein, R 12 teeth, [ka] and X is O or NR 14 and R 14 is H or (C1-C6) alkyl.
[0051] In any one of the embodiments disclosed herein, R 12 teeth, [ka] It is.
[0052] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] [ka] [ka] where Q is O or NH.
[0053] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] [ka] [ka] where Q is O or NH.
[0054] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] where Q is O or NH and R1 is H, (C1-C6)alkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl or halogen.
[0055] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] where Q is O or NH.
[0056] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] where Q is O or NH.
[0057] In any one of the embodiments disclosed herein, the structural moiety [ka] is bound to Y5 and has the structural moiety [ka] teeth, [ka] It has the structure:
[0058] In any one of the embodiments disclosed herein, the structural moiety [ka] is bound to Y5 and has the structural moiety [ka] teeth, [ka] It has the structure:
[0059] In any one of the embodiments disclosed herein, each occurrence of R2 is independently H, halogen, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2.
[0060] In any one of the embodiments disclosed herein, the structural moiety [ka] is bound to Y5 and has the structural moiety [ka] teeth, [ka] It has the structure:
[0061] In any one of the embodiments disclosed herein, the structural moiety [ka] is attached to Y3 and has the structural moiety [ka] teeth, [ka] It has the structure:
[0062] In any one of the embodiments disclosed herein, the structural moiety [ka] is attached to Y3 and has the structural moiety [ka] teeth, [ka] It has the structure:
[0063] In any one of the embodiments disclosed herein, each occurrence of R2 is independently H, halogen, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2.
[0064] In any one of the embodiments disclosed herein, the structural moiety [ka] is attached to Y3 and has the structural moiety [ka] teeth, [ka] It has the structure:
[0065] In any one of the embodiments disclosed herein, m is 0.
[0066] In any one of the embodiments disclosed herein, m is 1.
[0067] In any one of the embodiments disclosed herein, m is 2 or 3.
[0068] In any one of the embodiments disclosed herein, each occurrence of R4 is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C3-C7) cycloalkyl, -ORa, or -N(R a )2.
[0069] In any one of the embodiments disclosed herein, each occurrence of R4 is independently H, halogen, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2.
[0070] In any one of the embodiments disclosed herein, any two R groups bonded to two adjacent carbons, taken together with the two adjacent carbon atoms to which they are bonded, form a (C-C)cycloalkyl, a (C-C)heterocycloalkyl, or a halogenated (C-C)heterocycloalkyl.
[0071] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] and the Y ring is a (C3-C7) cycloalkyl.
[0072] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0073] In any one of the embodiments disclosed herein, each occurrence of R5 is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, -ORa, or -N(R a )2.
[0074] In any one of the embodiments disclosed herein, each occurrence of R5 is independently (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, aryl, or heteroaryl.
[0075] In any one of the embodiments disclosed herein, each occurrence of R5 is independently H, halogen, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2.
[0076] In any one of the embodiments disclosed herein, R6 is H or (C1-C6) alkyl.
[0077] In any one of the embodiments disclosed herein, R6 is (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, aryl, or heteroaryl.
[0078] In any one of the embodiments disclosed herein, R6 is H, CH3, CH2CH3, CH(CH3)2, [ka] It is.
[0079] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0080] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0081] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth [ka] It has the structure:
[0082] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0083] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0084] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0085] In any one of the embodiments disclosed herein, the structural moiety [ka] teeth, [ka] It has the structure:
[0086] In any one of the embodiments disclosed herein, each occurrence of R3 is independently H, halogen, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2.
[0087] In any one of the embodiments disclosed herein, each occurrence of R7 is independently H, halogen, (C1-C6) alkyl, -CN, -NC, -NO2, N 3、 -OR a , -SR a or -N(R a )2.
[0088] In any one of the embodiments disclosed herein, each occurrence of R7 is independently -COR a , -CO2R a , -CON(R a )2, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] It is.
[0089] In any one of the embodiments disclosed herein, each occurrence of R7 is independently [ka] each of which is optionally substituted with one or more of alkyl, OH, or halogen.
[0090] In any one of the embodiments disclosed herein, any two R7 groups together with the carbon atoms to which they are attached form a (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, aryl, or heteroaryl.
[0091] In any one of the embodiments disclosed herein, each occurrence of R7 is independently H, CH3, CH2CH3, CH(CH3)2, CF3, OH, NH2, -NHCH3 or -N(CH3)2, -SO2NH2, -COR a , -CONH2 or [ka] It is.
[0092] In any one of the embodiments disclosed herein, each occurrence of R8 is independently H, CH3, CH2CH3, CH(CH3)2, or CF3.
[0093] In any one of the embodiments disclosed herein, [ka] teeth, [ka] It is.
[0094] In any one of the embodiments disclosed herein, R aEach occurrence is independently H, (C2-C6)alkenyl, or (C1-C6)alkyl.
[0095] In any one of the embodiments disclosed herein, R a Each occurrence is independently H, CH, or CHCH.
[0096] In any one of the embodiments disclosed herein, the compound comprises: [ka] [ka] [ka] is selected from the group consisting of:
[0097] In another aspect, a method of treating a disease in a subject in need thereof is described, comprising administering to the subject an effective amount of a compound of any one of the embodiments disclosed herein.
[0098] In any one of the embodiments described herein, the disease is selected from the group consisting of neurodegenerative diseases, cachexia, anorexia, obesity, complications of obesity, inflammatory diseases, virally induced inflammatory responses, Gulf War syndrome, tuberous sclerosis, retinitis pigmentosa, graft rejection, cancer, autoimmune diseases, ischemic tissue injury, traumatic tissue injury, and combinations thereof.
[0099] In any one of the embodiments described herein, the disease is a neurodegenerative disease.
[0100] In any one of the embodiments described herein, the neurodegenerative disease is selected from the group consisting of Parkinson's disease, Alzheimer's disease, amyotrophic lateral sclerosis, motor neuron disease, Huntington's disease, HIV-induced neurodegeneration, Lewy body disease, spinal muscular atrophy, prion disease, spinocerebellar degeneration, familial amyloid polyneuropathy, multiple sclerosis, and combinations thereof.
[0101] In any one of the embodiments described herein, the disease is cachexia or anorexia.
[0102] In any one of the embodiments described herein, the disease is obesity or a complication of obesity.
[0103] In any one of the embodiments described herein, the complication of obesity is selected from the group consisting of impaired glucose tolerance, fatty liver, dyslipidemia, and combinations thereof.
[0104] In any one of the embodiments described herein, the disease is an inflammatory disease.
[0105] In any one of the embodiments described herein, the inflammatory disease is selected from the group consisting of atopic dermatitis, allergies, asthma, and combinations thereof.
[0106] In any one of the embodiments described herein, the disease is a virally induced inflammatory response.
[0107] In any one of the embodiments described herein, the virus-induced inflammatory response is SARS-induced inflammatory pneumonia, coronavirus disease 2019, or a combination thereof.
[0108] In any one of the embodiments described herein, the disease is Gulf War Syndrome or tuberous sclerosis complex.
[0109] In any one of the embodiments described herein, the disease is retinitis pigmentosa or graft rejection.
[0110] In any one of the embodiments described herein, the disease is ischemic tissue injury or traumatic tissue injury.
[0111] In any one of the embodiments described herein, the disease is cancer.
[0112] In any one of the embodiments described herein, the cancer is selected from the group consisting of adult T-cell leukemia / lymphoma, bladder, brain, breast, cervical, colorectal, esophageal, renal, liver, lung, nasopharyngeal, pancreatic, prostate, skin, stomach, uterine, ovarian and testicular cancer.
[0113] In any one of the embodiments described herein, the cancer is leukemia.
[0114] In any one of the embodiments described herein, the leukemia is adult T-cell leukemia / lymphoma.
[0115] In any one of the embodiments described herein, the adult T-cell leukemia / lymphoma is caused by a human T-cell lymphotropic virus.
[0116] In any one of the embodiments described herein, the disease is an autoimmune disease.
[0117] In any one of the embodiments described herein, the autoimmune disease is selected from the group consisting of achalasia, Addison's disease, adult Still's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-renal glomerular basement membrane disease, anti-tubular basement membrane antibody nephritis, antiphospholipid syndrome, autoimmune angioedema, autoimmune autonomic neuropathy, autoimmune encephalomyelitis, autoimmune hepatitis, autoimmune inner ear disease, autoimmune myocarditis, autoimmune oophoritis, autoimmune orchitis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune urticaria, axonal and neuronal neuropathy, Barrow's disease, Behçet's disease, benign mucous membrane pemphigoid, bullous pemphigoid, Castleman's disease, celiac disease, Chagas disease, chronic inflammatory demyelinating polyneuropathy, chronic relapsing multifocal osteomyelitis, Churg-Strauss syndrome, eosinophilic granulomatosis, cicatricial pemphigoid, Cogan's syndrome, cold agglutinin disease, congenital heart block, Coxsackie myocarditis, CREST syndrome, Crohn's disease, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), discoid lupus, Dressler's syndrome, endometriosis, eosinophilic esophagitis, eosinophilic fasciitis, erythema nodosum, essential mixed cryoglobulinemia, Eva fibromyalgia, fibrosing alveolitis, giant cell arteritis (temporal arteritis), giant cell myocarditis, glomerulonephritis, Goodpasture's syndrome, granulomatosis with polyangiitis, Graves' disease, Guillain-Barre syndrome, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schonlein purpura, herpes gestationis, hidradenitis suppurativa (acne inversa), hypogammaglobulinemia, IgA nephropathy, IgG4-related sclerosing disease, immune thrombocytopenic purpura, inclusion body myositis, interstitial cystitis, juvenile arthritis, juvenile diabetes mellitus (type 1 diabetes), juvenile myositis, Kawasaki disease, Ran Bart-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, lignified conjunctivitis, linear IgA disease, lupus, chronic Lyme disease, Meniere's disease, microscopic polyangiitis, mixed connective tissue disease, Mooren's ulcer, Muscha-Haberman disease, multifocal motor neuropathy, multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neonatal lupus, neuromyelitis optica, neutropenia, ocular pemphigoid, optic neuritis, relapsing rheumatism, pediatric autoimmune neuropsychiatric disorders, paraneoplastic cerebellar degeneration, paroxysmal nocturnal hemoglobinuria, Parry-Romberg syndrome, pars planitis (peripheral uveitis),Parsonage-Turner syndrome, pemphigus, peripheral neuropathy, perivenous encephalomyelitis, pernicious anemia, POEMS syndrome, polyarteritis nodosa, polyglandular syndrome type I, polyglandular syndrome type II, polyglandular syndrome type III, polymyalgia rheumatica, polymyositis, post-myocardial infarction syndrome, post-pericardiotomy syndrome, primary biliary cirrhosis, primary sclerosing cholangitis, progesterone dermatitis, psoriasis, psoriatic arthritis, pure red cell aplasia, pyoderma gangrenosum, Raynaud's phenomenon, reactive arthritis, reflex sympathetic dystrophy, relapsing polychondritis, restless legs impotence syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt's syndrome, scleritis, scleroderma, Sjogren's syndrome, sperm and testicular autoimmunity, stiff-body syndrome, subacute bacterial endocarditis, Susac's syndrome, sympathetic ophthalmia, Takayasu's arteritis, temporal arteritis (giant cell arteritis), thrombocytopenic purpura, Tolosa-Hunt syndrome, transverse myelitis, ulcerative colitis, undifferentiated connective tissue disease, uveitis, vasculitis, vitiligo, Vogt-Koyanagi-Harada disease, and combinations thereof.
[0118] In any one of the embodiments described herein, the compound modulates Akt3 in an immune cell.
[0119] In any one of the embodiments described herein, the immune cell is selected from the group consisting of a T cell, a B cell, a macrophage, and a glial cell.
[0120] In any one of the embodiments described herein, the glial cells are astrocytes, microglia, or oligodendrocytes.
[0121] In any one of the embodiments described herein, the T cells are regulatory T cells.
[0122] In any one of the embodiments described herein, the compound activates Akt3 signaling.
[0123] In any one of the embodiments described herein, the compound inhibits Akt3 signaling.
[0124] In any one of the embodiments described herein, the compound increases the activity or production of regulatory T cells.
[0125] In any one of the embodiments described herein, the compound reduces the activity or production of regulatory T cells.
[0126] In any one of the embodiments described herein, the method further comprises administering to the subject a second therapeutic agent.
[0127] In any one of the embodiments described herein, the second therapeutic agent is selected from the group consisting of nutritional supplements, chemotherapeutic agents, anti-inflammatory agents, immunosuppressants, cholinesterase inhibitors, antidepressants, anxiolytics, antipsychotics, riluzole, edavarone, dopamine agonists, MAO B inhibitors, catechol O-methyltransferase inhibitors, anticholinergics, anticonvulsants, tetrabenazine, carbidopa-levodopa, antispasmodics, antibodies, fusion proteins, enzymes, nucleic acids, ribonucleic acids, antiproliferative agents, cytotoxic agents, appetite stimulants, 5-HT3 antagonists, Cox-2 inhibitors, and combinations thereof.
[0128] In any one of the embodiments described herein, the method further comprises treating the subject with an immunotherapeutic agent, an immune modulator, a costimulatory activating agonist, a cytokine, a chemokine, a chemokine factor, an oncolytic virus, a biologic, a vaccine, a small molecule, a targeted therapy, an anti-inflammatory agent, a cellular therapy, chemotherapy, or radiation therapy.
[0129] Any one of the embodiments disclosed herein may be appropriately combined with any other embodiment disclosed herein. Any one of the embodiments disclosed herein may be combined with any other embodiment disclosed herein. The combination of any one of the embodiments disclosed herein with any other embodiment disclosed herein is expressly envisioned. In particular, the selection of one or more embodiments for one substituent may be appropriately combined with the selection of one or more specific embodiments for any other substituent. Such combinations may be made with any one or more embodiments of the application described herein or any formula described herein.
[0130] The present application is described with reference to the following figures, which are presented for illustrative purposes only and are not intended to be limiting. [Brief description of the drawings]
[0131] [Figure 1] 1 shows an assessment of iTreg induction (FoxP3) from human CD4 T cells treated with compounds 5-6 according to one or more embodiments described herein. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0132] definition It should be recognized that the present disclosure is not limited to the compositions and methods described herein and the experimental conditions described, and thus may vary.It should also be understood that the terms used herein are only for the purpose of describing certain embodiments, and are not intended to be limiting, since the scope of the present disclosure is limited only by the scope of the appended claims.
[0133] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Any compositions, methods, and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention.
[0134] In the context of describing the invention claimed herein (particularly in the context of the claims), the use of the singular and similar descriptions shall be construed to cover both the singular and the plural, unless otherwise indicated herein or the context clearly contradicts.
[0135] The recitation of ranges of values herein, unless otherwise indicated herein, is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, and each separate value is incorporated into the specification as if it were individually recited herein.
[0136] The use of the term "about" is intended to describe values in a range of approximately ±10% above or below any stated value. In some embodiments, values may range approximately ±5% above or below any stated value. In some embodiments, values may range approximately ±2% above or below any stated value. In other embodiments, values may range approximately ±1% above or below any stated value. The preceding ranges are intended to be made clear by the context, and no further limitations are implied. All methods described herein can be performed in any suitable order unless otherwise indicated herein or clearly contradicted by context. The use of any and all examples or exemplary language provided herein (e.g., "exemplary," "e.g., such as," "for example," "including but not limited to") is intended merely to better clarify the invention and does not impose limitations on the scope of the invention unless otherwise indicated.
[0137] The following are definitions of terms used in the specification of the present invention. The first definition provided for a group or term in this specification applies to that group or term individually or as part of another group throughout this specification, unless otherwise indicated. Unless otherwise defined, all technical and scientific terms used in this specification have the same meaning as commonly understood by those skilled in the art.
[0138] The terms "alkyl" and "alk" refer to straight or branched chain alkane (hydrocarbon) groups containing 1 to 12 carbon atoms, preferably 1 to 6 carbon atoms. Exemplary "alkyl" groups include methyl, ethyl, propyl, isopropyl, n-butyl, t-butyl, isobutylpentyl, hexyl, isohexyl, heptyl, 4,4-dimethylpentyl, octyl, 2,2,4-trimethylpentyl, nonyl, decyl, undecyl, dodecyl, and the like. 1~ The term "C4) alkyl" refers to a straight or branched chain alkane (hydrocarbon) group containing 1 to 4 carbon atoms, e.g., methyl, ethyl, propyl, isopropyl, n-butyl, t-butyl, and isobutyl. "Substituted alkyl" refers to an alkyl group that is substituted at any available attachment point with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR, aryl ... a , S.R. a , S(=O)R e , S(=O)2R e , P(=O)2R e , S(=O)2OR e , -N=S(=O)(R a ), S(=O)(=NR a )(=N(R a)2) (connected to the molecule via S or N), P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. In some embodiments, groups such as alkyl, cycloalkyl, alkenyl, alkynyl, cycloalkenyl, heterocycle, and aryl may themselves be optionally substituted.
[0139] The term "heteroalkyl" refers to a straight or branched chain alkyl group, preferably having 2 to 12 carbons in the chain, more preferably 2 to 10 carbons, where one or more of the carbons are replaced with a heteroatom selected from the group consisting of S, O, P, and N. Exemplary heteroalkyls include, but are not limited to, alkyl ethers, secondary and tertiary alkyl amines, alkyl sulfides, and the like. The group may be a terminal group or a bridging group. In some embodiments, the heteroalkyl is optionally substituted.
[0140] The term "alkenyl" refers to a straight or branched chain hydrocarbon group containing 2 to 12 carbon atoms and at least one carbon-carbon double bond. Exemplary such groups include ethenyl or allyl. The term "C2-C6 alkenyl" refers to a straight or branched chain hydrocarbon group containing 2 to 6 carbon atoms and at least one carbon-carbon double bond, such as ethylenyl, propenyl, 2-propenyl, (E)-but-2-enyl, (Z)-but-2-enyl, 2-methy(E)-but-2-enyl, 2-methy(Z)-but-2-enyl, 2,3-dimethyl ... "Alkenyl" refers to alkenyl groups which are substituted with one or more substituents, preferably one to four substituents, at any available point of attachment. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen, alkyl, halogenated alkyl (i.e., an alkyl group bearing a single halogen substituent or multiple halogen substituents, such as CF3 or CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR. a , S.R. a , S(=O)R e , S(=O)2R e , -N=S(=O)(R a ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)R e , S(=O)2OR e , P(=O)2OR e , N.R. b R c , N.R.b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. The exemplary substituents may themselves be optionally substituted.
[0141] The term "alkynyl" refers to a straight or branched chain hydrocarbon group containing 2 to 12 carbon atoms and at least one carbon-carbon triple bond. Exemplary groups include ethynyl. The term "C2-C6 alkynyl" refers to a straight or branched chain hydrocarbon group containing 2 to 6 carbon atoms and at least one carbon-carbon triple bond, such as ethynyl, prop-1-ynyl, prop-2-ynyl, but-1-ynyl, but-2-ynyl, pent-1-ynyl, pent-2-ynyl, hex-1-ynyl, hex-2-ynyl, or hex-3-ynyl. "Substituted alkynyl" refers to an alkynyl substituted at any available attachment point with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR. a , S.R. a , S(=O)R e , S(=O)2R e , P(=O)2R e , S(=O)2OR e , -N=S(=O)(R a ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d, C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. The exemplary substituents may themselves be optionally substituted.
[0142] The term "cycloalkyl" refers to a fully saturated cyclic hydrocarbon group containing one to four rings and three to eight carbons per ring. "C3-C7 cycloalkyl" refers to cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, or cycloheptyl. "Substituted cycloalkyl" refers to a cycloalkyl group substituted at any available attachment point with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR. a , S.R. a , S(=O)R e , S(=O)2R e , -N=S(=O)(R a ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)R e , S(=O)2OR e , P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. bC(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. Exemplary substituents may themselves be optionally substituted. Exemplary substituents also include spiro-linked or fused ring substituents, particularly spiro-linked cycloalkyl, spiro-linked cycloalkenyl, spiro-linked heterocycle (excluding heteroaryl), fused cycloalkyl, fused cycloalkenyl, fused heterocycle, or fused aryl, and the aforementioned substituents, e.g., cycloalkyl, cycloalkenyl, heterocycle, and aryl substituents, may themselves be optionally substituted.
[0143] The term "bicycloalkyl" or "spiroalkyl" refers to a group containing at least one cycloalkyl ring that shares one or more ring atoms with at least one other cycloalkyl ring. The term "heterobicycloalkyl" or "heterospiroalkyl" refers to a bicycloalkyl group in which at least one, preferably 1 to 3 carbon atoms in at least one ring is replaced with a heteroatom selected from the group consisting of N, S, O, or P. The heteroatom can occupy a terminal position or a bridging position (i.e., a connection point between two rings). Exemplary bicycloalkyl groups include adamantyl, bicyclo[1.1.1]pentyl, bicyclo[2.2.1]heptyl, bicyclo[3.1.1]heptyl, bicyclo[2.1.1]hexyl, octahydropentalenyl, bicyclo[3.2.1]octyl, bicyclo[3.3.3]undecanyl, decahydronaphthalenyl, bicyclo[3.2.0]heptyl, octahydro-1H-indenyl, bicyclo[4.2.1]nonanyl, and the like. Exemplary spiro bicycloalkyl groups include spiro[4.4]nonyl, spiro[3.3]heptyl, spiro[5.5]undecyl, spiro[3.5]nonyl, spiro[4.5]decyl, and the like. "Substituted bicycloalkyl," "substituted spiroalkyl," "substituted heterobicycloalkyl," and "substituted heterospiroalkyl" refer to a bicycloalkyl, spiroalkyl, heterobicycloalkyl, or heterospiroalkyl group that is substituted at any available point of attachment with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR. a , S.R. a , S(=O)R e , S(=O)2R e , -N=S(=O)(R a ), -Ra S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)R e , S(=O)2OR e , P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R eEach occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. Exemplary substituents may themselves be optionally substituted. Exemplary substituents also include spiro-linked or fused ring substituents, particularly spiro-linked cycloalkyl, spiro-linked cycloalkenyl, spiro-linked heterocycle (excluding heteroaryl), fused cycloalkyl, fused cycloalkenyl, fused heterocycle, or fused aryl, and the aforementioned substituents, e.g., cycloalkyl, cycloalkenyl, heterocycle, and aryl substituents, may themselves be optionally substituted.
[0144] The term "heterocycloalkyl" or "cycloheteroalkyl" refers to a saturated or partially saturated monocyclic, bicyclic or polycyclic ring containing at least one heteroatom, preferably 1 to 3 heteroatoms, selected from the group consisting of nitrogen, sulfur and oxygen, in at least one ring. Each ring is preferably 3 to 10 members, more preferably 4 to 7 members. In some embodiments, the heterocycloalkyl or cycloheteroalkyl is optionally substituted. Examples of suitable heterocycloalkyl substituents include, but are not limited to, azetidinyl, oxetanyl, pyrrolidyl, tetrahydrofuryl, tetrahydrothiofuranyl, piperidyl, piperazyl, tetrahydropyranyl, morpholino, 1,3-diazepanyl, 1,4-diazepanyl, 1,4-oxazepanyl and 1,4-oxathiapanyl. The group may be a terminal group or a bridging group.
[0145] The term "cycloalkenyl" refers to a partially unsaturated cyclic hydrocarbon group containing one to four rings and three to eight carbons per ring. Exemplary such groups include cyclobutenyl, cyclopentenyl, cyclohexenyl, and the like. "Substituted cycloalkenyl" refers to a cycloalkenyl group that is substituted at any available attachment point with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR, or the like. a , S.R. a , S(=O)R e , S(=O)2R e , -N=S(=O)(R a ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)R e , S(=O)2OR e , P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)ORe , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R cおよび R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. Exemplary substituents may themselves be optionally substituted. Exemplary substituents also include spiro-linked or fused ring substituents, particularly spiro-linked cycloalkyl, spiro-linked cycloalkenyl, spiro-linked heterocycle (excluding heteroaryl), fused cycloalkyl, fused cycloalkenyl, fused heterocycle, or fused aryl, and the aforementioned substituents, e.g., cycloalkyl, cycloalkenyl, heterocycle, and aryl substituents, may themselves be optionally substituted.
[0146] The term "aryl" refers to a cyclic aromatic hydrocarbon group having one to five aromatic rings, especially monocyclic or bicyclic groups, such as phenyl, biphenyl, or naphthyl. When containing two or more aromatic rings (such as bicyclic), the aromatic rings of the aryl group may be attached at a single point (such as biphenyl) or fused (such as naphthyl, phenanthrenyl, etc.). The term "fused aromatic ring" refers to a molecular structure having two or more aromatic rings in which two adjacent aromatic rings have two carbon atoms in common. "Substituted aryl" refers to an aryl group substituted at any available point of attachment with one or more substituents, preferably one to three substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR. a , S.R. a , S(=O)R e , S(=O)2R e , -N=S(=O)(R a ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)R e , S(=O)2OR e , P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)Ra , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. Exemplary substituents may themselves be optionally substituted. Exemplary substituents also include fused ring groups, particularly fused cycloalkyl, fused cycloalkenyl, fused heterocycle, or fused aryl, where the aforementioned substituents, e.g., cycloalkyl, cycloalkenyl, heterocycle, and aryl substituents, may themselves be optionally substituted.
[0147] The term "biaryl" refers to two aryl groups linked by a single bond. The term "biheteroaryl" refers to two heteroaryl groups linked by a single bond. Similarly, the term "heteroaryl-aryl" refers to a heteroaryl group and an aryl group linked by a single bond, and the term "aryl-heteroaryl" refers to an aryl group and a heteroaryl group linked by a single bond. In certain embodiments, the number of ring atoms in the heteroaryl and / or aryl rings is used to specify the size of the aryl or heteroaryl ring of the substituent. For example, 5,6-heteroaryl-aryl refers to a substituent in which a 5-membered heteroaryl is linked to a 6-membered aryl group. Other combinations and ring sizes can be specified similarly.
[0148] The term "carbocycle" or "carbocycle" refers to a fully saturated or partially saturated cyclic hydrocarbon group containing one to four rings and three to eight carbons per ring or a cyclic, aromatic hydrocarbon group having one to five aromatic rings, especially a monocyclic or bicyclic group, such as phenyl, biphenyl or naphthyl. The term "carbocycle" encompasses cycloalkyl, cycloalkenyl, cycloalkynyl and aryl as defined herein above. The term "substituted carbocycle" refers to a carbocycle or carbocyclic group substituted at any available attachment point with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, those described above for substituted cycloalkyl, substituted cycloalkenyl, substituted cycloalkynyl and substituted aryl. Exemplary substituents also include spiro-linked or fused ring substituents at any available point or attachment point, particularly spiro-linked cycloalkyl, spiro-linked cycloalkenyl, spiro-linked heterocycle (excluding heteroaryl), fused cycloalkyl, fused cycloalkenyl, fused heterocycle, or fused aryl, the aforementioned substituents, e.g., cycloalkyl, cycloalkenyl, heterocycle, and aryl substituents, may themselves be appropriately substituted.
[0149] The terms "heterocycle" and "heterocyclic" refer to fully saturated or partially or fully unsaturated ring groups, including aromatic (i.e., "heteroaryl"), having at least one heteroatom in at least one carbon atom-containing ring (e.g., 3- to 7-membered monocyclic, 7- to 11-membered bicyclic, or 8- to 16-membered tricyclic ring systems). Each ring of a heterocyclic group may be independently saturated or partially or fully unsaturated. Each ring of a heteroatom-containing heterocyclic group may have 1, 2, 3, or 4 heteroatoms selected from the group consisting of nitrogen, oxygen, and sulfur atoms, and the nitrogen and sulfur heteroatoms may be oxidized and the nitrogen heteroatom may be quaternized. (The term "heteroarylium" refers to a heteroaryl group that carries a quaternary nitrogen atom, thus carrying a positive charge.) A heterocyclic group may be attached to the remainder of the molecule at any heteroatom or carbon atom of the ring or ring system. Exemplary monocyclic heterocyclic groups are azetidinyl, pyrrolidinyl, pyrrolyl, pyrazolyl, oxetanyl, pyrazolinyl, imidazolyl, imidazolinyl, imidazolidinyl, oxazolyl, oxazolidinyl, isoxazolinyl, isoxazolyl, thiazolyl, thiadiazolyl, thiazolidinyl, isothiazolyl, isothiazolidinyl, furyl, tetrahydrofuryl, thienyl, oxadiazolyl, piperidinyl, piperazinyl, 2-oxopiperazinyl, Examples of aryl include aryl, 2-oxopiperidinyl, 2-oxopyrrolodinyl, 2-oxoazepinyl, azepinyl, hexahydrodiazepinyl, 4-piperidonyl, pyridyl, pyrazinyl, pyrimidinyl, pyridazinyl, triazinyl, triazolyl, tetrazolyl, tetrahydropyranyl, morpholinyl, thiamorpholinyl, thiamorpholinyl sulfoxide, thiamorpholinyl sulfone, 1,3-dioxolane, and tetrahydro-1,1-dioxothienyl.Exemplary bicyclic heterocyclic groups are indolyl, indolinyl, isoindolyl, benzothiazolyl, benzoxazolyl, benzoxadiazolyl, benzothienyl, benzo[d][1,3]dioxolyl, dihydro-2H-benzo[b][1,4]oxazine, 2,3-dihydrobenzo[b][1,4]dioxinyl, quinuclidinyl, quinolinyl, tetrahydroisoquinolinyl, isoquinolinyl, benzimidazolyl, benzopyranyl, indolizinyl, benzofuryl, benz ...dioxinyl, quinuclidinyl, quinolinyl, tetrahydroisoquinolinyl, isoquinolinyl, benzimidazolyl, benzopyranyl, indolizinyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, benzo[b][1,4]dioxinyl, benzyl, Exemplary tricyclic heterocyclic groups include carbazolyl, benzidolyl, dihydrobenzo[d]oxazole, chromonyl, coumarinyl, benzopyranyl, cinnolinyl, quinoxalinyl, indazolyl, pyrrolopyridyl, furopyridinyl (e.g., furo[2,3-c]pyridinyl, furo[3,2-b]pyridinyl, or furo[2,3-b]pyridinyl), dihydroisoindolyl, dihydroquinazolinyl (e.g., 3,4-dihydro-4-oxoquinazolinyl), triazinylazepinyl, tetrahydroquinolinyl, and the like. Exemplary tricyclic heterocyclic groups include carbazolyl, benzidolyl, phenanthrolinyl, acridinyl, phenanthridinyl, xanthenyl, and the like. The term "partially saturated bicyclic heteroaryl" refers to a bicyclic heteroaryl having a partially saturated, e.g., saturated, cycloalkyl or heterocyclic alkyl ring.
[0150] "Substituted heterocycle" and "substituted heterocyclic" (e.g., "substituted heteroaryl") refer to a heterocycle or heterocyclic group that is substituted at any available attachment point with one or more substituents, preferably one to four substituents. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, aryl, OR, aryl ... a , S.R. a , S(=O)R e , S(=O)2R e , -N=S(=O)(Ra ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)R e , S(=O)2OR e , P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)OR e , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, Re Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. Exemplary substituents may themselves be optionally substituted. Exemplary substituents also include spiro-linked or fused ring substituents at any available point or attachment point, particularly spiro-linked cycloalkyl, spiro-linked cycloalkenyl, spiro-linked heterocycle (excluding heteroaryl), fused cycloalkyl, fused cycloalkenyl, fused heterocycle, or fused aryl, and the aforementioned substituents, e.g., cycloalkyl, cycloalkenyl, heterocycle, and aryl substituents, may themselves be optionally substituted.
[0151] The term "oxo" means [ka] which may be attached to a carbon ring atom on a carbocyclic or heterocyclic ring. When the oxo substituent is attached to a carbon ring atom on an aromatic group, e.g., an aryl or heteroaryl, the bonds on the aromatic ring may be rearranged to meet valence requirements. For example, a pyridine with a 2-oxo substituent has the structure [ka] which structure can also have its tautomeric form [ka] Also includes.
[0152] The term "alkylamino" refers to a group having the structure -NHR', where R' is hydrogen, alkyl or substituted alkyl, cycloalkyl or substituted cycloalkyl as defined herein. Examples of alkylamino groups include, but are not limited to, methylamino, ethylamino, n-propylamino, iso-propylamino, cyclopropylamino, n-butylamino, tert-butylamino, neopentylamino, n-pentylamino, hexylamino, cyclohexylamino, and the like.
[0153] The term "dialkylamino" refers to a group having the structure -NRR', where R and R' are each independently alkyl or substituted alkyl, cycloalkyl or substituted cycloalkyl, cycloalkenyl or substituted cycloalkenyl, aryl or substituted aryl, heterocycle or substituted heterocycle, as defined herein. R and R' may be the same or different dialkylamino moieties. Examples of dialkylamino groups include, but are not limited to, dimethylamino, methylethylamino, diethylamino, methylpropylamino, di(n-propyl)amino, di(iso-propyl)amino, di(cyclopropyl)amino, di(n-butyl)amino, di(tert-butyl)amino, di(neopentyl)amino, di(n-pentyl)amino, di(hexyl)amino, di(cyclohexyl)amino, and the like. In certain embodiments, R and R' are linked to form a cyclic structure. The resulting cyclic structure may be aromatic or non-aromatic. Examples of the resulting cyclic structures include, but are not limited to, aziridinyl, pyrrolidinyl, piperidinyl, morpholinyl, pyrrolyl, imidazolyl, 1,2,4-triazolyl, and tetrazolyl.
[0154] The term "halogen" or "halo" refers to chlorine, bromine, fluorine or iodine.
[0155] The term "substituted" refers to embodiments in which a molecule, molecular moiety, or substituent (e.g., an alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocyclic, or aryl group, or any other group disclosed herein) is substituted at any available point of attachment with one or more substituents, preferably one to six substituents, as permitted by valence. Exemplary substituents include, but are not limited to, one or more of the following groups: hydrogen, halogen (e.g., a single halogen substituent or multiple halo substituents, in the latter case forming a group such as, for example, a CF3 group or an alkyl group bearing CCl3), cyano, nitro, oxo (i.e., =O), CF3, OCF3, alkyl, halogen-substituted alkyl, cycloalkyl, bicycloalkyl, spiroalkyl, alkenyl, cycloalkenyl, alkynyl, heterocyclic, aryl, OR, or the like. a , S.R. a , S(=O)R e , S(=O)2R e , P(=O)2R e , S(=O)2OR e , -N=S(=O)(R a ), -R a S(=O)(=NR a ), S(=O)(=NR a )(=N(R a )2)(R a or N), P(=O)2OR e , N.R. b R c , N.R. b S(=O)2R e , N.R. b P(=O)2R e , S(=O)2NR b R c , P(=O)2NR b R c , C(=O)OR d , C(=O)R a , C(=O)NR b R c ,OC(=O)R a ,OC(=O)NR b R c , N.R. b C(=O)ORe , N.R. d C(=O)NR b R c , N.R. d S(=O)2NR b R c , N.R. d P(=O)NR b R c , N.R. b C(=O)R a or NR b P(=O)2R e (In the formula, R a Each occurrence of is independently hydrogen, alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl; R b , R c and R d Each occurrence of is independently hydrogen, alkyl, cycloalkyl, heterocycle, aryl, or b and R c may form a heterocycle together with the N to which they are attached, R e Each occurrence of is independently alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl. In the above exemplary substituents, for example, groups such as alkyl, cycloalkyl, alkenyl, alkynyl, cycloalkenyl, heterocycle, and aryl may themselves be optionally substituted. The term "optionally substituted" refers to embodiments in which a molecule, molecular moiety, or substituent (e.g., an alkyl, cycloalkyl, alkenyl, cycloalkenyl, alkynyl, heterocycle, or aryl group or any other group disclosed herein) may or may not be substituted with one or more of the substituents described above.
[0156] Unless otherwise noted, any heteroatom with unsatisfied valences is assumed to have sufficient hydrogen atoms to satisfy the valences.
[0157] The compounds of the present invention can form salts that are also within the scope of the present invention. Reference to a compound of the present invention is considered to include reference to its salts unless otherwise indicated. The term "salts" as used herein refers to acid salts and / or base salts formed with inorganic and / or organic acids and bases. In addition, when a compound of the present invention contains both a basic moiety, such as, but not limited to, pyridine or imidazole, and an acidic moiety, such as, but not limited to, carboxylic acid, zwitterions ("internal salts") may be formed, which are included in the term "salts" as used herein. Pharmaceutically acceptable (i.e., non-toxic, physiologically acceptable) salts are preferred, although other salts that can be utilized during preparation are also useful, for example, in isolation or purification steps. Salts of the compounds of the present invention can be formed, for example, by reacting a compound described herein with an amount of an acid or base, for example, an equivalent amount of an acid or base, in a medium, such as a medium in which the salt precipitates or an aqueous medium, followed by lyophilization.
[0158] The compounds of the present invention that contain a basic moiety, such as, but not limited to, an amine or a pyridine or imidazole ring, can form salts with a variety of organic and inorganic acids. Exemplary acid addition salts include acetate (e.g., those formed with acetic acid or trihaloacetic acid; e.g., trifluoroacetic acid), adipate, alginate, ascorbate, aspartate, benzoate, benzenesulfonate, bisulfate, borate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, fumarate, glucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, hydroxyethanesulfonate ... Examples of suitable salts include sulfonates (e.g., 2-hydroxyethanesulfonate), lactate, maleate, methanesulfonate, naphthalenesulfonate (e.g., 2-naphthalenesulfonate), nicotinate, nitrate, oxalate, pectinate, persulfate, phenylpropionate (e.g., 3-phenylpropionate), phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate (e.g., formed with sulfuric acid), sulfonate, tartrate, thiocyanate, toluenesulfonate, e.g., tosylate, undecanoate, and the like.
[0159] The compounds of the present invention that contain an acidic moiety, such as, but not limited to, carboxylic acid, can form salts with various organic and inorganic bases.Exemplary base salts include ammonium salts, alkali metal salts, such as sodium salts, lithium salts and potassium salts, alkaline earth metal salts, such as calcium salts and magnesium salts, salts with organic bases (such as organic amines), such as benzathine, dicyclohexylamine, hydrabamine (formed with N,N-bis(dehydroabietyl)ethylenediamine), N-methyl-D-glucamine, N-methyl-D-glycamide, t-butylamine salts, and salts with amino acids, such as arginine, lysine, etc. Basic nitrogen-containing groups can be quaternized with agents such as lower alkyl halides (e.g., methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides), dialkyl sulfates (e.g., dimethyl, diethyl, dibutyl, and diamyl sulfates), long chain halides (e.g., decyl, lauryl, myristyl, and stearyl chlorides, bromides, and iodides), aralkyl halides (e.g., benzyl and phenethyl bromides), and others.
[0160] Prodrugs and solvates of the compounds of the present invention are also contemplated herein.The term "prodrug" as used herein refers to a compound that, when administered to a subject, undergoes chemical conversion by metabolic or chemical processes to produce the compounds of the present invention or their salts and / or solvates.Solvates of the compounds of the present invention include, for example, hydrates.
[0161] The compounds of the present invention and their salts or solvates can exist in their tautomeric forms (e.g., amide or iminol). All such tautomeric forms are contemplated herein as part of the present invention. As used herein, any depicted structure of a compound includes its tautomeric forms.
[0162] All stereoisomers of the compounds described herein, including enantiomeric and diastereomeric forms (e.g., those that may exist due to asymmetric carbons on various substituents), are contemplated within the scope of the present invention. Individual stereoisomers of the compounds of the present invention may, for example, be substantially free of other isomers (e.g., as pure or substantially pure optical isomers having the specified activity) or, for example, as racemates or mixed with all other stereoisomers, or other selected stereoisomers. The chiral centers of the present invention may have the S or R configuration as defined by the 1974 Recommendations of the International Union of Pure and Applied Chemistry (IUPAC). Racemates can be resolved by physical methods, such as fractional crystallization, separation, or crystallization of diastereomeric derivatives or separation by chiral column chromatography. Individual optical isomers can be obtained from the racemates by any suitable method, including, but not limited to, conventional methods, such as salt formation with an optically active acid followed by crystallization.
[0163] The compounds of the present invention are preferably isolated and purified after their preparation to obtain compositions containing an amount of the compound equal to or greater than 90% by weight, for example, equal to or greater than 95% by weight, equal to or greater than 99% by weight ("substantially pure" compounds), and then used or formulated as described herein. Such "substantially pure" compounds of the present invention are also contemplated herein as part of the present invention.
[0164] All configurational isomers of the compounds of the present invention are contemplated, either in admixture or in pure or substantially pure form. The definition of the compounds of the present invention encompasses both cis (Z) and trans (E) alkene isomers, as well as cis and trans isomers of cyclic hydrocarbon or heterocyclic rings.
[0165] Throughout the specification, groups and substituents may be chosen to provide stable moieties and compounds.
[0166] Definitions of certain functional groups and chemical terms are described in more detail herein. For purposes of the present invention, chemical elements are defined as defined in the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75 th Ed., inside cover, and specific functional groups are generally defined as described therein. Further, general principles of organic chemistry, and specific functional group moieties and reactivities are described in "Organic Chemistry", Thomas Sorrell, University Science Books, Sausalito (1999).
[0167] Certain compounds of the present invention can exist in particular geometric or stereoisomeric forms. The present invention contemplates that all such compounds are included within the scope of the present invention, including cis- and trans-isomers, R- and S-enantiomers, diastereomers, (D)-isomers, (L)-isomers, racemic mixtures thereof, and other mixtures thereof. Additional asymmetric carbon atoms may be present in a substituent, such as an alkyl group. All such isomers, as well as mixtures thereof, are intended to be included in the present invention.
[0168] Mixtures of isomers containing any of a variety of isomeric ratios can be utilized in accordance with the present invention. For example, when only two isomers are combined, mixtures containing 50:50, 60:40, 70:30, 80:20, 90:10, 95:5, 96:4, 97:3, 98:2, 99:1 or 100:0 isomeric ratios are all contemplated by the present invention. Those skilled in the art will readily recognize that similar ratios are contemplated for more complex isomeric mixtures.
[0169] The present invention also includes isotopically labeled compounds that are identical to the compounds disclosed herein except for the fact that one or more atoms have been replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number normally found in nature. Examples of isotopes that can be incorporated into the compounds of the present invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine and chlorine, e.g., 2 H (or D), 3 H, 13 C. 11 C. 14 C. 15 N, 18 O. 17 O. 31 P, 32 P, 35 S, 18 F and 36 The compounds of the invention, or their enantiomers, diastereomers, tautomers, or pharma- ceutically acceptable salts or solvates, that contain the aforementioned isotopes and / or other isotopes of other atoms are within the scope of the invention. Certain isotopically labeled compounds of the invention, for example, radioactive isotopes, e.g. 3 H and 14 Compounds incorporating C are useful in drug and / or substrate tissue distribution assays. Tritium-labeled isotopes, i.e. 3 H and carbon-14 isotopes, i.e., 14 C is particularly preferred due to its ease of preparation and detectability. Additionally, heavier isotopes such as deuterium, i.e. 2 Substitution with H may confer certain therapeutic advantages resulting from greater metabolic stability, e.g., increased in vivo half-life or reduced dosage requirements, and may therefore be preferred in some circumstances. Isotopically labeled compounds can generally be prepared by carrying out the procedures disclosed in the following schemes and / or examples, substituting readily available isotopically labeled reagents for non-isotopically labeled reagents.
[0170] For example, if a particular enantiomer of a compound of the invention is desired, it can be prepared by asymmetric synthesis or by derivatization with a chiral auxiliary, where the resulting mixture of diastereomers is separated and the auxiliary group is cleaved to give the desired pure enantiomer. Alternatively, if the molecule contains a basic functional group, e.g., amino, or an acidic functional group, e.g., carboxyl, the diastereomeric salt can be formed with an appropriate optically active acid or base, followed by separation of the diastereomers thus formed by means of fractional crystallization or chromatography as is well known in the art, and then recovery of the pure enantiomer.
[0171] It should be recognized that the compounds described herein may be substituted with any number of substituents or functional moieties. In general, the term "substituted" refers to the replacement of hydrogen groups in a given structure with the group of the specified substituents, whether preceded by the term "optionally" or not, and whether the substituents are included in the formulas of the invention. If more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituents may be the same or different at all positions. As used herein, the term "substituted" is intended to include all permissible substituents of organic compounds. In a broad aspect, the permissible substituents include acyclic and cyclic, branched and unbranched, carbocyclic and heterocyclic, aromatic and nonaromatic substituents of organic compounds. For purposes of this invention, heteroatoms, e.g., nitrogen, may have any permissible substituent of organic compounds described herein that satisfies the valence of the hydrogen substituents and / or heteroatoms. Furthermore, this invention is not intended to limit in any manner the permissible substituents of organic compounds. Combinations of substituents and variables envisioned by the present invention are those that preferably result in the formation of stable compounds useful in therapy, e.g., in the treatment of proliferative disorders. The term "stable," as used herein, preferably refers to a compound that possesses sufficient stability to permit manufacture and maintains its integrity for a sufficient period of time for the compound to be detected, preferably for a sufficient period of time to be useful for the purposes detailed herein.
[0172] As used herein, the term "cancer" and equivalently "tumor" refers to a condition in which abnormally replicating cells of host origin are present in a detectable amount in a subject. Cancer can be malignant or non-malignant cancer. Cancer or tumor includes, but is not limited to, adult T-cell leukemia / lymphoma (including those caused by human T-cell lymphotropic virus (HTLV-1)), bile duct cancer; brain cancer; breast cancer; cervical cancer; choriocarcinoma; colon cancer; endometrial cancer; esophageal cancer; gastric (stomach) cancer; intraepithelial neoplasia; leukemia; lymphoma; liver cancer; lung cancer (e.g., small cell and non-small cell); melanoma; neuroblastoma; oral cancer; ovarian cancer; pancreatic cancer; prostate cancer; rectal cancer; renal (kidney) cancer; sarcoma; skin cancer; testicular cancer; thyroid cancer; and other cancers and sarcomas. As used herein, the term "lymphoma" refers to cancer of the lymphatic system or blood cancer that develops from lymphocytes. Cancer may be primary or metastatic. Diseases other than cancer may also be associated with mutational changes in components of the Ras signaling pathway, and the compounds disclosed herein can be used to treat these non-cancer diseases. Such non-cancer diseases can include: neurofibromatosis; Leopard syndrome; Noonan syndrome; Regius syndrome; Costello syndrome; Cardio-facio-cutaneous syndrome; Hereditary gingival fibromatosis type 1; Autoimmune lymphoproliferative syndrome; and Capillary malformation-cerebral arteriovenous malformation.
[0173] As used herein, "effective amount" refers to any amount necessary or sufficient to achieve or promote a desired result. In some cases, the effective amount is a therapeutically effective amount. A therapeutically effective amount is any amount necessary or sufficient to promote or achieve a desired biological response in a subject. The effective amount for any particular application may vary depending on factors such as the disease or condition being treated, the specific drug being administered, the size of the subject, or the severity of the disease or condition. Those skilled in the art can empirically determine the effective amount of a particular drug without undue experimentation.
[0174] As used herein, the term "subject" refers to a vertebrate. In one embodiment, the subject is a mammal or a mammalian species. In one embodiment, the subject is a human. In other embodiments, the subject is a non-human vertebrate, including but not limited to non-human primates, laboratory animals, farm animals, race horses, domestic animals, and non-domestic animals.
[0175] The term "immune cells," as used herein, refers to cells of the innate and acquired immune systems, including, but not limited to, neutrophils, eosinophils, basophils, glial cells (e.g., astrocytes, microglia, and oligodendrocytes), monocytes, macrophages, dendritic cells, lymphocytes, including B cells, T cells, and NK cells.
[0176] As used herein, a "conventional T cell" is a T lymphocyte that expresses an αβ T cell receptor ("TCR") and the co-receptors CD4 or CD8. Conventional T cells are present in peripheral blood, lymph nodes and tissues. See Roberts and Girardi, "Conventional and Unconventional T Cells", Clinical and Basic Immunodermatology, pp. 85-104, (Gaspari and Tyring (ed.)), Springer London (2008), which is incorporated by reference in its entirety. As used herein, a "non-conventional T cell" is a lymphocyte that expresses a γδ TCR and can typically reside in epithelial environments, such as the skin, gastrointestinal tract or urogenital tract. Another subset of non-conventional T cells is the invariant natural killer T ("NKT") cell, which has the phenotype and functional capabilities of conventional T cells, as well as the characteristics of natural killer cells (e.g., cytotoxic activity). See ibid. As used herein, regulatory T cells ("Tregs") are a subpopulation of T cells that modulate the immune system, maintain tolerance to self-antigens, reverse autoimmune disease, and suppress otherwise immune stimulation or activate other cellular responses. Tregs come in many forms, but the best understood are those that express CD4, CD25, and Foxp3. As used herein, "natural Tregs" or "nTregs" refer to Tregs or cells that develop in the thymus. As used herein, "induced Tregs" or "iTregs" refer to Tregs or cells that develop from mature CD4+ conventional T cells outside the thymus.
[0177] The "activity" of Akt3 refers to the biological function of Akt3 protein. Biological activity can be increased or decreased by increasing or decreasing the basal level activity of protein, by increasing or decreasing the basal level avidity of protein, the amount of protein, the ratio of Akt3 to one or more other isoforms of Akt protein (e.g., Akt1 or Akt2), by increasing or decreasing the expression level of protein (including increasing or decreasing the mRNA expression of Akt3), or by combinations thereof. For example, a biologically available Akt3 protein is a protein that has kinase activity and can bind and phosphorylate Akt3 substrates. A non-biologically available Akt3 protein includes Akt3 protein that is mislocalized or cannot bind and phosphorylate Akt substrates.
[0178] In some embodiments, the disclosed compounds selectively modulate Akt3 compared to Akt1 and Akt2. In some embodiments, any one of the disclosed compounds does not modulate Akt1 and Akt2 to a statistically significant extent. In other embodiments, the modulation of Akt3 by the disclosed compounds is about 5-fold, about 10-fold, about 15-fold, about 50-fold, about 100-fold, about 1000-fold, or about 5000-fold greater than their modulation of Akt1 and / or Akt2.
[0179] As used herein, the term "peptide" or "polypeptide" refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation). The term includes proteins and fragments thereof. A polypeptide may be "exogenous," meaning that the polypeptide is "heterologous," i.e., foreign to the host cell in which it is utilized, e.g., a human polypeptide produced by a bacterial cell. Polypeptides are disclosed herein as amino acid residue sequences. The sequences are written in a left-to-right orientation from amino to carboxy terminus. According to standard nomenclature, amino acid residue sequences are designated by either the three letter or one letter code shown as follows: alanine (Ala, A), arginine (Arg, R), asparagine (Asn, N), aspartic acid (Asp, D), cysteine (Cys, C), glutamine (Gln, Q), glutamic acid (Glu, E), glycine (Gly, G), histidine (His, H), isoleucine (Ile, I), leucine (Leu, L), lysine (Lys, K), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W), tyrosine (Tyr, Y), and valine (Val, V).
[0180] The term "stimulate expression of" means to affect the expression of, e.g., to induce expression or activity or to induce increased / greater expression or activity compared to normal, healthy controls.
[0181] The terms "immune activating response", "activating immune response" and "immune stimulating response" refer to responses that initiate, induce, enhance or increase the activation or efficiency of innate or adaptive immunity. Such immune responses include, for example, the generation of beneficial humoral (antibody-mediated) and / or cellular (mediated by antigen-specific T cells or their secretions) responses directed against the peptide in the recipient patient. Such responses can be active responses elicited by administration of an immunogen or passive responses elicited by administration of antibodies or primed T cells. Cellular immune responses are elicited by presenting polypeptide epitopes in conjunction with class I or class II major histocompatibility complex ("MHC") molecules to activate antigen-specific CD4+ T helper cells and / or CD8+ cytotoxic T cells. Responses can also include activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglial cells, eosinophils, activation or recruitment of neutrophils or other components of innate immunity. The presence of a cell-mediated immunological response can be determined by proliferation assays (CD4+ T cells) or cytotoxic T lymphocyte ("CTL") assays. The relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by isolating antibodies and T cells separately from an immunized syngeneic animal and measuring the protective or therapeutic effect in a second subject.
[0182] An "inhibitory immune response" and an "immunosuppressive response" refer to a response that reduces or prevents the activation or efficiency of innate or adaptive immunity.
[0183] The term "immune tolerance" refers to any mechanism that prevents, suppresses, or shifts a potentially harmful immune response toward a non-harmful immune response (see Bach, et al., N. Eng. J. Med., 347:911-920 (2002)).
[0184] The term "immunogenic agent" or "immunogen" refers to an agent that is capable of eliciting an immunological response upon administration to a mammal, optionally in combination with an adjuvant.
[0185] compound In one embodiment, compounds of formula I are described as Akt3 modulators. Applicants have surprisingly discovered that the compounds disclosed herein modulate Akt3 activity, e.g., activate or inhibit Akt3 activity and / or downstream events, depending on their structure and substitution.
[0186] In one embodiment, formula I [ka] [During the ceremony, [ka] teeth, [ka] and each occurrence of X1, X2, X3, X4, X5, X6, X7, X8, and X9 is independently CR1 or N; Each occurrence of R1 is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C 10 ) Bicycloalkyl, (C4-C 14 )tricycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 14 )Heterotricycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10)Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 ) Heterotricycloalkenyl, aryl, heteroaryl, -OR a , -SR a , -N(R a )2, -COR a , -CO2R a , -CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] and one or more of (C1-C6) alkyl, halogenated (C1-C6) alkyl, -SO2R a or -SO2N(R a ) 2 is optionally substituted with a partially saturated bicyclic heteroaryl; R1 is (C3-C7)cycloalkyl, (C4-C 10 ) Bicycloalkyl, (C4-C 14 )tricycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 14 )Heterotricycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 ) Heterotricycloalkenyl, aryl and heteroaryl are each selected from one or more of (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a )2, each of which is appropriately replaced, n is an integer of 0 to 4 permitted by the valence; Q is C(R a )2, O, NR a , N(C=O)R a or NSO2R a and Y1, Y2, Y3, Y4 and Y5 are each independently N or CR2, as permitted by valence, provided that the moiety [ka] is bonded to Y3 or Y5 and the moiety [ka] when bonded to, Y3 or Y5 is C; Each occurrence of R2 is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C 10 )bicycloalkyl, (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 10 )Heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, heteroaryl, -OR a , -SR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] is selected from the group consisting of Each occurrence of R4 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, heteroaryl, -OR a and -N(R a ) 2 selected from the group consisting of Each occurrence of R5 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, heteroaryl, -OR a and -N(R a ) 2 or or any two R groups bonded to two adjacent carbon atoms, taken together with the two adjacent carbon atoms to which they are bonded, form an optionally substituted (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, or halogenated (C3-C7)heterocycloalkyl; m is an integer from 0 to 3; R6 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl or heteroaryl; [ka] teeth, [ka] and Z is CR3 or N; W is O, NR8 or S, R8 is H, (C1-C6)alkyl, (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, aryl or heteroaryl; Each occurrence of R3 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, -ORa, -N(R a )2, -COR a , -CO2R a , -CON(R a )2, -CN, -NC or -NO2; Each occurrence of R7 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, -ORa, -SR a , -N(R a )2, -COR a , -CO2R a , -CON(R a )2, -CN, -NC, -NO2, -N3, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] selected from the group consisting of optionally substituted aryl and optionally substituted heteroaryl; or any two R7 groups together with the carbon atoms to which they are attached form a (C3-C7)cycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, or heteroaryl; p is an integer of 0 to 3 allowed by the valence; R a Each occurrence of is independently H, (C1-C6) alkyl, (C2-C6) alkenyl, (C3-C7) cycloalkyl, aryl, or heteroaryl, or two R a together form a 4- to 6-membered ring optionally substituted with halogen or (C1-C6) alkyl. or a pharma- ceutically acceptable salt thereof is described.
[0187] In some embodiments, [ka] teeth [ka] In some embodiments, [ka] teeth [ka] In some embodiments, [ka] teeth [ka] It is.
[0188] In some embodiments, Q is C(R a )2, O or NR a In some embodiments, Q is O. In some embodiments, Q is NR a In some embodiments, Q is NH. In some embodiments, Q is NCH3 or NCH2CH3. In some embodiments, Q is N(C=O)R a or NSO2R a In some embodiments, Q is N(C=O)H. In some embodiments, Q is N(C=O)CH3 or N(C=O)CH2CH3. In some embodiments, Q is NSO2H. In some embodiments, Q is NSO2CH3 or NSO2CH2CH3.
[0189] In some embodiments, n is 0, 1, 2, 3 or 4. In some embodiments, n is 0. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4.
[0190] In some embodiments, [ka] teeth [ka] In some embodiments, X2, X3 and X4 are each independently CR1 or N. In some embodiments, X2, X3 and X4 are CR1. In some embodiments, X2, X3 and X4 are CH. In some embodiments, one of X2, X3 and X4 is N and the remaining is CR1. In some embodiments, one of X2, X3 and X4 is N and the remaining is CH. In some embodiments, two of X2, X3 and X4 are N and the remaining is CR1. In some embodiments, two of X2, X3 and X4 are N and the remaining is CH.
[0191] In some embodiments, the structural moiety [ka] teeth, [ka] It has the structure:
[0192] In some embodiments, the structural moiety [ka] teeth, [ka] It has the structure:
[0193] In some embodiments, the structural moiety [ka] teeth, [ka] It has the structure:
[0194] In some embodiments, X1, X2, X3, X4, X5, X6 and X7 are each independently CR1 or N. In some embodiments, X1, X2, X3, X4, X5, X6 and X7 are CR1. In some embodiments, X1, X2, X3, X4, X5, X6 and X7 are each independently CH or CCH3. In some embodiments, one of X1, X2, X3, X4, X5, X6 and X7 is N and the rest are CR1. In some embodiments, one of X1, X2, X3, X4, X5, X6 and X7 is N and the rest are each independently CH or CCH3. In some embodiments, two of X1, X2, X3, X4, X5, X6 and X7 are N and the rest are CR1. In some embodiments, two of X1, X2, X3, X4, X5, X6, and X7 are N, and the remaining are each independently CH or CCH3. In some embodiments, three of X1, X2, X3, X4, X5, X6, and X7 are N, and the remaining are CR1. In some embodiments, three of X1, X2, X3, X4, X5, X6, and X7 are N, and the remaining are each independently CH or CCH3. In some embodiments, four of X1, X2, X3, X4, X5, X6, and X7 are N, and the remaining are CR1. In some embodiments, four of X1, X2, X3, X4, X5, X6, and X7 are N, and the remaining are each independently CH or CCH3. In some embodiments, X2 is N, X7 is CR, and X1, X3, X4, X5, and X6 are each independently CH or CCH3. In some embodiments, X2 is N, X7 is CR1, X3 is CCH3, and X1, X4, X5, and X6 are CH. In some embodiments, X2 and X7 are N, and X1, X3, X4, X5, and X6 are CR1. In some embodiments, X2 and X7 are N, and X1, X3, X4, X5, and X6 are each independently CH or CCH3.
[0195] In some embodiments, X2, X3, X4, X8, and X9 are each independently CR1 or N. In some embodiments, X2, X3, X4, X8, and X9 are CR1. In some embodiments, X2, X3, X4, X8, and X9 are each independently CH or CCH3. In some embodiments, one of X2, X3, X4, X8, and X9 is N, and the remaining is CR1. In some embodiments, one of X2, X3, X4, X8, and X9 is N, and the remaining is each independently CH or CCH3. In some embodiments, two of X2, X3, X4, X8, and X9 are N, and the remaining is CR1. In some embodiments, two of X2, X3, X4, X8, and X9 are N, and the remaining is each independently CH or CCH3. In some embodiments, three of X2, X3, X4, X8, and X9 are N, and the remaining is CR1. In some embodiments, three of X2, X3, X4, X8 and X9 are N, and the remaining are each independently CH or CCH3. In some embodiments, four of X2, X3, X4, X8 and X9 are N, and one is CR1. In some embodiments, four of X2, X3, X4, X8 and X9 are N, and one is CH or CCH3.
[0196] In some embodiments, the structural moiety [ka] teeth, [ka] It has the structure:
[0197] In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, Q is O. In some embodiments, Q is NRa , N(C=O)R a or NSO2R a In some embodiments, Q is NH. In some embodiments, Q is NCH3 or NCH2CH3.
[0198] In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, Q is O. In some embodiments, Q is NR a , N(C=O)R a or NSO2R a In some embodiments, Q is NH. In some embodiments, Q is NCH3 or NCH2CH3.
[0199] In some embodiments, the structural moiety [ka] teeth, [ka] It has the structure:
[0200] In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0201] In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, Q is O. In some embodiments, Q is NR a , N(C=O)R a or NSO2R a In some embodiments, Q is NH. In some embodiments, Q is NCH3 or NCH2CH3.
[0202] In some embodiments, each occurrence of R is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C7) alkoxy, (C5-C8) alkoxy, (C6-C9) alkoxy, (C7-C10) alkoxy, (C8-C11) alkoxy, (C9-C12) alkoxy, (C10-C13) alkoxy, (C10-C14) alkoxy, (C10-C15) alkoxy, (C10-C16) alkoxy, (C10-C17) alkoxy, (C10-C18) alkoxy, (C10-C19) 10 ) Bicycloalkyl, (C4-C 14 )tricycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 14 )Heterotricycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 ) Heterotricycloalkenyl, aryl, heteroaryl, -OR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2 and -N(R a )SO2R a (C3-C7)cycloalkyl, (C4-C 10 ) Bicycloalkyl, (C4-C 14 )tricycloalkyl, (C3-C7)heterocycloalkyl, halogenated (C3-C7)heterocycloalkyl, (C4-C10 )Heterobicycloalkyl, (C4-C 14 )Heterotricycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 )heterotricycloalkenyl, aryl, and heteroaryl are each optionally substituted with one or more (C1-C6)alkyl. In some embodiments, each occurrence of R1 is independently selected from (C1-C6)alkyl, (C1-C6)haloalkyl, (C2-C6)alkenyl, (C2-C6)haloalkenyl, (C2-C6)alkynyl, (C2-C6)haloalkynyl, (C3-C7)cycloalkyl, (C4-C7)cycloalkyl, (C5-C7)cycloalkyl, (C6-C7)cycloalkyl, (C7-C7)cycloalkyl, (C8-C8)cycloalkyl, (C9-C9)cycloalkyl, (C10-C10)cycloalkyl, (C11-C10)cycloalkyl, (C12-C12)cycloalkyl, (C13-C13)cycloalkyl, (C14-C14)cycloalkyl, (C15-C15)cycloalkyl, (C16-C16)cycloalkyl, (C17-C17)cycloalkyl, (C18-C18)cycloalkyl, (C19-C19)cycloalkyl, (C20-C20)cycloalkyl, (C21-C20)cycloalkyl, (C22-C20)cycloalkyl, (C23-C20)cycloalkyl, (C24-C20)cycloalkyl, (C25-C20)cycloalkyl, (C26-C20)cycloalkyl, (C27-C20)cycloalkyl, (C28-C20)cycloalkyl, (C29-C30)cycloalkyl, (C31-C30)cycloalkyl, (C21-C20)cycloalkyl, (C22-C20)cycloalkyl, (C23-C20)cycloalkyl, (C24-C20)cycloalkyl, (C25-C20)cycloalkyl, (C26-C20)cycloalkyl, ( 10 )bicycloalkyl, (C3-C7)heterocycloalkyl and (C4-C 10 )heterobicycloalkyl; (C3-C7)cycloalkyl, (C4-C 10 )bicycloalkyl, (C3-C7)heterocycloalkyl and (C4-C 10 )heterobicycloalkyl is optionally substituted with one or more (C1-C6)alkyl. In some embodiments, each occurrence of R is independently selected from the group consisting of (C4-C 10 )heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl and heteroaryl; (C4-C 10 )heterospiroalkyl, aryl, and heteroaryl are each optionally substituted with one or more (C1-C6)alkyl. In some embodiments, each occurrence of R is independently selected from (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 )Tricycloalkyl, (C4-C 14)heterotricycloalkyl or (C4-C 14 In some embodiments, each occurrence of R is independently -OR a , -SR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2 and -N(R a )SO2R a In some embodiments, each occurrence of R1 is independently an optionally substituted (C3-C7)cycloalkenyl or an optionally substituted (C3-C7)heterocycloalkenyl. In some embodiments, each occurrence of R1 is independently an optionally substituted (C4-C 10 ) bicycloalkenyl or optionally substituted (C4-C 10 In some embodiments, each occurrence of R is independently an optionally substituted (C4-C 14 )tricycloalkenyl or optionally substituted (C4-C 14 In some embodiments, each occurrence of R is independently an optionally substituted (C4-C 14 ) tricycloalkyl or optionally substituted (C4-C 14 ) heterotricycloalkyl. In some embodiments, each occurrence of R is independently [ka] In some embodiments, each occurrence of R is independently selected from the group consisting of H, D, halogen, OR a , N(R a )2, (C1-C6) alkyl, (C3-C7) heterocycloalkyl, (C4-C 10 )Heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, (C1-C6)alkynyl, aryl, (C4-C 10) Bicycloalkyl, -CN, -NC, N3, NO2, COR a , CO2R a , CON(R a )2, -SO2R a or -SO2N(R a )2, (C3-C7)heterocycloalkyl, (C4-C 10 ) Heterospiroalkyl, aryl and (C4-C 10 )bicycloalkyl is optionally substituted with one or more (C1-C6)alkyl. In some embodiments, each occurrence of R is independently selected from H, D, halogen, (C1-C6)alkyl, (C3-C7)heterocycloalkyl, (C4-C 10 )heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, N(R a )2 or -CN, (C3-C7)heterocycloalkyl and (C4-C 10 )heterospiroalkyl is optionally substituted with one or more (C1-C6)alkyl. In some embodiments, each occurrence of R is independently selected from H, (C1-C6)alkyl, (C1-C6)alkynyl, aryl, (C4-C 10 ) Bicycloalkyl, -SO2R a or -SO2N(R a ) 2, and aryl and (C4-C 10 )bicycloalkyl is optionally substituted with one or more (C1-C6)alkyl. In some embodiments, at least one occurrence of R1 is optionally substituted with one or more (C4-C6)alkyl. 10 )heterospiroalkyl. In some embodiments, at least one occurrence of R1 is a halogenated (C3-C7)heterocycloalkyl optionally substituted with one or more (C1-C6)alkyl. In some embodiments, each occurrence of R1 is independently H, D, F, Cl, Br, CH3, OCH3, NH2, NHCH3, N(CH3)2, [ka] [In the formula, R a' is H or (C1-C6)alkyl. In some embodiments, each occurrence of R1 is independently H, D, F, CH3, N(CH3)2, [ka] (In the formula, R a ' is H or (C1-C6)alkyl. In some embodiments, each occurrence of R1 is independently [ka] (In the formula, R a ' is H or (C1-C6)alkyl. In some embodiments, each occurrence of R1 is independently [ka] It is.
[0203] In some embodiments, R1 is (C3-C7)cycloalkyl, (C4-C 10 )bicycloalkyl, (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 10 )heterospiroalkyl, (C3-C7)cycloalkenyl, (C3-C7)heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) Tricycloalkenyl, (C4-C 14 )heterotricycloalkenyl, (C4-C 14 )Tricycloalkyl, (C4-C 14 )Heterotricycloalkyl, aryl and heteroaryl are each independently one or more halogen, (C1-C6) alkyl, -OR a , -CN or -N(R a )2, each of which has been replaced appropriately.
[0204] In some embodiments, at least one occurrence of R is selected from one or more of (C1-C6) alkyl, halogenated (C1-C6) alkyl, -SO2R aor -SO2N(R a In some embodiments, at least one occurrence of R is optionally substituted with 2. [ka] In some embodiments, [ka] teeth, [ka] It is.
[0205] In some embodiments, at least one occurrence of R1 is H, D or halogen. In some embodiments, at least one occurrence of R1 is F. In some embodiments, at least one occurrence of R1 is H. In some embodiments, at least one occurrence of R1 is D. In some embodiments, at least one occurrence of R1 is CH3. In some embodiments, at least one occurrence of R1 is OCH3. In some embodiments, at least one occurrence of R1 is NH2. In some embodiments, at least one occurrence of R1 is NHCH3. In some embodiments, at least one occurrence of R1 is N(CH3)2. In some embodiments, at least one occurrence of R1 is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] (In the formula, R a ' is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R1 is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] (In the formula, R a ' is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R1 is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R1 is -CN. In some embodiments, at least one occurrence of R1 is -NC. In some embodiments, at least one occurrence of R1 is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R is [ka] In some embodiments, at least one occurrence of R1 is NO2. In some embodiments, at least one occurrence of R1 is N3. In some embodiments, at least one occurrence of R1 is [ka] In some embodiments, at least one occurrence of R is [ka] It is.
[0206] In some embodiments, at least one occurrence of R is [ka] and X is CR 15 , O, N.R. 14 or S, and each occurrence of R9 is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a )2, and R 14 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl or heteroaryl; R 15 each occurrence is independently selected from H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a ) 2 and q is 0, 1, 2 or 3.
[0207] In some embodiments, X is O. In some embodiments, X is S. In some embodiments, X is CR 15 In some embodiments, X is NR 14 It is.
[0208] In some embodiments, each occurrence of R is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a)2. In some embodiments, each occurrence of R9 is independently H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, or halogen. In some embodiments, each occurrence of R9 is independently H, F, Cl, Br, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2. In some embodiments, each occurrence of R9 is independently H, F, Cl, Br, or CH3.
[0209] In some embodiments, R 15 each occurrence is independently selected from H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a In some embodiments, R 15 Each occurrence of is independently H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, or halogen. 15 Each occurrence of is independently H, F, Cl, Br, CH, CF, OH, NH, -NHCH, or -N(CH). 15 Each occurrence is independently H, F, Cl, Br, or CH3.
[0210] In some embodiments, q is 0. In some embodiments, q is 1. In some embodiments, q is 2. In some embodiments, q is 3.
[0211] In some embodiments, R 14 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, or heteroaryl. 14 is H, (C1-C6) alkyl, or (C3-C7) cycloalkyl. In some embodiments, R 14 is H or (C1-C6) alkyl. In some embodiments, R 14 is H or CH3.
[0212] In some embodiments, at least one occurrence of R is [ka] and X is O or NR 14 and R 14 is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R1 is [ka] It is.
[0213] In some embodiments, [ka] teeth, [ka] and R 12 is (C3-C7) cycloalkenyl, (C3-C7) heterocycloalkenyl, (C4-C 10 )bicycloalkenyl, (C4-C 10 )Heterobicycloalkenyl, (C4-C 14 ) tricycloalkenyl or (C4-C 14 )heterotricycloalkenyl, each of which is selected from one or more of (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -ORa, -CN, or -N(R a In some embodiments, R 12 teeth, [ka] and X is CR 15 , O, N.R. 14 or S, and each occurrence of R9 is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a )2, and R 14 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl or heteroaryl; R15 each occurrence is independently selected from H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a ) 2 and q is 0, 1, 2 or 3.
[0214] In some embodiments, X is O. In some embodiments, X is S. In some embodiments, X is CR 15 In some embodiments, X is NR 14 It is.
[0215] In some embodiments, each occurrence of R is independently H, (C1-C6)alkyl, halogenated (C1-C6)alkyl, halogen, -OR a , -CN or -N(R a )2. In some embodiments, each occurrence of R9 is independently H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, or halogen. In some embodiments, each occurrence of R9 is independently H, F, Cl, Br, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2. In some embodiments, each occurrence of R9 is independently H, F, Cl, Br, or CH3.
[0216] In some embodiments, R 15 each occurrence is independently selected from H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, halogen, -OR a , -CN or -N(R a In some embodiments, R 15 Each occurrence of is independently H, (C1-C6) alkyl, halogenated (C1-C6) alkyl, or halogen. 15 Each occurrence of is independently H, F, Cl, Br, CH, CF, OH, NH, -NHCH, or -N(CH). 15 Each occurrence is independently H, F, Cl, Br, or CH3.
[0217] In some embodiments, q is 0. In some embodiments, q is 1. In some embodiments, q is 2. In some embodiments, q is 3.
[0218] In some embodiments, R 14 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, or heteroaryl. 14 is H, (C1-C6) alkyl, or (C3-C7) cycloalkyl. In some embodiments, R 14 is H or (C1-C6) alkyl. In some embodiments, R 14 is H or CH3.
[0219] In some embodiments, R 12 At least one occurrence of [ka] and X is O or NR 14 and R 14 is H or (C1-C6) alkyl. In some embodiments, R 12 At least one occurrence of [ka] It is.
[0220] In some embodiments, the structural moiety [ka] teeth, [ka] [ka] [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0221] In some embodiments, the structural moiety [ka] teeth, [ka] [ka] [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] where Q is O or NH.
[0222] In some embodiments, the structural moiety [ka] teeth, [ka] wherein Q is O or NH and R1 is H, (C1-C6) alkyl, (C3-C7) heterocycloalkyl, halogenated (C3-C7) heterocycloalkyl or halogen. [ka] teeth, [ka] wherein Q is O or NH and R1 is H, D, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, F, Cl, or Br. [ka] teeth, [ka] where Q is O or NH and R1 is methyl or Cl.
[0223] In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] where Q is O or NH.
[0224] In some embodiments, the structural moiety [ka] teeth, [ka] and Q is O or NH. In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, Q is O or NH.
[0225] In some embodiments, the compound has the structure of formula Ia.
[0226] In some embodiments, Y1, Y2, Y3, Y4 and Y5 are each independently CR2 or N. In some embodiments, Y1, Y2, Y3, Y4 and Y5 are each CR2. In some embodiments, Y1, Y2, Y3, Y4 and Y5 are each CH. In some embodiments, Y1, Y2, Y3, Y4 and Y5 are each N. In some embodiments, one of Y1, Y2, Y3, Y4 and Y5 is CR2 and the remaining is N. In some embodiments, one of Y1, Y2, Y3, Y4 and Y5 is CH and the remaining is N. In some embodiments, two of Y1, Y2, Y3, Y4 and Y5 are CR2 and the remaining is N. In some embodiments, two of Y1, Y2, Y3, Y4 and Y5 are CH and the remaining is N. In some embodiments, three of Y1, Y2, Y3, Y4, and Y5 are CR2, and two of Y1, Y2, Y3, Y4, and Y5 are N. In some embodiments, three of Y1, Y2, Y3, Y4, and Y5 are CH, and two of Y1, Y2, Y3, Y4, and Y5 are N.
[0227] In some embodiments, the structural moiety [ka] is bound to Y5 and has the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0228] In some embodiments, the structural moiety [ka] is bonded to Y1, and the structural moiety [ka] teeth [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0229] In some embodiments, each occurrence of R2 is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C7) alkoxy, (C5-C8) alkoxy, (C6-C9) alkoxy, (C7-C10) alkoxy, (C8-C11) alkoxy, (C9-C12) alkoxy, (C10-C13) alkoxy, (C10-C14) alkoxy, (C10-C15) alkoxy, (C10-C16) alkoxy, (C10-C17) alkoxy, (C10-C18) alkoxy, (C10-C19) 10 )bicycloalkyl, (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 10 )Heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, heteroaryl, -OR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2 and -N(R a )SO2R a In some embodiments, each occurrence of R2 is independently selected from the group consisting of: (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C 10 )bicycloalkyl, (C3-C7)heterocycloalkyl and (C4-C 10 In some embodiments, each occurrence of R2 is independently selected from the group consisting of (C4-C 10 )heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, and heteroaryl. In some embodiments, each occurrence of R2 is independently selected from the group consisting of -OR a , -SR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2 and -N(R a)SO2R a In some embodiments, each occurrence of R2 is independently selected from the group consisting of: [ka] In some embodiments, each occurrence of R2 is independently selected from the group consisting of H, D, halogen, OR a , N(R a )2, (C1-C6) alkyl, (C3-C7) heterocycloalkyl, (C1-C6) alkynyl, aryl, (C4-C 10 ) Bicycloalkyl, -CN, -NC, N3, NO2, COR a , CO2R a , CON(R a )2, -SO2R a or -SO2N(R a In some embodiments, each occurrence of R is independently H, D, halogen, (C1-C6)alkyl, (C3-C7)heterocycloalkyl, N(R a )2 or -CN. In some embodiments, each occurrence of R2 is independently H, (C1-C6) alkyl, (C1-C6) alkynyl, aryl, (C4-C 10 ) Bicycloalkyl, -SO2R a or -SO2N(R a In some embodiments, each occurrence of R2 is independently H, D, F, Cl, Br, CH3, OCH3, NH2, N(CH3)2, [ka] In some embodiments, each occurrence of R2 is independently H, D, F, CH3, N(CH3)2, [ka] It is.
[0230] In some embodiments, at least one occurrence of R2 is H, D or halogen. In some embodiments, at least one occurrence of R2 is H. In some embodiments, at least one occurrence of R2 is D. In some embodiments, at least one occurrence of R2 is F. In some embodiments, at least one occurrence of R2 is CH3. In some embodiments, at least one occurrence of R2 is OCH3. In some embodiments, at least one occurrence of R2 is NH2. In some embodiments, at least one occurrence of R2 is N(CH3)2. In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] [In the formula, R a ' is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] [In the formula, R a ' is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is -CN. In some embodiments, at least one occurrence of R2 is -NC. In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is NO2. In some embodiments, at least one occurrence of R2 is N3. In some embodiments, at least one occurrence of R2 is [ka] In some embodiments, at least one occurrence of R2 is [ka] It is.
[0231] In some embodiments, each occurrence of R is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, -N(R a )2, NO2 and -OR a In some embodiments, each occurrence of R2 is independently H, halogen, CH3, CF3, OH, NH2, -NHCH3, or -N(CH3)2. In some embodiments, at least one occurrence of R2 is H. In some embodiments, at least one occurrence of R2 is (C1-C6) alkyl. In some embodiments, at least one occurrence of R2 is -N(R a )2, NO2 or -OR a In some embodiments, at least one occurrence of R2 is H, CH3, OH, NH2, or halogen. In some embodiments, at least one occurrence of R2 is H. In some embodiments, at least one occurrence of R2 is CF3. In some embodiments, R2 is H or CH3.
[0232] In some embodiments, the moiety [ka] is bound to Y5 and has the structural moiety [ka] teeth [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0233] In some embodiments, the moiety [ka] is attached to Y3 and is a structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0234] In some embodiments, m is 0. In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, m is 2 or 3.
[0235] In some embodiments, each occurrence of R4 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, heteroaryl, -OR a and -N(R a )2. In some embodiments, each occurrence of R4 is independently selected from the group consisting of: (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, and (C3-C7) heterocycloalkyl. In some embodiments, each occurrence of R4 is independently aryl or heteroaryl. In some embodiments, each occurrence of R4 is independently -ORa or -N(R aIn some embodiments, each occurrence of R is independently H, halogen, (C1-C6)alkyl, (C3-C7)heterocycloalkyl, or N(R a In some embodiments, each occurrence of R4 is independently H, F, Cl, Br, CH3, OCH3, NH2, N(CH3)2, [ka] In some embodiments, each occurrence of R4 is independently H, F, CH3, N(CH3)2, [ka] It is.
[0236] In some embodiments, at least one occurrence of R4 is H or halogen. In some embodiments, at least one occurrence of R4 is H. In some embodiments, at least one occurrence of R4 is F. In some embodiments, at least one occurrence of R4 is CH3. In some embodiments, at least one occurrence of R4 is OCH3. In some embodiments, at least one occurrence of R4 is NH2. In some embodiments, at least one occurrence of R4 is N(CH3)2. In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] [In the formula, R a ' is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] In some embodiments, at least one occurrence of R4 is [ka] It is.
[0237] In some embodiments, each occurrence of R is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, -N(R a )2, NO2 and -OR aIn some embodiments, at least one occurrence of R4 is H, CH3, OH, NH2, or halogen. In some embodiments, at least one occurrence of R4 is H or CH3. In some embodiments, at least one occurrence of R4 is OH or NH2. In some embodiments, at least one occurrence of R4 is halogen. In some embodiments, at least one occurrence of R4 is H. In some embodiments, at least one occurrence of R4 is CF3. In some embodiments, R4 is H or CH3.
[0238] In some embodiments, any two R groups bonded to two adjacent carbons, together with the two adjacent carbon atoms to which they are bonded, form a (C-C)cycloalkyl, a (C-C)heterocycloalkyl, or a halogenated (C-C)heterocycloalkyl.
[0239] In some embodiments, each occurrence of R5 is independently selected from H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, heteroaryl, -OR a and -N(R a )2. In some embodiments, each occurrence of R5 is independently selected from the group consisting of: (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, and (C3-C7) heterocycloalkyl. In some embodiments, each occurrence of R5 is independently aryl or heteroaryl. In some embodiments, each occurrence of R5 is independently -ORa or -N(R a In some embodiments, each occurrence of R is independently H, halogen, (C1-C6)alkyl, (C3-C7)heterocycloalkyl, or N(R aIn some embodiments, each occurrence of R5 is independently H, F, Cl, Br, CH3, OCH3, NH2, N(CH3)2, [ka] In some embodiments, each occurrence of R5 is independently H, F, CH3, N(CH3)2, [ka] It is.
[0240] In some embodiments, at least one occurrence of R5 is H or halogen. In some embodiments, at least one occurrence of R5 is H. In some embodiments, at least one occurrence of R5 is F. In some embodiments, at least one occurrence of R5 is CH3. In some embodiments, at least one occurrence of R5 is OCH3. In some embodiments, at least one occurrence of R5 is NH2. In some embodiments, at least one occurrence of R5 is N(CH3)2. In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] (In the formula, R a ' is H or (C1-C6) alkyl. In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] In some embodiments, at least one occurrence of R5 is [ka] It is.
[0241] In some embodiments, each occurrence of R is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, -N(R a)2, NO2 and -ORa. In some embodiments, at least one occurrence of R5 is H, CH3, OH, NH2 or halogen. In some embodiments, at least one occurrence of R5 is H or CH3. In some embodiments, at least one occurrence of R5 is OH or NH2. In some embodiments, at least one occurrence of R5 is halogen. In some embodiments, at least one occurrence of R5 is H. In some embodiments, at least one occurrence of R5 is CF3. In some embodiments, R5 is H or CH3.
[0242] In some embodiments, R6 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, or heteroaryl. In some embodiments, R6 is H or (C1-C6) alkyl. In some embodiments, R6 is (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, or heteroaryl. In some embodiments, R6 is H, CH3, CH2CH3, CH(CH3)2, [ka] In some embodiments, R6 is H or CH3. In some embodiments, R6 is H. In some embodiments, R6 is CF3.
[0243] In some embodiments, the structural moiety [ka] teeth, [ka] and the Y ring is a (C3-C7)cycloalkyl. [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0244] In some embodiments, [ka] teeth, [ka] In some embodiments, [ka] teeth, [ka] In some embodiments, [ka] teeth, [ka] In some embodiments, Z is CR3. In some embodiments, Z is N. In some embodiments, W is O. In some embodiments, W is S. In some embodiments, W is NR8.
[0245] In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0246] In some embodiments, the structural moiety [ka] teeth, [ka] In some embodiments, the structural moiety has the structure: [ka] teeth, [ka] It has the structure:
[0247] In some embodiments, each occurrence of R is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, -ORa, -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, or N3. In some embodiments, each occurrence of R3 is independently selected from the group consisting of (C1-C6)alkyl, (C1-C6)haloalkyl, (C2-C6)alkenyl, (C2-C6)haloalkenyl, (C2-C6)alkynyl, and (C2-C6)haloalkynyl. In some embodiments, each occurrence of R3 is independently selected from the group consisting of -ORa, -SR a , -N(R a )2, -COR a , -CO2R a , CON(R a In some embodiments, each occurrence of R is independently selected from the group consisting of H, D, halogen, (C1-C6)alkyl, N(R a In some embodiments, each occurrence of R is independently H, D, F, Cl, Br, CH, OCH, NH, N(CH), [ka] In some embodiments, each occurrence of R is independently H, D, F, CH, or N(CH).
[0248] In some embodiments, at least one occurrence of R3 is H, D, or halogen. In some embodiments, at least one occurrence of R3 is H. In some embodiments, at least one occurrence of R3 is D. In some embodiments, at least one occurrence of R3 is F. In some embodiments, at least one occurrence of R3 is CH3. In some embodiments, at least one occurrence of R3 is OCH3. In some embodiments, at least one occurrence of R3 is NH2. In some embodiments, at least one occurrence of R3 is N(CH3)2. In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is -CN. In some embodiments, at least one occurrence of R3 is -NC. In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is [ka] In some embodiments, at least one occurrence of R3 is NO2. In some embodiments, at least one occurrence of R3 is N3.
[0249] In some embodiments, each occurrence of R is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, -N(R a )2, NO2 and -ORa. In some embodiments, at least one occurrence of R3 is H, CH3, OH, NH2 or halogen. In some embodiments, at least one occurrence of R3 is H or CH3. In some embodiments, at least one occurrence of R3 is OH or NH2. In some embodiments, at least one occurrence of R3 is halogen. In some embodiments, at least one occurrence of R3 is H. In some embodiments, at least one occurrence of R3 is CF3. In some embodiments, R3 is H or CH3.
[0250] In some embodiments, each occurrence of R7 is independently selected from H, D, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C7) alkoxy, (C5-C8) alkoxy, (C6-C9) alkoxy, (C7-C10) alkoxy, (C8-C11) alkoxy, (C9-C12) alkoxy, (C10-C13) alkoxy, (C10-C14) alkoxy, (C10-C15) alkoxy, (C10-C16) alkoxy, (C10-C17) alkoxy, (C10-C18) alkoxy, (C10-C19) alkoxy, (C10-C20 ... 10 )bicycloalkyl, (C3-C7)heterocycloalkyl, (C4-C 10 )Heterobicycloalkyl, (C4-C 10 )Heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, heteroaryl, -ORa, -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2 and -N(Ra )SO2R a In some embodiments, each occurrence of R7 is independently selected from the group consisting of: (C1-C6) alkyl, (C1-C6) haloalkyl, (C2-C6) alkenyl, (C2-C6) haloalkenyl, (C2-C6) alkynyl, (C2-C6) haloalkynyl, (C3-C7) cycloalkyl, (C4-C 10 )bicycloalkyl, (C3-C7)heterocycloalkyl and (C4-C 10 In some embodiments, each occurrence of R7 is independently selected from the group consisting of (C4-C 10 ) heterospiroalkyl, halogenated (C3-C7)heterocycloalkyl, aryl, and heteroaryl. In some embodiments, each occurrence of R7 is independently selected from the group consisting of -ORa, -SR a , -N(R a )2, -COR a , -CO2R a , CON(R a )2, -CN, -NC, NO2, N3, -SO2R a , -SO2N(R a )2 and -N(R a )SO2R a In some embodiments, each occurrence of R7 is independently selected from the group consisting of: [ka] In some embodiments, each occurrence of R7 is independently selected from the group consisting of H, D, halogen, OR a , N(R a )2, (C1-C6) alkyl, (C3-C7) heterocycloalkyl, (C1-C6) alkynyl, aryl, (C4-C 10 ) Bicycloalkyl, -CN, -NC, N3, NO2, COR a , CO2R a , CON(R a )2, -SO2R a or -SO2N(R aIn some embodiments, each occurrence of R is independently H, D, halogen, (C1-C6)alkyl, (C3-C7)heterocycloalkyl, N(R a )2 or -CN. In some embodiments, each occurrence of R7 is independently H, (C1-C6) alkyl, (C1-C6) alkynyl, aryl, (C4-C 10 ) Bicycloalkyl, -SO2R a or -SO2N(R a In some embodiments, each occurrence of R7 is independently H, D, F, Cl, Br, CH3, OCH3, NH2, N(CH3)2, [ka] In some embodiments, each occurrence of R7 is independently H, D, F, CH3, N(CH3)2, [ka] It is.
[0251] In some embodiments, each occurrence of R7 is independently H, halogen, (C1-C6) alkyl, -CN, -NC, -NO2, N 3、 -ORa, -SR a or -N(R a In some embodiments, each occurrence of R7 is independently -COR a , -CO2R a , -CON(R a )2, -SO2R a , -SO2N(R a )2, -N(R a )SO2R a , [ka] In some embodiments, each occurrence of R7 is independently [ka] each of which is optionally substituted with one or more of alkyl, OH, or halogen. In some embodiments, each occurrence of R7 is independently H, CH3, CH2CH3, CH(CH3)2, CF3, OH, NH2, -NHCH3, or -N(CH3)2, -SO2NH2, -CONH2, or [ka] It is.
[0252] In some embodiments, at least one occurrence of R7 is H, D or halogen. In some embodiments, at least one occurrence of R7 is H. In some embodiments, at least one occurrence of R7 is D. In some embodiments, at least one occurrence of R7 is F. In some embodiments, at least one occurrence of R7 is CH3. In some embodiments, at least one occurrence of R7 is OCH3. In some embodiments, at least one occurrence of R7 is NH2. In some embodiments, at least one occurrence of R7 is N(CH3)2. In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is -CN. In some embodiments, at least one occurrence of R7 is -NC. In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is NO2. In some embodiments, at least one occurrence of R7 is N3. In some embodiments, at least one occurrence of R7 is [ka] In some embodiments, at least one occurrence of R7 is [ka] It is.
[0253] In some embodiments, each occurrence of R is independently H, halogen, (C1-C6) alkyl, (C1-C6) haloalkyl, -N(R a)2, NO2 and -ORa. In some embodiments, at least one occurrence of R7 is H, CH3, OH, NH2 or halogen. In some embodiments, at least one occurrence of R7 is H or CH3. In some embodiments, at least one occurrence of R7 is OH or NH2. In some embodiments, at least one occurrence of R7 is halogen. In some embodiments, at least one occurrence of R7 is H. In some embodiments, at least one occurrence of R7 is CF3. In some embodiments, R7 is H or CH3.
[0254] In some embodiments, any two R7 groups, together with the carbon atoms to which they are attached, form a (C3-C7)cycloalkyl, a (C3-C7)heterocycloalkyl, an aryl, or a heteroaryl. In some embodiments, any two R7 groups, together with the carbon atoms to which they are attached, form a (C3-C7)heterocycloalkyl. In some embodiments, [ka] teeth [ka] It is.
[0255] In some embodiments, R8 is H, (C1-C6) alkyl, (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, or heteroaryl. R8 is H or (C1-C6) alkyl. In some embodiments, R8 is (C3-C7) cycloalkyl, (C3-C7) heterocycloalkyl, aryl, or heteroaryl. In some embodiments, R8 is H, CH3, CH2CH3, CH(CH3)2, [ka] In some embodiments, each occurrence of R8 is independently H, CH3, CH2CH3, CH(CH3)2, or CF3. In some embodiments, R8 is H or CH3. In some embodiments, R8 is H. In some embodiments, R8 is CF3.
[0256] In some embodiments, [ka] teeth, [ka] It is.
[0257] In some embodiments, R a Each occurrence of is independently H, (C2-C6) alkenyl, or (C1-C6) alkyl. a Each occurrence of is independently H, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, isobutyl, or tert-butyl. a Each occurrence of is independently H or CH. In some embodiments, R a Each occurrence of is H.
[0258] In some embodiments, the compound has formula Ia: [ka] In some embodiments, the compound of formula Ia has the structure: [ka] wherein each occurrence of R1 is H, (C1-C6) alkyl, N(R a )2, (C3-C7)heterocycloalkyl or halogen, and each occurrence of R7 is independently H, halogen, (C1-C6)alkyl, -ORa, -SR a , -N(R a )2, -COR a , -CO2R a , -CON(Ra )2, -CN, -NC, -NO2, -N3, -SO2R a , -SO2N(R a )2 or -N(R a )SO2R a and each occurrence of Y, Y, Y, and Y is independently CH or N.
[0259] In some embodiments, the compound has formula Ib: [ka] In some embodiments, the compound of formula Ib has the structure: [ka] wherein each occurrence of R1 is H, (C1-C6) alkyl, N(R a )2, (C3-C7)heterocycloalkyl or halogen, and each occurrence of R7 is independently H, halogen, (C1-C6)alkyl, -ORa, -SR a , -N(R a )2, -COR a , -CO2R a , -CON(R a )2, -CN, -NC, -NO2, -N3, -SO2R a , -SO2N(R a )2 or -N(R a )SO2R a and each occurrence of Y, Y, Y, and Y is independently CH or N.
[0260] In some embodiments, the compound is [ka] [ka] [ka] is selected from the group consisting of:
[0261] In some embodiments, the compound is [ka] In some embodiments, the compound is selected from the group consisting of: [ka] is selected from the group consisting of:
[0262] In any one of the embodiments disclosed herein, the compound is selected from the group consisting of compounds 1-7 shown in Examples 1-7, respectively.
[0263] In any one of the embodiments disclosed herein, the compound is selected from the group consisting of compounds 1-3 and 5-6 shown in Table 1.
[0264] How to Modulate Akt3 Akt3, also called RAC-gamma serine / threonine-protein kinase, is an enzyme that is encoded by the Akt3 gene in humans. Akt kinase is known to be a regulator of cell signaling in response to insulin and growth factors, and is involved in a wide range of biological processes, including but not limited to cell proliferation, differentiation, apoptosis and tumorigenesis, as well as glycogen synthesis and glucose uptake. Akt3 has been shown to be stimulated by platelet-derived growth factor ("PDGF"), insulin and insulin-like growth factor 1 ("IGF1").
[0265] Akt3 kinase activity mediates the serine and / or threonine phosphorylation of a series of downstream substrates. Nucleic acid sequences for Akt3 are known in the art. See, for example, Genbank Accession No. AF124141.1: Homo sapiens protein kinase B gamma mRNA (complete cds), which is specifically incorporated by reference in its entirety and provides the following nucleic acid sequence: AGGGGAGTCATCATGAGCGATGTTACCATTGTGAAGGAAGGTTGGGTTCAGAAGAGGGGA GAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGCTCATTCATA GGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTG GCAAAATGCCAGTTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGT CTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAGGAAAGGGAA GAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGA ATGAATTGTAGTCCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCT ACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTACTAGGTAAA GGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATG AAGATTCTGAAGAAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAA AGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATATTCCTTCCAG ACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGCTGTTTTTCCAT TTGTCGAGAGAGCGGGTGTTCTCTGAGGACCGCACACGTTTCTATGGTGCAGAAATTGTC TCTGCCTTGGACTATCTACATTCCGGAAAGATTGTGTACCGTGATCTCAAGTTGGAGAAT CTAATGCTGGACAAAGATGGCCACATAAAAATTACAGATTTTGGACTTTGCAAAGAAGGG ATCACAGATGCAGCCACCATGAAGACATTCTGTGGCACTCCAGAATATCTGGCACCAGAG GTGTTAGAAGATAATGACTATGGCCGAGCAGTAGACTGGTGGGGCCTAGGGGTTGTCATG TATGAAATGATGTGTGGGAGGTTACCTTTCTACAACCAGGACCATGAGAAACTTTTTGAA TTAATATTAATGGAAGACATTAAATTTCCTCGAACACTCTCTTCAGATGCAAAATCATTG CTTTCAGGGCTCTTGATAAAGGATCCAAATAAACGCCTTGGTGGAGGACCAGATGATGCA AAAGAAATTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAA AAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGATATTTTGAT GAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGT ATGGACTGCATGGACAATGAGAGGCGGCCGCATTTCCCTCAATTTTCCTACTCTGCAAGT GGACGAGAATAAGTCTCTTTCATTCTGCTACTTCACTGTCATCTTCAATTTATTACTGAA AATGATTCCTGGACATCACCAGTCCTAGCTCTTACACATAGCAGGGGCACCTTCCGACAT CCCAGACCAGCCAAGGGTCCTCACCCCTCGCCACCTTTCACCCTCATGAAAACACACATA CACGCAAATACACTCCAGTTTTTGTTTTTGCATGAAATTGTATCTCAGTCTAAGGTCTCA TGCTGTTGCTGCTACTGTCTTACTATTA (Sequence number 1).
[0266] The amino acid sequence for Akt3 is also known in the art. See, e.g., UniProtKB / Swiss-Prot Accession No. Q9Y243 (Akt3_HUMAN), which is specifically incorporated by reference in its entirety and provides the following amino acid sequence: MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE (Sequence number 2).
[0267] The domain structure of Akt3 is outlined in Romano, Scientifica, Volume 2013 (2013), Article ID 317186, 12 pages (incorporated herein by reference in its entirety) and includes an N-terminal pleckstrin homology domain ("PH") followed by a catalytic kinase domain ("KD") and a C-terminal regulatory hydrophobic region. The KD and regulatory domains are important for the biological actions mediated by Akt protein kinase and show the greatest homology among the three Akt isoforms. The PH domain binds lipid substrates, such as phosphatidylinositol (3,4) diphosphate ("PIP2") and phosphatidylinositol (3,4,5) triphosphate ("PIP3"). The ATP binding site is located approximately in the center of the catalytic kinase domain, which has a significant degree of homology to other members of the AGC kinase family, e.g., p70 S6 kinase ("S6K") and p90 ribosomal S6 kinase ("RSK"), protein kinase A ("PKA") and protein kinase B ("PKB"). A hydrophobic regulatory portion is a typical feature of the AGC kinase family. With reference to SEQ ID NO:2, Akt3 is generally believed to have the molecular processing and domain structure outlined as follows:
[0268] Molecular Processing: Main Features Position Length Type Initiator methionine 1 1 removal Chain 2-479 478 Akt3 region: Main Features Position Length Type Domain 5~107 103 PH Domain 148-405 258 Protein Kinase Domain 406-479 74 AGC-kinase, C-terminus Nucleotide binding 154-162 9 ATP Part: Main Features Position Length Type Active site 271 1 Proton acceptor Binding site 177 1 ATP The initiator methionine of SEQ ID NO:2 is disposable for Akt3 function. Thus, in some embodiments, the compound directly or indirectly modulates the expression or bioavailability of Akt3 having the following amino acid sequence: SDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE (Sequence number 3).
[0269] Two specific sites, one in the kinase domain (Thr-305, per SEQ ID NO:2) and the other in the C-terminal regulatory region (Ser-472, per SEQ ID NO:2), must be phosphorylated for full activation of Akt3. Interaction between the PH domain of Akt3 and TCL1A enhances Akt3 phosphorylation and activation. IGF-1 leads to activation of Akt3, which may play a role in regulating cell survival.
[0270] In some embodiments, the compounds of formula I described herein are inhibitors of Akt3. In other embodiments, the compounds of formula I described herein are activators of Akt3.
[0271] Pharmaceutical Compositions Some aspects of the invention involve administering an effective amount of a composition to a subject to achieve a particular result. Thus, small molecule compositions useful in accordance with the methods of the invention can be formulated in any manner suitable for pharmaceutical use.
[0272] The formulations of the present invention are administered in pharma- ceutically acceptable solutions, which may customarily contain pharma- ceutically acceptable concentrations of salts, buffers, preservatives, compatible carriers, adjuvants, and other therapeutic ingredients as appropriate.
[0273] For use in therapy, an effective amount of the compound can be administered to a subject in any mode that allows absorption of the compound by the appropriate target cells. "Administering" the pharmaceutical composition of the present invention can be accomplished by any means known to those skilled in the art. Specific routes of administration include, but are not limited to, oral, transdermal (e.g., via a patch), parenteral injection (subcutaneous, intradermal, intramuscular, intravenous, intraperitoneal, intrathecal, etc.) or mucosal (intranasal, intratracheal, inhalation, intrarectal, intravaginal, etc.). Injection can be a bolus or continuous infusion.
[0274] For example, pharmaceutical compositions according to the invention are often administered intravenously, intramuscularly or by other parenteral means. They can also be administered intranasally, by inhalation, topically, orally or as implants, and even rectally or vaginally. Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for injection or inhalation, microencapsulated, cochleated, coated on fine gold particles, contained in liposomes, nebulized, aerosolized, pelleted for implantation in the skin or dried on a sharp object that scratches the skin, etc. Pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with delayed release of the active compound, in which excipients and additives and / or auxiliaries, such as disintegrants, binders, coating agents, swelling agents, lubricants, flavoring agents, sweeteners or solubilizers, as described above, are usually used. The pharmaceutical compositions are suitable for use in various drug delivery systems. For a brief review of current methods for drug delivery, see Langer R (1990) Science 249:1527-33.
[0275] The concentration of the compound in the composition used in the method of the present invention may range from about 1 nM to about 100 μM. Effective doses are believed to be in the range of about 10 picomoles / kg to about 100 micromoles / kg.
[0276] The pharmaceutical composition is preferably prepared and administered in dose units. Liquid dose units are vials or ampoules for injection or other parenteral administration. Solid dose units are tablets, capsules, powders and suppositories. For the treatment of a patient, different doses may be required depending on the activity of the compound, the mode of administration, the purpose of administration (i.e., prophylactic or therapeutic), the nature and severity of the disorder, the age and weight of the patient. The administration of a given dose can be performed either as a single administration in the form of individual dose units or as several smaller dose units. Repeated and multiple administration of doses at specific daily, weekly or monthly intervals is also envisaged by the present invention.
[0277] The composition can be administered per se (pure) or in the form of a pharmaceutically acceptable salt. When used in medicine, the salt should be pharmaceutically acceptable, but non-pharmaceutically unacceptable salts can be conveniently used to prepare its pharmaceutically acceptable salt. Such salts include, but are not limited to, those prepared from the following acids: hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, maleic acid, acetic acid, salicylic acid, TsOH (p-toluenesulfonic acid), tartaric acid, citric acid, methanesulfonic acid, formic acid, malonic acid, succinic acid, naphthalene-2-sulfonic acid and benzenesulfonic acid. Such salts can also be prepared as alkali metal or alkaline earth salts, for example, the sodium, potassium or calcium salt of the carboxylic acid group.
[0278] Suitable buffering agents include acetic acid and salts (1-2% w / v), citric acid and salts (1-3% w / v), boric acid and salts (0.5-2.5% w / v), and phosphoric acid and salts (0.8-2% w / v). Suitable preservatives include benzalkonium chloride (0.003-0.03% w / v), chlorobutanol (0.3-0.9% w / v), parabens (0.01-0.25% w / v), and thimerosal (0.004-0.02% w / v).
[0279] Compositions suitable for parenteral administration conveniently include sterile aqueous preparations that can be isotonic with the blood of recipients. Among acceptable vehicles and solvents, water, Ringer's solution, phosphate-buffered saline and isotonic sodium chloride solution are included. In addition, sterile fixed oils are conventionally used as solvents or suspending media. For this purpose, any non-irritating fixed mineral oil or non-mineral oil may be used, including synthetic mono- or diglycerides. In addition, fatty acids, such as oleic acid, find use in injectable preparations. Carrier formulations suitable for subcutaneous, intramuscular, intraperitoneal, intravenous, etc. administration can be found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA.
[0280] The compounds useful in the present invention can be delivered as a mixture of more than two such compounds, which can further include one or more adjuvants in addition to the combination of compounds.
[0281] A variety of administration routes are available. The particular mode selected will naturally depend on the particular compound selected, the age and general health of the subject, the particular condition being treated, and the dosage required for therapeutic effect. The method of the present invention can be carried out using any medically acceptable administration mode, which means any mode that produces an effective response level without causing clinically unacceptable adverse effects. The preferred administration modes are discussed above.
[0282] Composition can be conveniently presented in unit dosage form and can be prepared by any method well known in the art of pharmacy.All methods include the step of mixing compound with carrier, which constitutes one or more accessory ingredients.Generally, composition is prepared by mixing compound uniformly and intimately with liquid carrier, finely divided solid carrier or both, and then, if necessary, shaping product.
[0283] Other delivery systems can include sustained, delayed or extended release delivery systems. Such systems can avoid repeated administration of the compound, increasing convenience for the subject and the physician. Many types of release delivery systems are available and known to those skilled in the art. These include polymer-based systems, such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid and polyanhydrides. Microcapsules of the aforementioned polymers containing drugs are described, for example, in U.S. Pat. No. 5,075,109. Delivery systems also include: non-polymeric systems, such as lipids or neutral fats, including sterols, such as cholesterol, cholesterol esters and fatty acids, such as mono-, di- and tri-glycerides; hydrogel release systems; silastic systems; peptide-based systems; wax coatings; compressed tablets using conventional binders and excipients; partially condensed implants, and the like. Specific examples include, but are not limited to, (a) erodible systems, in which the agent of the invention is contained in a matrix, such as those described in U.S. Patents 4,452,775, 4,675,189, and 5,736,152, and (b) diffusion systems, in which the active ingredient permeates through a polymer at a controlled rate, such as those described in U.S. Patents 3,854,480, 5,133,974, and 5,407,686. In addition, pump-based hardware delivery systems can be used, some of which are adapted for implantation.
[0284] Methods for Treating Disease In another aspect, a method of treating a disease in a subject in need of treatment comprises administering to the subject an effective amount of a compound of formula I as described herein.
[0285] In some embodiments, the disease is selected from the group consisting of neurodegenerative diseases, cachexia, anorexia, obesity, complications of obesity, inflammatory diseases, virally induced inflammatory responses, Gulf War syndrome, tuberous sclerosis, retinitis pigmentosa, graft rejection, cancer, autoimmune diseases, ischemic tissue injury, traumatic tissue injury, and combinations thereof.
[0286] In some embodiments, the compound of formula I modulates Akt3 in immune cells. Non-limiting examples of immune cells include T cells (e.g., regulatory T cells ("Treg")), B cells, macrophages, and glial cells (e.g., astrocytes, microglia, or oligodendrocytes). In some embodiments, the immune cells are Tregs. In some embodiments, the compound of formula I activates Akt3 signaling. In other embodiments, the compound of formula I inhibits Akt3 signaling. In some embodiments, the compound of formula I modulates Akt3 in Tregs. The inventors have surprisingly found that in some embodiments, the compound of formula I increases Treg activity or production, while in other embodiments, the compound reduces Treg activity or production. The inventors have also surprisingly found that in some embodiments, the compound of formula I activates Akt3 signaling, while in other embodiments, the compound inhibits Akt3 signaling.
[0287] Neurodegenerative diseases In some embodiments, a method of treating or preventing a neurodegenerative disease in a subject in need thereof is described, comprising modulating Akt3 signaling through administering to the subject an effective amount of a compound of formula I as described herein. In some embodiments, the neurodegenerative disease is selected from the group consisting of Parkinson's disease, Alzheimer's disease, amyotrophic lateral sclerosis, motor neuron disease, Huntington's disease, HIV-induced neurodegeneration, Lewy body disease, spinal muscular atrophy, prion disease, spinocerebellar degeneration, familial amyloid polyneuropathy, multiple sclerosis, and combinations thereof.
[0288] Neurodegenerative diseases occur when nerve cells in the brain or peripheral nervous system lose function over time and eventually die.In many neurodegenerative diseases, chronic neuroinflammation is the cause of disease progression.Current treatments can help alleviate some of the physical or mental symptoms associated with neurodegenerative diseases, but there is currently no way to slow down the progression of disease, and no known cure.
[0289] Although the mechanisms that trigger neurodegenerative processes are unclear, increasing evidence suggests a crucial role for immunity and the immune system in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, Parkinson's disease, Huntington's disease, multiple sclerosis, spinal muscular atrophy, familial amyloid polyneuropathy and ALS. Tregs suppress immune responses and mediate self-tolerance and immune homeostasis through the CD4 + A subset of T cells (see Sakaguchi, et al., Cell, 133, 775-787 (2008)). Evidence suggests that Tregs play an important role in the progression of neurodegenerative diseases. For example, Akt3 can modulate the suppressive function of natural Tregs and the polarization of inducible Tregs, and thus, by modulating Akt3 in immune cells, can modulate immune responses. More specifically, activation of Akt3 in immune cells can result in an increase in the immunosuppressive response, while inhibition of Akt3 in immune cells can result in a decrease in the immunosuppressive response. Without being bound to any one theory, it is believed that modulating Akt3 signaling in immune cells can be used for the treatment and prevention of neurodegenerative diseases.
[0290] In some embodiments, a method of treating or preventing a neurodegenerative disease in a subject in need of treatment is described, comprising administering to the subject an Akt3 activator of a compound of formula I as described herein in an amount effective to induce an immunosuppressive response and treat or slow the progression of the disease. In some embodiments, the Akt3 activator modulates the immune response by increasing the suppressive function of immune suppressive cells. In some embodiments, Akt3 is selectively activated in immune cells. Exemplary immune cells include, but are not limited to, T cells, B cells, macrophages and glial cells, such as astrocytes, microglia and oligodendrocytes. In a preferred embodiment, Akt3 is activated in Tregs. In some embodiments, the Akt3 activator can also be used to increase or promote the activity or production of Tregs, increase the production of cytokines, such as IL-10, from Tregs, increase the differentiation of Tregs, increase the number of Tregs or increase the survival time of Tregs.
[0291] In some embodiments, a method of treating or preventing a neurodegenerative disease in a subject in need of treatment is described, comprising administering to the subject an Akt3 inhibitor of a compound of formula I as described herein in an amount effective to inhibit immunosuppressive response and treat or prevent disease progression. In some embodiments, the Akt3 inhibitor of a compound of formula I as described herein modulates immune response by reducing immunosuppressive response or increasing immunostimulatory response. In some embodiments, Akt3 is selectively inhibited in immune cells. Exemplary immune cells include, but are not limited to, T cells, B cells, macrophages and glial cells, such as astrocytes, microglia and oligodendrocytes. In a preferred embodiment, Akt3 is inhibited in Tregs.
[0292] In one embodiment, the compound of formula I can treat or prevent ALS. ALS, also known as Lou Gehrig's disease, is a progressive neurodegenerative disease that affects motor neurons in the brain and spinal cord. Symptoms of ALS include, but are not limited to, difficulties in speaking, swallowing, walking, moving, and breathing. ALS usually affects men and women between the ages of 40 and 70. There are two different types of ALS, sporadic and familial. Sporadic is the most common form of the disease in the United States, accounting for 90-95 percent of all cases. Familial ALS is associated with mutations in Cu / Zn superoxide dismutase (SOD1). Oxidative stress, mitochondrial dysfunction, excitotoxicity, protein aggregation, endoplasmic reticulum stress, dysfunction of axonal transport, dysregulation of neuronal-glial interactions, and apoptosis have all been demonstrated to contribute to motor neuron damage in the presence of mutant SOD1. Without being bound to any one theory, it is believed that Treg dysfunction plays a role in the development of ALS, and administration of Akt3 modulators can treat or prevent the progression of ALS. Some subjects with rapid progression of ALS have deficiency of Treg master transcription factor FOXP3, which leads to the dysfunction of Treg suppressive function.One embodiment provides a method for treating ALS in a subject in need of treatment by administering to the subject in need of treatment an Akt3 activator in an amount effective to activate Akt3 in immune cells and induce an immunosuppressive response.In a preferred embodiment, Akt3 is activated in Treg.
[0293] In some embodiments, administration of an Akt3 activator of formula I described herein to a subject with ALS slows disease progression and increases the subject's survival time.
[0294] For example, other motor neuron diseases including progressive bulbar palsy, pseudobulbar palsy, primary lateral sclerosis, spinal muscular atrophy and post-polio syndrome can be treated or prevented using the disclosed Akt3 modulators.
[0295] Parkinson's disease is a neurodegenerative disorder that mainly affects dopamine-producing neurons in a specific area of the brain called substantia nigra.Parkinson's disease is a progressive disease that worsens over time as neurons are damaged or disappear.The cause of neuronal death in Parkinson's disease is not known.Symptoms of Parkinson's disease include, but are not limited to, tremors in hands, arms, legs, jaw or head, stiffness of limbs and trunk, slowness of movement and impaired balance and coordination.
[0296] One embodiment provides a method of treating Parkinson's disease by administering to a subject in need of treatment an Akt3 modulator in an amount effective to activate or inhibit Akt3 in immune cells and induce an immunosuppressive response. In some embodiments, administration of an Akt3 activator to a subject with Parkinson's disease slows or stops disease progression to unaffected regions of the brain.
[0297] In some embodiments, the disclosed Akt3 activators of formula I described herein can be administered prophylactically to a subject if the subject has a family history of Parkinson's disease or other neurodegenerative disease. In some embodiments, the Akt3 activators can protect neurons from or delay the induction of disease.
[0298] Huntington's disease is a progressive neurodegenerative disease. The disease is characterized by the progressive degeneration of nerve cells in the brain. Symptoms of Huntington's disease include, but are not limited to, problems with involuntary movement and impairments in voluntary movement, such as involuntary spasms, muscle rigidity, slow or abnormal eye movements, gait, loss of posture and balance, physical impairments in speech or swallowing; cognitive impairments, such as difficulty in organizing, prioritizing or concentrating on tasks, lack of flexibility or tendency to get stuck in thinking, behavior or actions, lack of impulse control, lack of awareness of one's own behavior and abilities, slowness in processing thoughts or specific words and difficulty in learning new information, and psychiatric disorders, such as depression. In one embodiment, the disclosed Akt3 modulator can reduce or slow the progression of symptoms of Huntington's disease.
[0299] One embodiment provides a method of treating Huntington's disease in a subject in need of treatment by administering to the subject an Akt3 modulator in an amount effective to activate or inhibit Akt3 in immune cells and induce an immunosuppressive response. In some embodiments, the Akt3 modulator can slow or stop the progression of disease symptoms in a subject with Huntington's disease. In another embodiment, the Akt3 modulator can change the balance of Treg / Th17.
[0300] Huntington's disease is primarily hereditary. All children of parents with Huntington's disease have a 50 / 50 chance of inheriting the disease. In one embodiment, subjects with a family history of Huntington's disease can prevent or delay the onset of disease symptoms by prophylactically administering one of the disclosed Akt3 modulators before the onset of disease symptoms.
[0301] Alzheimer's disease is a progressive disorder that causes brain cells to degenerate and eventually disappear. Alzheimer's disease is the most common cause of dementia and is marked by a continuous decline in thinking, behavior, and social skills that disrupts a person's ability to function independently. Symptoms of Alzheimer's disease include, but are not limited to, memory loss, impairment in thinking and reasoning abilities, difficulty in making judgments and decisions, and changes in personality and behavior. The exact cause of Alzheimer's disease is not fully understood, but the core problem is thought to be a malfunction in brain proteins that disrupts neuronal function and triggers a series of toxic events. Damage most often begins in the areas of the brain that control memory, but this process begins several years before the first symptoms. Neuronal loss spreads to other areas of the brain in a somewhat predictable pattern. By the later stages of the disease, the brain has significantly shrunk. Beta-amyloid plaques and tau protein tangles are most often responsible for the massive neuronal damage and dysfunction in Alzheimer's disease.
[0302] One embodiment provides a method of treating Alzheimer's disease in a subject by administering to the subject an Akt3 activator in an amount effective to activate Akt3 in Tregs and activate downstream neuroprotective pathways in the brain. In another embodiment, the subject is administered an effective amount of an Akt3 activator to reduce or eliminate symptoms of Alzheimer's disease or slow disease progression.
[0303] Another embodiment provides a method of treating or preventing the progression of Alzheimer's disease in a subject by administering to the subject an Akt3 inhibitor of formula I described herein in an amount effective to inhibit Akt3 in Tregs and induce an immune response or reduce an immunosuppressive response. In some embodiments, inhibition of Akt3 in Tregs results in clearance of beta amyloid plaques, attenuation of neuroinflammatory responses and reversal of cognitive decline.
[0304] Spinal muscular atrophy ("SMA") is a group of chronic neuromuscular disorders characterized by progressive loss of motor neurons and muscle wasting. SMA is generally classified into four types that differ in severity and life stage during which the disease manifests. These types are: SMA1 or Werdnig-Hoffmann disease, which appears between 0 and 6 months of age ("infantile" SMA); SMA2 or Dubowitz disease, which appears between 6 and 18 months of age ("intermediate" SMA); SMA3 or Kugelberg-Welander disease, which appears after age 1 year ("juvenile" SMA); and SMA4, which appears during adulthood ("adult-onset" SMA). The most severe form, SMA1, is sometimes called SMA0 ("infantile severe" SMA). Signs and symptoms of SMA vary according to type, but the most common include, but are not limited to, being flaccid or prone to collapse, difficulty sitting, standing or walking, loss of respiratory muscle strength, twitching, and difficulty eating and swallowing. All types of SMA are linked to exon deletions and / or point mutations in the SMN1 gene that prevent the expression of the SMN protein. Depending on the type, SMA can be treated with various gene therapies, nutritional and respiratory support, orthopedic surgery, and combinations thereof. Neuroprotective drugs are promising ways to stabilize motor neuron loss, but currently available candidates are still undergoing successful clinical trials. Therefore, additional neuroprotective drug candidates are needed for the treatment of SMA.
[0305] One embodiment provides a method of treating SMA in a subject by administering to the subject an Akt3 modulator of formula I described herein in an amount effective to allow survival of motor neurons. In another embodiment, the subject is administered an effective amount of an Akt3 modulator to reduce or eliminate symptoms of SMA or slow disease progression.
[0306] Multiple sclerosis ("MS") is a disease in which nerve cells in the brain and spinal cord demyelinate, leading to nerve cell damage and disruption of signal transmission throughout the nervous system. People with MS can experience almost any neurological sign / symptom, with autonomic, visual, motor and sensory dysfunction being the most common. The exact cause of MS is unknown, but is thought to be a combination of genetic factors, such as chromosomal abnormalities in the major histocompatibility complex, and environmental factors, such as exposure to infectious agents and toxins. Treatments for MS include, but are not limited to, drugs and physical therapy, attempts to restore function in affected areas after an acute attack and prevent new attacks from occurring, and the like. There is no known cure for MS, and many current drugs, while somewhat effective, have severe side effects and can be poorly tolerated. Thus, new drugs are needed for safe, effective, reversible and preventative treatment of MS.
[0307] One embodiment provides a method of treating MS in a subject by administering to the subject an Akt3 modulator of formula I as described herein in an amount effective to restore loss of function after a seizure and / or prevent a seizure from occurring. In another embodiment, the subject is administered an effective amount of an Akt3 modulator to reduce or eliminate symptoms of MS or slow disease progression.
[0308] weight loss In some embodiments, disclosed herein are methods for treating or preventing extreme weight loss, comprising administering a compound disclosed herein to a subject in need of treatment. Non-limiting examples of weight loss disorders include cachexia, anorexia, and anorexia nervosa. An exemplary method comprises inhibiting Akt3 in a subject in need of treatment by administering a compound of formula I described herein. Without being bound to any one theory, Akt3 is believed to play a key role in adipogenesis. White adipogenesis requires activation of a transcriptional cascade involving the sequential induction of several transcription factors, including but not limited to FOXO1, some members of the C / EBP family, and PPARγ. FOXO1 is the main negative regulator of adipogenesis and is primarily controlled via phosphorylation / acetylation on multiple residues by enzymes including Akt. FOXO1 can also be regulated by the serine / threonine protein kinase SGK1. SGK1 is downstream of PI3K and can inhibit FOXO1 by phosphorylation. SGK1 is regulated by serine / threonine protein kinase WNK1, which can also be regulated by Akt and SGK1. Akt3 suppresses lipogenesis through phosphorylation of WNK1, leading to downregulation of SGK1 activity and SGK-1-mediated inhibition of FOXO1. In one embodiment, inhibition of Akt3 in Treg can promote lipogenesis and reverse disease-induced weight loss.
[0309] Cachexia or wasting syndrome is a multifactorial syndrome characterized by a continuous loss of skeletal muscle that cannot be fully reversed by conventional nutritional supplementation, resulting in progressive functional impairment. Cachexia is so destructive that when the body senses a lack of nutrients, it turns to other sources of energy, namely skeletal muscle and adipose tissue. Cachexia affects a large proportion of patients with advanced cancer, and is associated with a decrease in the ability to fight infection, resistance to treatment, response to therapy, quality of life and survival. In one embodiment, cachexia is caused by chronic diseases, including but not limited to cancer, inflammatory diseases, neurodegenerative diseases, pathogenic infections, immune deficiency disorders, weight gain disorders, weight loss disorders, hormone imbalances, tuberous sclerosis, retinitis pigmentosa, congestive heart failure, and combinations thereof. One embodiment provides a method for treating cachexia in a subject in need of treatment by administering to the subject an Akt3 inhibitor of the compound of formula I described herein in an amount effective to reduce the symptoms of cachexia. Another embodiment provides a method for promoting weight gain in a subject in need of treatment by administering to the subject an Akt3 inhibitor of formula I compound described herein in an amount effective to promote adipogenesis in the subject. In one embodiment, a subject suspected of being susceptible to cachexia (e.g., a subject diagnosed with cancer or other disease) can be prophylactically administered an Akt3 inhibitor to prevent or delay the onset of cachexia syndrome. In some embodiments, the compounds disclosed herein are used to treat cachexia by modulating Akt3, rather than by modulating regulatory T cells.
[0310] Anorexia nervosa is an eating disorder characterized by weight loss or lack of weight gain in growing children, difficulty in maintaining an appropriate weight for height, age and stature, and often a distorted body image. One of the primary goals of treatment for anorexia is to restore normal body weight. In some embodiments, the compounds of formula I disclosed herein inhibit Akt3, which is overactivated by estradiol and whose levels are increased in subjects with anorexia. In some embodiments, the compounds of formula I disclosed herein can be used to treat anorexia. In one embodiment, the disclosed Akt3 inhibitors of formula I compounds can be administered to subjects diagnosed with anorexia in an amount effective to promote lipogenesis and reverse extreme weight loss.
[0311] Obesity and its complications Disorders characterized by weight gain (e.g., obesity) are estimated to occur in 40% of adults and 20% of children and adolescents in the United States alone, and these numbers are trending upward. See "Overweight & Obesity: Data & Statistics", US Centers for Disease Control and Prevention, accessed April 3, 2020. Obesity is defined as a body mass index >30 kg / m 2 Akt3 activation is characterized by increased likelihood of various diseases (e.g., cardiovascular disease and type 2 diabetes). Akt3 activation is shown to protect against obesity. In one embodiment, a method for treating obesity comprises administering an Akt3 activator to a subject having obesity or at risk of developing obesity in an amount effective to reverse or prevent the effects of the disease.
[0312] In some embodiments, the compounds disclosed herein that modulate Akt3 are used to treat obesity and / or obesity complications. In some embodiments, the obesity complications are selected from the group consisting of impaired glucose tolerance, fatty liver, dyslipidemia, and combinations thereof. In some embodiments, the compounds disclosed herein are used to treat obesity and / or obesity complications by modulating Akt3, but not by modulating regulatory T cells.
[0313] inflammatory diseases Akt3 signaling is linked to chronic or acute inflammation that causes inflammatory disease. One embodiment provides a method for treating or preventing inflammatory disease in a subject in need of treatment, comprising administering to the subject a composition comprising an Akt3 modulator in an amount effective to modulate Akt3 signaling and treat or delay the progression of the disease. In some embodiments, the Akt3 modulator activates Akt3 signaling and / or increases the activity or production of Treg, resulting in an immunosuppressive effect.
[0314] Non-limiting examples of inflammatory diseases include atopic dermatitis, allergies, asthma, and combinations thereof.
[0315] Virus-induced inflammatory response Akt3 signaling is linked to acute immune responses that lead to virally induced inflammatory diseases, such as Severe Acute Respiratory Syndrome ("SARS") and COVID-19. Thus, in one embodiment, a method of treating a virally induced inflammatory disease in a subject in need thereof comprises administering to the subject an Akt3 modulator in an amount effective to reverse or slow the progression of the disease.
[0316] cancer In some embodiments, there is provided a method of treating or preventing cancer in a subject in need thereof, comprising modulating Akt3 signaling via administering to the subject an effective amount of a compound of formula I as described herein. In some embodiments, the compound of formula I inhibits Akt3 signaling and / or reduces Treg activity or production, resulting in an immune response activation effect.
[0317] In some embodiments, the cancer is selected from the group consisting of bladder cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, esophageal cancer, kidney cancer, liver cancer, lung cancer, nasopharyngeal cancer, pancreatic cancer, prostate cancer, skin cancer, gastric cancer, uterine cancer, ovarian cancer, testicular cancer, adult T-cell leukemia / lymphoma, and combinations thereof.
[0318] In some embodiments, the compounds and compositions disclosed herein are useful for treating leukemia. In some embodiments, the compounds and compositions disclosed herein that inhibit Akt3 are useful for treating leukemia. In these embodiments, the compounds and compositions disclosed herein that inhibit Akt3 are useful in vivo and ex vivo as therapeutic agents that stimulate immune responses. The ability to inhibit Akt3, and thus inhibit or reduce Treg-mediated immune suppression, allows for a stronger immune response. In some embodiments, the compounds and compositions disclosed herein are also useful for stimulating or enhancing immune stimulating or activating responses involving T cells. In some embodiments, the compounds and compositions disclosed herein are useful for stimulating or enhancing immune responses in a host to treat leukemia by selectively inhibiting Akt3. In these embodiments, the compounds and compositions disclosed herein can be administered to a subject in an amount effective to stimulate T cells in the subject. Types of leukemia that can be treated with the compounds and compositions disclosed herein include, but are not limited to, acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), adult T-cell leukemia / lymphoma (ATLL), and chronic myelomonocytic leukemia (CMML).
[0319] In some embodiments, ATLL is diagnosed almost exclusively in adults with a mean age in the mid-60s. In some embodiments, there are four types of ATLL: (1) acute, (2) chronic, (3) smoldering, and (4) lymphomatous. In some embodiments, acute ATLL is the most common form and is characterized by high white blood cell counts, hypercalcemia, organomegaly, and high lactose dehydrogenase. In some embodiments, lymphomatous ATLL appears in lymph nodes with less than 1% circulating lymphocytes. In some embodiments, chronic and smoldering ATLL are characterized by a less aggressive clinical course, allowing for prolonged survival times. In some embodiments, the 4-year survival rate for acute and lymphomatous ATLL is less than 5%. In some embodiments, the 4-year survival rate for chronic and smoldering forms of ATLL is 26.9% and 62%, respectively. In some embodiments, adult T-cell leukemia / lymphoma is caused by human T-cell lymphotropic virus (HTLV-1).
[0320] In some embodiments, the compounds and compositions disclosed herein that inhibit Akt3 are useful for treating ATLL. In some embodiments, the compounds and compositions disclosed herein that inhibit Akt3 are useful for treating ATLL. In some embodiments, Tregs that express CD25 and FoxP3 can be converted into ATLL cells. In some embodiments, ATLL cells exhibit an activated helper / inducer T cell phenotype but exhibit strong immunosuppressive activity. In some embodiments, the compounds and compositions disclosed herein that inhibit Akt3 reduce the immunosuppressive response of ATLL cells. In other embodiments, the compounds and compositions disclosed herein that inhibit Akt3 increase the immunostimulatory response to overcome the strong immunosuppressive activity of ATLL cells.
[0321] In some embodiments, the compounds and compositions disclosed herein useful for treating leukemia or ATLL reduce or inhibit immunosuppressive responses, such as, but not limited to, the immunosuppressive function of natural Treg (nTreg) cells and the induction of conventional T cells into inducible Treg (iTreg). In these embodiments, the immunosuppressive function of nTreg cells that is reduced or inhibited is the secretion of one or more anti-inflammatory cytokines, such as, but not limited to, IL10, TGFβ, or a combination thereof. In some embodiments, the method for treating leukemia or adult T cell leukemia / lymphoma includes administering to the subject a second active agent, such as, but not limited to, an antiemetic, a chemotherapeutic, or an augmenting agent (e.g., cyclophosphamide).
[0322] autoimmune disease In some embodiments, the disease is an autoimmune disease. Non-limiting examples of autoimmune diseases include achalasia, Addison's disease, adult Still's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-renal glomerular basement membrane disease, anti-tubular basement membrane antibody nephritis, antiphospholipid syndrome, autoimmune angioedema, autoimmune autonomic neuropathy, autoimmune encephalomyelitis, autoimmune hepatitis, inner ear autoimmune disease, autoimmune myocarditis, autoimmune oophoritis, autoimmune orchitis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune urticaria, axonal and neuronal neuropathy, Baro's disease, Behcet's disease, benign mucous membrane pemphigoid. , bullous pemphigoid, Castleman's disease, celiac disease, Chagas' disease, chronic inflammatory demyelinating polyneuropathy, chronic relapsing multifocal osteomyelitis, Churg-Strauss syndrome, eosinophilic granulomatosis, cicatricial pemphigoid, Cogan's syndrome, cold agglutinin disease, congenital heart block, Coxsackie myocarditis, CREST syndrome, Crohn's disease, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), discoid lupus, Dressler's syndrome, endometriosis, eosinophilic esophagitis, eosinophilic fasciitis, erythema nodosum, essential mixed cryoglobulinemia, Evans' syndrome, fibromyalgia, Fibrotic alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture's syndrome, Granulomatosis with polyangiitis, Graves' disease, Guillain-Barre syndrome, Hashimoto's thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hidradenitis suppurativa (Acne inversa), Hypogammaglobulinemia, IgA nephropathy, IgG4-related sclerosing disease, Immune thrombocytopenic purpura, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile diabetes mellitus (Type 1 diabetes), Juvenile myositis, Kawasaki disease, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus Scabies, lignified conjunctivitis, linear IgA disease, lupus, chronic Lyme disease, Meniere's disease, microscopic polyangiitis, mixed connective tissue disease, Mooren's ulcer, Muscha-Haberman's disease, multifocal motor neuropathy, multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neonatal lupus, neuromyelitis optica, neutropenia, ocular pemphigoid, optic neuritis, relapsing rheumatism, pediatric autoimmune neuropsychiatric disorders, paraneoplastic cerebellar degeneration, paroxysmal nocturnal hemoglobinuria, Parry-Romberg syndrome, pars planitis (peripheral uveitis), Parsonage-Turner syndrome, pemphigus, peripheral neuropathy,Perivenous encephalomyelitis, pernicious anemia, POEMS syndrome, polyarteritis nodosa, polyglandular syndrome type I, polyglandular syndrome type II, polyglandular syndrome type III, polymyalgia rheumatica, polymyositis, post-myocardial infarction syndrome, post-pericardiotomy syndrome, primary biliary cirrhosis, primary sclerosing cholangitis, progesterone dermatitis, psoriasis, psoriatic arthritis, pure red cell aplasia, pyoderma gangrenosum, Raynaud's phenomenon, reactive arthritis, reflex sympathetic dystrophy, relapsing polychondritis, restless legs syndrome group, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt's syndrome, scleritis, scleroderma, Sjögren's syndrome, sperm and testicular autoimmunity, stiff-body syndrome, subacute bacterial endocarditis, Susac's syndrome, sympathetic ophthalmia, Takayasu's arteritis, temporal arteritis (giant cell arteritis), thrombocytopenic purpura, Tolosa-Hunt syndrome, transverse myelitis, ulcerative colitis, undifferentiated connective tissue disease, uveitis, vasculitis, vitiligo, and Vogt-Koyanagi-Harada disease.
[0323] Other indications In some embodiments, the compounds disclosed herein modulate Akt3 and are used to treat Gulf War syndrome, tuberous sclerosis, retinitis pigmentosa, graft rejection, ischemic tissue injury, or traumatic tissue injury. In some embodiments, the graft rejection is graft-versus-host disease. In some embodiments, the compounds disclosed herein are used to treat retinitis pigmentosa by modulating Akt3, but not by modulating regulatory T cells. In some embodiments, the compounds disclosed herein are used to treat ischemic tissue injury or traumatic tissue injury. In some embodiments, the ischemic tissue injury or traumatic tissue injury is cerebral ischemic tissue injury or traumatic tissue injury.
[0324] Combination therapy methods In some embodiments, the disclosed compound can be administered alone or in combination with one or more additional therapeutic agents to a subject in need of treatment.In some embodiments, the compound and the additional therapeutic agent are administered separately but simultaneously.In some embodiments, the compound and the additional therapeutic agent are administered as part of the same composition.In other embodiments, the compound and the second therapeutic agent are administered separately and at different times but as part of the same treatment regimen.
[0325] In some embodiments, the subject can receive a first therapeutic agent 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours or more before the administration of the second therapeutic agent, or 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days or more before the administration of the second therapeutic agent. In some embodiments, the subject can receive one or more doses of the first agent every 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 14 days, 21 days, 28 days, 35 days or 48 days before the first administration of the second agent. The compounds disclosed herein can be the first or second therapeutic agent.
[0326] In some embodiments, the compound and additional therapeutic agent can be administered as part of a treatment regimen.For example, the first therapeutic agent can be administered to a subject every 4 days, and the second therapeutic agent can be administered on the first, second, third or fourth day or a combination thereof.The first therapeutic agent or the second therapeutic agent can be administered repeatedly throughout the entire treatment regimen.
[0327] Exemplary additional therapeutic agents include, but are not limited to, cytokines, chemotherapeutic agents, radionuclides, other immunotherapies, enzymes, antibiotics, antiviral agents (e.g., protease inhibitors alone or in combination with nucleosides for the treatment of HIV or Hepatitis B or C), antiparasitic agents (e.g., helminths or protozoans), growth factors, growth inhibitory agents, hormones, hormone antagonists, antibodies and bioactive fragments thereof (including humanized, single chain and chimeric antibodies), antigen and vaccine formulations (including adjuvants), peptide drugs, anti-inflammatory drugs, ligands that bind to Toll-like receptors to activate the innate immune system (including, but not limited to, CpG oligonucleotides), molecules that recruit and optimize the adaptive immune system, other molecules that activate or upregulate the action of cytotoxic T lymphocytes, NK cells and helper T cells, and other molecules that inactivate or downregulate suppressor or regulatory T cells.
[0328] The additional therapeutic agent is selected based on the condition, disorder or disease to be treated. For example, the compounds of the present invention can be co-administered with one or more additional agents that function to enhance or promote immune response or to reduce or inhibit immune response.
[0329] Chemotherapeutic agents In some embodiments, the compounds of the invention can be combined with one or more chemotherapeutic or pro-apoptotic agents. Representative chemotherapeutic agents include amsacrine, bleomycin, busulfan, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clofarabine, crisantaspase, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, daunorubicin, docetaxel, doxorubicin, epirubicin, etoposide, fludarabine, fluorouracil, gemcitabine, hydroxycarbamide, idarubicin, ifosfamide, irinotecan, leucovorin, and liposomal doxorubicin. Representative pro-apoptotic agents include, but are not limited to, liposomal daunorubicin, lomustine, melphalan, mercaptopurine, mesna, methotrexate, mitomycin, mitoxantrone, oxaliplatin, paclitaxel, pemetrexed, pentostatin, procarbazine, raltitrexed, satraplatin, streptozocin, tegafur-uracil, temozolomide, teniposide, thiotepa, thioguanine, topotecan, treosulfan, vinblastine, vincristine, vindesine, vinorelbine, or combinations thereof. Representative pro-apoptotic agents include, but are not limited to, fludarabine, staurosporine, cycloheximide, actinomycin D, lactosylceramide, 15d-PGJ(2), and combinations thereof.
[0330] Anti-inflammatory drugs Other suitable additional therapeutic agents include, but are not limited to, anti-inflammatory agents. In some embodiments, the anti-inflammatory agent may be non-steroidal, steroidal, or a combination thereof. One embodiment provides an oral composition containing about 1% (w / w) to about 5% (w / w), typically about 2.5% (w / w), of an anti-inflammatory agent. Representative examples of nonsteroidal anti-inflammatory agents include, but are not limited to, oxicams such as piroxicam, isoxicam, tenoxicam, sudoxicam; salicylates such as aspirin, disalcid, benorate, trilysate, safaprin, solprin, diflunisal, and fendosal; acetic acid derivatives such as diclofenac, fenclofenac, indomethacin, sulindac, tolmetin, isoxepac, furofenac, tiopinac, zidometacin, acematacin, fentiazac, zomepirac, clindanac, oxepinac, felbinac, and ketorolac; Fenamic acids, such as mefenamic acid, meclofenamic acid, flufenamic acid, niflumic acid, and tolfenamic acid; propionic acid derivatives, such as ibuprofen, naproxen, benoxaprofen, flurbiprofen, ketoprofen, fenoprofen, fenbufen, indoprofen, pirprofen, carprofen, oxaprozin, pranoprofen, miloprofen, tioxaprofen, suprofen, alminoprofen, and tiaprofenic acid; pyrazoles, such as phenylbutazone, oxyphenbutazone, feprazone, azapropazone, and trimethasone. In some embodiments, mixtures of these nonsteroidal anti-inflammatory agents may also be utilized.
[0331] Representative examples of steroidal anti-inflammatory drugs include, but are not limited to, corticosteroids such as hydrocortisone, hydroxyltriamcinolone, alpha-methyldexamethasone, dexamethasone phosphate, beclomethasone dipropionates, clobetasol valerate, desonide, desoxymethasone, desoxycorticosterone acetate, dexamethasone, dichlorisone, diflorasone diacetate, diflucortolone valerate, fluadrenolone, fluclorone acetonide, fludrocortisone, flumethasone pivalate, fluocinolone acetonide, fluocinonide, flucortine butyl ester, fluocortolone, fluprednidene (fluprednylidene) acetate, flurandrenolone, halcinonide, hydrocortisone acetate, hydrocortisone butyrate, methylprednisolone, tocortisone acetate ... Includes liamcinolone acetonide, cortisone, cortodoxone, flucetonide, fludrocortisone, difluorosone diacetate, fluradrenolon, fludrocortisone, difluorosone diacetate, fluradrenolon acetonide, medrysone, amcinafide, amcinafide, betamethasone and its ester counterbalances, chloroprednisone, chloroprednisone acetate, clocortelone, clesinolone, dichlorisone, difluprednate, flucloronide, flunisolide, fluoromethalone, fluperolone, fluprednisolone, hydrocortisone valerate, hydrocortisone cyclopentylpropionate, hydrocortamate, meprednisone, paramethasone, prednisolone, prednisone, beclomethasone dipropionate, triamcinolone and mixtures thereof.
[0332] Immunosuppressants In some embodiments, the compounds disclosed herein reduce Treg activity or production. In some embodiments, the compounds disclosed herein are used in induction therapy for cancer. In some embodiments, the compounds disclosed herein are used in combination with other immunotherapeutic agents, immune modulators, costimulatory activation agonists, other cytokines and chemokines and factors, vaccines, oncolytic viruses, cell therapy, small molecule and targeted therapy, chemotherapy and radiation therapy. In some embodiments, immune modulators include checkpoint inhibitors, such as anti-PD1, anti-CTLA4, anti-TIM3, anti-LAG3. In some embodiments, costimulatory activation agonists include anti-OX40, anti-GITR, etc. In some embodiments, cell therapy includes engineered T cells, CAR-T, TCR-T cells, and others.
[0333] In some embodiments, the compounds disclosed herein are used in combination with other immunotherapeutics, immune modulators, biologics (e.g., antibodies), vaccines, small molecule and targeted therapies, anti-inflammatory drugs, cell therapies (e.g., engineered Tregs and other types of cells), chemotherapy, and radiation therapy.
[0334] In some embodiments, the compounds disclosed herein, used alone or in combination with other agents, are administered to patients in vivo by intravenous, intramuscular or other parenteral means.These compounds can also be administered by intranasal application, inhalation, rectal, vaginal, topical, oral or implant.In other embodiments, the compounds disclosed herein, used alone or in combination with other agents, can be applied ex vivo to enhance the function of suppressive Tregs and other types of suppressive T cells, including natural Tregs, induced Tregs, engineered Tregs, and then used appropriately to treat patients.
[0335] In some embodiments, the additional therapeutic agent is an immunosuppressant. Immunosuppressants include, but are not limited to, antibodies against other lymphocyte surface markers (e.g., CD40, alpha-4 integrin) or against cytokines, fusion proteins (e.g., CTLA-4-Ig (Orencia®), TNFR-Ig (Enbrel®)), TNF-α blockers such as Enbrel, Remicade, Cimzia, and Humira, cyclophosphamide ("CTX") (e.g., Endoxan®, Cytoxan®, Neosar®, Procytox®, and Revimmune™), methotrexate ("MTX") (e.g., Rheumatrex® and Trexall®), belimumab (e.g., Benlysta®), other immunosuppressant drugs (e.g., cyclosporine A, FK506-like compounds, rapamycin compounds, and steroids), antiproliferative agents, cytotoxic agents, and other compounds that can aid in immunosuppression.
[0336] In some embodiments, the additional therapeutic agent can be a checkpoint inhibitor. In some embodiments, the additional therapeutic agent can be a CTLA-4 fusion protein, such as CTLA-4-Ig (abatacept). The CTLA-4-Ig fusion protein can function on T cells to compete with the costimulatory receptor, CD28, for binding to CD80 / CD86 (B7-1 / B7-2) on antigen-presenting cells, thus inhibiting T cell activation. In another embodiment, the additional therapeutic agent is a CTLA-4-Ig fusion protein known as belatacept. Belatacept contains two amino acid substitutions (L104E and A29Y) that can significantly increase its avidity with CD86 in vivo. In another embodiment, the additional therapeutic agent is Maxy-4.
[0337] In another embodiment, the additional therapeutic agent is CTX. CTX (generic name for Endoxan®, Cytoxan®, Neosar®, Procytox® and Revimmune™), also known as cytophosphan, is a nitrogen mustard alkylating agent derived from the oxazofolin family. It can be used to treat various types of cancer and some autoimmune disorders. CTX is the first-line drug used for diffuse proliferative glomerulonephritis in patients with lupus nephritis.
[0338] In some embodiments, the additional therapeutic agent can be administered in an amount effective to reduce blood or serum levels of anti-double stranded DNA ("anti-dsDNA") autoantibodies and / or to reduce proteinuria in a patient in need thereof.
[0339] In another embodiment, the additional therapeutic agent can increase the amount of adenosine in serum (see, e.g., WO08 / 147482). For example, the second therapeutic agent can be CD73-Ig, recombinant CD73, or another agent (e.g., a cytokine, monoclonal antibody, or small molecule) that increases expression of CD73 (see, e.g., WO04 / 084933). In another embodiment, the additional therapeutic agent is interferon-beta.
[0340] In some embodiments, the additional therapeutic agent may be a small molecule that inhibits or reduces differentiation, proliferation, activity, cytokine production and / or cytokine secretion by Th1, Th17, Th22 and / or other cells that secrete or cause other cells to secrete inflammatory molecules including, but not limited to, IL-1β, TNF-α, TGF-beta, IFN-γ, IL-18IL-17, IL-6, IL-23, IL-22, IL-21 and MMPs. In another embodiment, the additional therapeutic agent is a small molecule that interacts with Tregs, enhances Treg activity, promotes or enhances IL-10 secretion by Tregs, increases the number of Tregs, increases the suppressive capacity of Tregs, or a combination thereof.
[0341] In some embodiments, the composition increases the activity or production of Tregs. Exemplary Treg enhancers include, but are not limited to, glucocorticoid fluticasone, salmeteroal, antibodies against IL-12, IFN-γ and IL-4; vitamin D3 and dexamethasone, and combinations thereof.
[0342] In some embodiments, the additional therapeutic agent is an antibody, eg, a function-blocking antibody against a pro-inflammatory molecule such as IL-6, IL-23, IL-22, or IL-21.
[0343] In some embodiments, the additional therapeutic agent comprises a nucleic acid.In some embodiments, the additional therapeutic agent comprises a ribonucleic acid.
[0344] Combination Therapies for Neurodegenerative Diseases In some embodiments, the compound disclosed herein can be administered with a second therapeutic agent that is selected based on the pathology of the subject.In some embodiments, the second therapeutic agent can be a treatment for Alzheimer's disease.Current treatments for Alzheimer's disease include, but are not limited to, cholinesterase inhibitors, such as donepezil, rivastigmine and galantamine; memantine; antidepressants, such as citalopram, fluoxetine, paroxetine, sertraline and trazadone; anxiolytics, such as lorazepam and oxazepam; and antipsychotics, such as aripiprazole, clozapine, haloperidol, olanzapine, quetiapine, risperidone and ziprasidone.
[0345] In another embodiment, the additional therapeutic agent can be a treatment for ALS. Currently, there are two US FDA approved treatments for ALS: riluzole and edavarone. Both drugs have been shown to slow the progression of ALS. In addition to riluzole and edavarone, subjects with ALS can also be treated with drugs that target specific symptoms of the disease. Exemplary such drugs include, but are not limited to, drugs that reduce spasticity, such as anticonvulsants (e.g., baclofen, dantrolene and diazepam); drugs that help control nerve pain, such as amitriptyline, carbamazepine, duloxetine, gabapentin, lamotrigine, milnacipran, nortriptyline, pregabalin and venlafaxine; and drugs that help patients swallow, such as trihexyphenidyl or amitriptyline.
[0346] In one embodiment, the additional therapeutic agent can be treatment for Parkinson's disease.Current treatment for Parkinson's disease includes but is not limited to carbidopa-levodopa; dopamine agonist, for example, pramipexole, ropinirole and rotigotine; MAOB inhibitor, for example, selegiline, rasagiline and safinamide; catechol O-methyltransferase inhibitor, for example, entacapone and tolcapone; anticholinergic, for example, benztropine and trihexyphenidyl; and amantadine.
[0347] In some embodiments, the second therapeutic agent can be treatment for Huntington's disease.Current treatment for Huntington's disease includes but is not limited to: tetrabenazine; antipsychotics, such as haloperidol, chlorpromazine, risperidone and quetiapine; amantadine; levetiracetam; clonazepam; antidepressants, such as citalopram, escitalopram, fluoxetine and sertraline; and anticonvulsants, such as valproate, carbamazepine and lamotrigine.
[0348] Combination treatments for weight loss In some embodiments, the compounds disclosed herein can be administered to subjects with additional therapeutic agents that are used to treat cachexia or extreme weight loss.The current strategy for treating cachexia and extreme weight loss is to improve appetite by using appetite stimulants to ensure sufficient intake of nutrients.Pharmacological interventions using appetite stimulants, nutrient supplementation, 5-HT3 antagonists and Cox-2 inhibitors are used to treat cancer cachexia.
[0349] In some embodiments, the appetite stimulant is a vitamin, mineral, or herbal medicine, including, but not limited to, zinc, thiamine, or fish oil, hi another embodiment, the appetite stimulant is a medication, including, but not limited to, dronabinol, megestrol, and oxandrolone.
[0350] Equivalent The following representative examples are intended to help illustrate the present invention, and are not intended to limit the scope of the present invention, and should not be interpreted as such. Indeed, in addition to the embodiments shown and described herein, various variations of the present invention and many further embodiments thereof will be apparent to those skilled in the art from the following examples and the complete contents of this document, including references to scientific and patent literature cited herein. It should be further recognized that the contents of these cited references are incorporated herein by reference to help illustrate the state of the art. The following examples contain important additional information, illustrations and guidance that can be adapted to the practice of the present invention in its various embodiments and equivalents thereof. EXAMPLES
[0351] Example 1: Compound 1 (2-(4-((3-methylquinolin-4-yl)amino)phenyl)-N-(2-sulfamoylphenyl)acetamide) [ka] [ka] As shown in Scheme 1, methyl 2-(4-aminophenyl)acetate was coupled with 4-chloro-3-methylquinoline, followed by conversion of the ester to the carboxylic acid under basic conditions. The resulting intermediate was coupled with 2-aminobenzenesulfonamide to form the amide bond in the resulting compound 1: C 24 H 22 N4O3S; 446.53g / mol; 13mg; pale yellow solid; ESI-LCMS m / z=447.1[M+H] + LCMS RT=1.50 min, >95% (214 nm and 254 nm).
[0352] The compounds set forth in the following examples were made based on the experimental procedures described in Example 1 and / or as described below and / or similarly by methods known in the art.
[0353] The following abbreviations used in the examples below have the following definitions: DCM = dichloromethane; DMF = dimethylformamide; EA or EtOAc = ethyl acetate; DMSO = dimethylsulfoxide; HPLC = high performance liquid chromatography; LCMS = liquid chromatography mass spectrometry; MS = mass spectrometry; NMR = nuclear magnetic resonance; PE = petroleum ether; RT = retention time (e.g., HPLC retention time); and TLC = thin layer chromatography. These abbreviations and definitions are not intended to be limiting of other abbreviations and definitions in this application.
[0354] The following general methods were used in one or more of the following examples. Substrates and reagents were commercially available and were used without further purification. Reactions were monitored by LCMS or TLC using precoated glass plates. Column chromatography was performed using silica gel (200-300 mesh) or a Biotage instrument (normal phase HPLC). The preparative HPLC method used a Gilson 281 (PHG012) instrument, a Welch 10μm 150A 21.2*250mm column, a mobile phase consisting of A: water (12mM NH4HCO3), B: acetonitrile, flow rate 30.00mL / min, and detection at 214 / 254nm. NMR spectroscopy was performed using CDCl3 / MeOD / DMSO- on a 500 or 400MHz Bruker NMR spectrometer. d6 In 、1 H NMR spectra were recorded. Resonances are given in parts per million relative to tetramethylsilane. Data are reported as follows: chemical shift, multiplicity (s=singlet, d=doublet, t=triplet, m=multiplet), coupling constants (Hz) and integrals. MS data was obtained on an LCMS instrument equipped with an electrospray source.
[0355] Example 2: Compound 2 (N-(2-acetylphenyl)-4-((3-methylquinolin-4-yl)amino)benzamide) [ka] [ka] As shown in Scheme 2, 4-aminobenzoic acid was coupled with 4-chloro-3-methylquinoline, followed by conversion of the ester to a carboxylic acid under basic conditions. The resulting intermediate was coupled with 1-(2-aminophenyl)ethan-1-one to form the amide bond in the resulting compound 2: 25 H 21 N3O2; 395.46g / mol; 10mg; off-white solid; ESI-LCMS m / z=396.2[M+H] + LCMS RT=1.75 min, >95% (214 nm and 254 nm).
[0356] Example 3: Compound 3 (N-(2-acetylphenyl)-2-(4-((3-methylquinolin-4-yl)amino)phenyl)acetamide) [ka] [ka] As shown in Scheme 3, the intermediate from Example 1 was coupled with 1-(2-aminophenyl)ethan-1-one to form an amide bond in the resulting compound 3: 26 H 23 N3O2; 409.49 g / mol; 11 mg; pale yellow solid; ESI-LCMS m / z=410.1 [M+H] + LCMS RT=1.71 min, >95% (214 nm and 254 nm).
[0357] Example 4: Compound 4 (2-(4-((3-methylquinolin-4-yl)amino)phenyl)-N,N-di(pyridin-2-yl)acetamide) [ka] Compound 4 was prepared by methods known in the art and / or similar to those described herein. Compound 4 (2-(4-((3-methylquinolin-4-yl)amino)phenyl)-N,N-di(pyridin-2-yl)acetamide): C 28 H 23 NO; 445.53 g / mol; 14 mg; pale yellow solid; ESI-LCMS m / z=446.2 [M+H] + LCMS RT=1.53 min, >95% (214 nm and 254 nm).
[0358] Example 5: Compound 5 (N-(3-acetylphenyl)-2-(4-((2-methylquinolin-4-yl)amino)phenyl)acetamide) [ka] [ka] Compound 5 was prepared as shown in Scheme 4.
[0359] Process a To a stirred mixture of 4-chloro-2-methylquinoline (3.54 g, 0.02 mol) in 1,4-dioxane (50 mL), methyl 2-(4-aminophenyl)acetate (3.3 g, 0.02 mol), Cs2CO3 (13 g, 0.04 mol), Pd2(dba)3 (350 mg) and Xantphos (350 mg) were added under N2. The resulting mixture was stirred at 100 °C for 4 h. The reaction was then quenched with water (80 mL) and extracted with EtOAc (3 × 500 mL). The combined organic phases were dried over Na2SO4, filtered and concentrated. The residue was purified by flash chromatography on silica gel (0-50% EtOAc in petroleum ether) to give compound 5-1 as a solid (5.5 g, 90% yield).
[0360] Process b To a stirred solution of compound 5-1 (3.06 g, 0.01 mmol) in MeOH (15 mL) / THF (15 mL) was added 5N NaOH (5 mL). The resulting mixture was stirred at room temperature for 2 h, concentrated, adjusted to pH 4 with 1N HCl, and filtered to give compound 5-2 (2.6 g, 90% yield).
[0361] Process c To a mixture of compound 5-2 (2 g, 6.8 mmol) in dry DCM (20 mL) was added sulfurous dichloride (1.61 g, 13.6 mmol) and DMF (catalyst). The mixture was stirred at room temperature for 4 h. The mixture was concentrated to give crude compound 5-3 (2.2 g, 100% yield).
[0362] Process dTo a mixture of 1-(3-aminophenyl)ethan-1-one (80 mg, 0.59 mmol) and TEA (179 mg, 1.77 mmol) in dry DCM (10 mL), compound 5-3 (200 mg, 0.64 mmol) was added and the mixture was stirred at room temperature for 4 h. The mixture was concentrated and the crude product was purified by preparative HPLC to give compound 5 (20 mg, 9% yield) as a yellow solid.
[0363] Compound 5 (N-(3-acetylphenyl)-2-(4-((2-methylquinolin-4-yl)amino)phenyl)acetamide): C 26 H 23 NO; 409.48 g / mol; 20 mg; yellow solid; ESI-LCMS m / z=410 [M+H] + LCMS RT=1.54 min, >95% (214 nm and 254 nm).
[0364] Example 6: Compound 6 (N-(3-acetylpyridin-4-yl)-2-(4-((2-methylquinolin-4-yl)amino)phenyl)acetamide) [ka] [ka] Compound 6 was prepared as shown in Scheme 5.
[0365] Process a To a mixture of 1-(4-aminopyridin-3-yl)ethan-1-one (50 mg, 0.36 mmol) and TEA (110 mg, 1.08 mmol) in dry DCM (8 mL), compound 5-3 (135 mg, 0.43 mmol) was added and the mixture was stirred at room temperature for 4 h. The mixture was concentrated and the crude product was purified by preparative HPLC to give compound 6 (20 mg, 13% yield) as a yellow solid.
[0366] Compound 6 (N-(3-acetylpyridin-4-yl)-2-(4-((2-methylquinolin-4-yl)amino)phenyl)acetamide): C 25 H 22N4O2; 410.47g / mol; 20mg; yellow solid; ESI-LCMS m / z=411[M+H] + LCMS RT=1.48 min, >95% (214 nm and 254 nm).
[0367] Example 7: Compound 7 (N-(2-methylpyridin-4-yl)-2-(4-((2-methylquinolin-4-yl)amino)phenyl)acetamide) [ka] [ka] Compound 7 was prepared as shown in Scheme 6.
[0368] Process a To a mixture of 2-methylpyridin-4-amine (40 mg, 0.37 mmol) and TEA (112 mg, 1.11 mmol) in dry DCM (6 mL), compound 5-3 (126 mg, 0.41 mmol) was added and the mixture was stirred at room temperature for 4 h. The mixture was concentrated and the crude product was purified by preparative HPLC to give compound 7 (18 mg, 12.7% yield) as a yellow solid.
[0369] Compound 7 (N-(2-methylpyridin-4-yl)-2-(4-((2-methylquinolin-4-yl)amino)phenyl)acetamide): C 24 H 22 NO; 382.46 g / mol; 18 mg; yellow solid; ESI-LCMS m / z=383 [M+H] + LCMS RT=1.38 min, >95% (214 nm and 254 nm).
[0370] Example 8: Biological Assays Foxp3 induction assay Sorted or enriched (Miltenyi magnetic separation) CD4 conventional T cells (Tconvs-CD4+ / CD25) from C57 / Bl6 mice were used for induction of iTregs. 10 μg / mL plate bound anti-CD3 antibody (50 μl per well, 96-well plate), 2.5 μg / mL soluble anti-CD28 antibody, 100 IU / mL IL2 and 5 ng / mL TGF-β were used in the absence or presence of different concentrations of drugs (usually titrated from 0.01 uM to 10 uM). As negative control for induction, samples without TGF-β were used.
[0371] After 3 days of culture in the presence of stimuli, TGF-β and drugs, cells were stained using a fixable live / dead cell stain (Life Technologies, NY) for gating and exclusion of toxic doses. Cells were fixed and permeabilized using a mouse Foxp3 buffer kit according to the manufacturer's instructions (BD Bioscience, San Jose, CA). Cells were stained using anti-CD4 and anti-Foxp3 antibodies. After staining, cells were acquired using a flow cytometer.
[0372] The Akt3 inhibitory and activating activities of selected compounds disclosed herein are shown in Table 1, respectively. [Table 1]
Claims
1. Formula I: 【Chemistry 1】 [During the ceremony, 【Chemistry 2】 teeth, 【Transformation 3】 and X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 and X 9 Each occurrence of 1 or N, R 1 Each occurrence of is independently selected from H, D, halogen, (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) haloalkyl, (C 2 ~C 6 ) alkenyl, (C 2 ~C 6 ) haloalkenyl, (C 2 ~C 6 ) alkynyl, (C 2 ~C 6 ) haloalkynyl, (C 3 ~C 7 ) cycloalkyl, (C 4 ~C 10 ) bicycloalkyl, (C 4 ~C 14 ) tricycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, halogenated (C 3 ~C 7 ) heterocycloalkyl, (C 4 ~C 10 ) heterobicycloalkyl, (C 4 ~C 14 ) heterotricycloalkyl, (C 4 ~C 10 ) heterospiroalkyl, (C 3 ~C 7 ) cycloalkenyl, (C 3 ~C 7 ) heterocycloalkenyl, (C 4 ~C 10 ) bicycloalkenyl, (C 4 ~C 10 ) heterobicycloalkenyl, (C 4 ~C 14 ) tricycloalkenyl, (C 4 ~C 14 ) heterotricycloalkenyl, aryl, heteroaryl, -OR a , -SR a , -N(R a ) 2 , -COR a , -CO 2 R a , -CON(R a ) 2 、-CN、-NC、NO 2 、N 3 、-SO 2 R a 、-SO 2 N(R a ) 2 、-N(R a )SO 2 R a 、 【Chemistry 4】 and one or more (C 1 ~C 6 ) alkyl, halogenated (C 1 ~C 6 ) alkyl, -SO 2 R a or -SO 2 N(R a ) 2 partially saturated bicyclic heteroaryl, optionally substituted with R 1 (C 3 ~C 7 ) cycloalkyl, (C 4 ~C 10 ) bicycloalkyl, (C 4 ~C 14 ) tricycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, halogenated (C 3 ~C 7 ) heterocycloalkyl, (C 4 ~C 10 ) heterobicycloalkyl, (C 4 ~C 14 ) heterotricycloalkyl, (C 4 ~C 10 ) heterospiroalkyl, (C 3 ~C 7 ) cycloalkenyl, (C 3 ~C 7 ) heterocycloalkenyl, (C 4 ~C 10 ) bicycloalkenyl, (C 4 ~C 10 ) heterobicycloalkenyl, (C 4 ~C 14 ) tricycloalkenyl, (C 4 ~C 14 ) Heterotricycloalkenyl, aryl and heteroaryl are each selected from the group consisting of one or more (C 1 ~C 6 ) alkyl, halogenated (C 1 ~C 6 ) Alkyl, halogen, -OR a , —CN or —N(R a ) 2 are substituted as appropriate, n is an integer from 0 to 4, as allowed by valence; Q is C(R a ) 2 , O., N.R. a , N(C=O)R a or NSO 2 R a and Y 1 , Y 2 , Y 3 , Y 4 and Y 5 are each independently N or CR as allowed by valence. 2 However, 【Transformation 5】 But Y 3 or Y 5 and part 【Transformation 6】 When bonded to Y 3 or Y 5 is C, R 2 Each occurrence of is independently selected from H, D, halogen, (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) haloalkyl, (C 2 ~C 6 ) alkenyl, (C 2 ~C 6 ) haloalkenyl, (C 2 ~C 6 ) alkynyl, (C 2 ~C 6 ) haloalkynyl, (C 3 ~C 7 ) cycloalkyl, (C 4 ~C 10 ) bicycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, (C 4 ~C 10 ) heterobicycloalkyl, (C 4 ~C 10 ) Heterospiroalkyl, halogenated (C 3 ~C 7 ) heterocycloalkyl, aryl, heteroaryl, -OR a , -SR a , -N(R a ) 2 , -COR a , -CO 2 R a , CON(R a ) 2 , -CN, -NC, NO 2 , N 3 , -SO 2 R a , -SO 2 N(R a ) 2 , -N(R a )SO 2 R a , 【Transformation 7】 is selected from the group consisting of R 4 Each occurrence of is independently selected from H, halogen, (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) haloalkyl, (C 2 ~C 6 ) alkenyl, (C 2 ~C 6 ) haloalkenyl, (C 2 ~C 6 ) alkynyl, (C 2 ~C 6 ) haloalkynyl, (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, aryl, heteroaryl, -OR a and -N(R a ) 2 is selected from the group consisting of R 5 Each occurrence of is independently selected from H, halogen, (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) haloalkyl, (C 2 ~C 6 ) alkenyl, (C 2 ~C 6 ) haloalkenyl, (C 2 ~C 6 ) alkynyl, (C 2 ~C 6 ) haloalkynyl, (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, aryl, heteroaryl, —ORa and —N(R a ) 2 or selected from the group consisting of Or any two R bonded to two adjacent carbon atoms 4 The groups, together with the two adjacent carbon atoms to which they are attached, are optionally substituted (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, or halogenated (C 3 ~C 7 ) forming a heterocycloalkyl, m is an integer from 0 to 3; R 6 is H, (C 1 ~C 6 ) alkyl, (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, aryl or heteroaryl; 【Transformation 8】 teeth, 【Chemistry 9】 and Z is CR 3 or N, W is O, NR 8 or S, and R 8 is H, (C 1 ~C 6 ) alkyl, (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, aryl or heteroaryl; R 3 Each occurrence of is independently selected from H, halogen, (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) haloalkyl, (C 2 ~C 6 ) alkenyl, (C 2 ~C 6 ) haloalkenyl, (C 2 ~C 6 ) alkynyl, (C 2 ~C 6 ) haloalkynyl, —ORa, —N(R a ) 2 , -COR a , -CO 2 R a , -CON(R a ) 2 , —CN, —NC or —NO 2 is selected from the group consisting of R 7 Each occurrence of is independently selected from H, halogen, (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) haloalkyl, (C 2 ~C 6 ) alkenyl, (C 2 ~C 6 ) haloalkenyl, (C 2 ~C 6 ) alkynyl, (C 2 ~C 6 ) haloalkynyl, -ORa, -SR a , -N(R a ) 2 , -COR a , -CO 2 R a , -CON(R a ) 2 , -CN, -NC, -NO 2 , -N 3 , -SO 2 R a , -SO 2 N(R a ) 2 , -N(R a )SO 2 R a , 【Chemistry 10】 selected from the group consisting of optionally substituted aryl and optionally substituted heteroaryl; Or any two R 7 The groups, together with the carbon atoms to which they are attached, are represented by (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) heterocycloalkyl, halogenated (C 3 ~C 7 ) forming a heterocycloalkyl, aryl, or heteroaryl; p is an integer from 0 to 3, as allowed by the valence; R a Each occurrence of is independently H, (C 1 ~C 6 ) alkyl, (C 2 ~C 6 ) alkenyl, (C 3 ~C 7 ) cycloalkyl, aryl, or heteroaryl, or two R a together, halogen or (C 1 ~C 6 ) forming a 4- to 6-membered ring optionally substituted with alkyl. or a pharmaceutically acceptable salt thereof.
2. Formula Ia: 【Chemistry 11】 or having the structure Formula Ib: 【Chemistry 12】 having the structure 2. The compound of claim 1 or a pharmaceutically acceptable salt thereof. 【Request Item 3】 【Chemistry 13】 but, a) 【Chemistry 14】 is; As desired structural part 【Chemistry 15】 but, 【Chemistry 16】 and optionally having the structure n is 0, 1 or 2; or structural part 【Chemistry 17】 but, [Chemistry 18] and optionally having the structure structural part 【Chemistry 19】 but, 【Chemistry 20】 or having the structure b) 【Chemistry 21】 is; As desired structural part 【Chemistry 22】 but, 【Chemistry 23】 and optionally having the structure n is 0, 1 or 2; or structural part 【Chemistry 24】 but, 【Chemistry 25】 and optionally having the structure structural part 【Chemistry 26】 but, 【Chemistry 27】 and optionally having the structure structural part 【Chemistry 28】 but, 【Chemistry 29】 or having the structure c) 【Transformation 30】 is; As desired structural part 【Chemistry 31】 but, 【Chemistry 32】 and optionally having the structure structural part 【Transformation 33】 but, 【Transformation 34】 or having the structure d) 【Chemistry 35】 That is, 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof.
4. Q is O; or Q is NH; 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof.
5. R 1 each occurrence independently represents H, D, halogen, —ORa, —N(R a ) 2 , (C 1 ~C 6 ) alkyl, (C 1 ~C 6 ) alkynyl, (C 3 ~C 7 ) heterocycloalkyl, (C 4 ~C 10 ) Heterospiroalkyl, halogenated (C 3 ~C 7 ) heterocycloalkyl, aryl, (C 4 ~C 10 ) Bicycloalkyl, -CN, -N 3 , -NO 2 , -COR a , -CO 2 R a , -CON(R a ) 2 , -SO 2 R a or -SO 2 N(R a ) 2 and (C 3 ~C 7 ) heterocycloalkyl is one or more (C 1 ~C 6 ) optionally substituted with alkyl; (i) each occurrence of R 1 is independently H, halogen, (C 1 -C 6 )alkyl, (C 3 -C 7 )heterocycloalkyl, (C 4 -C 10 )heterospiroalkyl, halogenated (C 3 -C 7 )heterocycloalkyl, —N(R a ) 2 , or —CN, wherein the (C 3 -C 7 )heterocycloalkyl is optionally substituted with one or more (C 1 -C 6 )alkyl; each occurrence of R 1 is independently H, (C 1 -C 6 )alkyl, (C 3 -C 7 )heterocyclohaloalkyl, or (C 3 -C 7 )heterocycloalkyl, where the (C 3 -C 7 )heterocycloalkyl is optionally substituted with one or more (C 1 -C 6 )alkyl; (ii) each occurrence of R 1 is independently H, D, F, Cl, Br, CH 3 , OCH 3 , NH 2 , NHCH 3 , N(CH 3 ) 2 , 【Transformation 36】 is; optionally Each occurrence of R 1 is independently H, D, F, CH 3 , NH 2 , NHCH 3 , N(CH 3 ) 2 , 【Chemistry 37】 That is, 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof.
6. a) R 1 At least one occurrence of 【Transformation 38】 is; or b) at least one occurrence of R 1 is 【Chemistry 39】 and X is CR 15 , O, NR 14 or S, each occurrence of R 9 is independently H, (C 1 -C 6 )alkyl, halogenated (C 1 -C 6 )alkyl, halogen, —OR a , —CN or —N(R a ) 2 , R 14 is H, (C 1 -C 6 )alkyl, (C 3 -C 7 )cycloalkyl, (C 3 -C 7 )heterocycloalkyl, aryl or heteroaryl, each occurrence of R 15 is independently H, (C 1 -C 6 )alkyl, halogenated (C 1 -C 6 )alkyl, halogen, —OR a , —CN or —N(R a ) 2 , and q is 0, 1, 2 or 3; optionally (i) X is O or X is NR 14 and R 14 is H or (C 1 -C 6 )alkyl; and / or (ii) each occurrence of R 9 is independently H, (C 1 -C 6 )alkyl, halogenated (C 1 -C 6 )alkyl, or halogen; optionally each occurrence of R 9 is independently H, F, Cl, Br, CH 3 , CF 3 , OH, NH 2 , —NHCH 3 or —N(CH 3 ) 2 ; optionally each occurrence of R 9 is independently H, F, Cl, Br, or CH 3 ; and / or (iii) each occurrence of R 15 is independently H, (C 1 -C 6 )alkyl, halogenated (C 1 -C 6 )alkyl, or halogen; optionally each occurrence of R 15 is independently H, F, Cl, Br, or CH 3 ; and / or (iv) q is 0; or q is 1; or q is 2 or 3; and / or (v) at least one occurrence of R 1 is 【Chemistry 40】 and X is O or NR 14 , and R 14 is H or (C 1 -C 6 )alkyl; optionally At least one occurrence of R 1 is 【Chemistry 41】 That is, 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof. 【Request Item 7】 【Chemistry 42】 but, 【Chemistry 43】 and R 12 However, (C 3 ~C 7 ) cycloalkenyl, (C 3 ~C 7 ) heterocycloalkenyl, (C 4 ~C 10 ) bicycloalkenyl, (C 4 ~C 10 ) heterobicycloalkenyl, (C 4 ~C 14 ) tricycloalkenyl or (C 4 ~C 14 )heterotricycloalkenyl, each of which is one or more (C 1 ~C 6 ) alkyl, halogenated (C 1 ~C 6 ) Alkyl, halogen, -OR a , —CN or —N(R a ) 2 optionally substituted with R 12 is 【Chemistry 44】 and X is CR 15 , O, NR 14 or S, each occurrence of R 9 is independently H, (C 1 -C 6 )alkyl, halogenated (C 1 -C 6 )alkyl, halogen, —OR a , —CN or —N(R a ) 2 , R 14 is H, (C 1 -C 6 )alkyl, (C 3 -C 7 )cycloalkyl, (C 3 -C 7 )heterocycloalkyl, aryl or heteroaryl, each occurrence of R 15 is independently H, (C 1 -C 6 )alkyl, halogenated (C 1 -C 6 )alkyl, halogen, —OR a , —CN or —N(R a ) 2 , and q is 0, 1, 2 or 3; optionally R 12 is 【Chemistry 45】 and X is O or NR 14 , and R 14 is H or (C 1 -C 6 )alkyl; optionally R 12 is 【Chemistry 46】 That is, 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof.
8. structural part 【Chemistry 47】 but, a) 【Chemistry 48】 【Chemistry 49】 [Transformation 50] wherein Q is O or NH; or b) 【Chemistry 51】 【Chemistry 52】 【Chemistry 53】 wherein Q is O or NH; 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof.
9. structural part 【Chemistry 54】 but, a) 【Transformation 55】 wherein Q is O or NH, and R 1 However, H, (C 1 ~C 6 ) alkyl, (C 3 ~C 7 ) heterocycloalkyl, halogenated (C 3 ~C 7 ) heterocycloalkyl or halogen; or b) 【Transformation 56】 wherein Q is O or NH; 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof.
10. structural part 【Chemistry 57】 but, 【Transformation 58】 3. The compound of claim 1 or 2, wherein Q is O or NH, or a pharmaceutically acceptable salt thereof.
11. structural part 【Chemistry 59】 But Y 5 is bound to; a) Structural part 【Transformation 60】 but, 【Chemistry 61】 and optionally having the structure structural part 【Transformation 62】 But Y 5 The structural part 【Transformation 63】 but, 【Chemistry 64】 and optionally having the structure each occurrence of R 2 is independently H, halogen, CH 3 , CF 3 , OH, NH 2 , —NHCH 3 , or —N(CH 3 ) 2 ; or structural part 【Transformation 65】 is bonded to Y 5 , and the structural moiety 【Chemical Formula 66】 but, 【Transformation 67】 or having the structure b) Structural part 【Transformation 68】 is bonded to Y 3 , and the structural moiety 【Transformation 69】 but, 【Transformation 70】 and optionally having the structure structural part 【Chemistry 71】 is bonded to Y 3 , and the structural moiety 【Chemistry 72】 but, 【Transformation 73】 and optionally having the structure each occurrence of R 2 is independently H, halogen, CH 3 , CF 3 , OH, NH 2 , —NHCH 3 , or —N(CH 3 ) 2 ; or structural part 【Chemistry 74】 is bonded to Y 3 , and the structural moiety 【Chemistry 75】 but, 【Transformation 76】 having the structure 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof. Claim 12: a) m is 0; or m is 1; or m is 2 or 3; and / or (i) each occurrence of R 4 is independently H, halogen, (C 1 -C 6 )alkyl, (C 1 -C 6 )haloalkyl, (C 3 -C 7 )cycloalkyl, —ORa, or —N(R a ) 2 ; optionally each occurrence of R 4 is independently H, halogen, CH 3 , CF 3 , OH, NH 2 , —NHCH 3 , or —N(CH 3 ) 2 ; (ii) any two R 4 groups bonded to two adjacent carbon atoms, together with the two adjacent carbon atoms to which they are bonded, form a (C 3 -C 7 )cycloalkyl, a (C 3 -C 7 )heterocycloalkyl, or a halogenated (C 3 -C 7 )heterocycloalkyl; and / or c) Structural part 【Chemical 77】 but, (i) 【Transformation 78】 wherein the Y ring is (C 3 -C 7 )cycloalkyl; structural part 【Transformation 79】 but, 【Chemistry 80】 or having the structure (ii) structural parts; 【Chemistry 81】 but, 【Chemistry 82】 and / or having the structure d) each occurrence of R 5 is independently H, halogen, (C 1 -C 6 )alkyl, (C 1 -C 6 )haloalkyl, —ORa, or —N(R a ) 2 , optionally with each occurrence of R 5 being independently (C 3 -C 7 )cycloalkyl, (C 3 -C 7 )heterocycloalkyl, aryl, or heteroaryl; or each occurrence of R 5 is independently (C 3 -C 7 )cycloalkyl, (C 3 -C 7 )heterocycloalkyl, aryl, or heteroaryl; and / or e) R 6 is H or (C 1 -C 6 ) alkyl; or R 6 is (C 3 -C 7 )cycloalkyl, (C 3 -C 7 )heterocycloalkyl, aryl, or heteroaryl; optionally R 6 is H, CH 3 , CH 2 CH 3 , CH(CH 3 ) 2 , 【Chemistry 83】 That is, 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof. 【Request Item 13】 【Chemistry 84】 but, a) 【Chemical 85】 is; As desired (i) Structural part 【Chemical 86】 but, 【Transformation 87】 and optionally having the structure structural part 【Chemical 88】 but, 【Chemical 89】 and / or having the structure (ii) R 3 each occurrence of is independently selected from H, halogen, CH 3 , C.F. 3 , OH, NH 2 , -NHCH 3 or -N(CH 3 ) 2 and / or (iii) R 7 Each occurrence of is independently H, halogen, (C 1 ~C 6 ) Alkyl, -CN, -NC, -NO 2 , N 3 , -OR a , -SR a , -N(R a ) 2 where R 7 are respectively -COR a , -CO 2 R a , -CON(R a ) 2 , -SO 2 R a , -N(R a ) 2 , -N(R a ) SO 2 R a , 【Chemistry 90】 and optionally, R 7 Each occurrence of 3 , C.H. 2 CH 3 , CH(CH 3 ) 2 , C.F. 3 , OH, NH 2 , -NHCH 3 or -N(CH 3 ) 2 , -SO 2 NH 2 , -COR a , -CONH 2 or 【Chemistry 91】 is; As desired R 8 Each occurrence of 3 , C.H. 2 CH 3 , CH(CH 3 ) 2 or CF 3 is; or R 7 Each entity of 【Chemistry 92】 each of which is optionally substituted with one or more of alkyl, OH, or halogen; or Any two R 7 The groups, together with the carbon atoms to which they are attached, form (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) forming a heterocycloalkyl, aryl or heteroaryl; and / or (iv) R a Each occurrence of H, (C 2 ~C 6 ) alkenyl or (C 1 ~C 6 ) alkyl; optionally R a Each occurrence of 3 or CH 2 CH 3 is; or b) 【Chemistry 93】 is; As desired (i) Structural part 【Chemical 94】 but, 【Chemical 95】 or having the structure 【Chemistry 96】 but, 【Chemistry 97】 and / or having the structure (ii) R 7 Each occurrence of is independently selected from H, halogen, (C 1 ~C 6 ) Alkyl, -CN, -NC, -NO 2 , N 3、 -ORa, -SR a , -N(R a ) 2 and R 7 Each occurrence of -COR a , -CO 2 R a , -CON(R a ) 2 , -SO 2 R a , -SO 2 N(R a ) 2 , -N(R a )SO 2 R a , 【Chem.98】 and optionally R 7 Each occurrence of 3 , C.H. 2 CH 3 , CH(CH 3 ) 2 , C.F. 3 , OH, NH 2 , -NHCH 3 or -N(CH 3 ) 2 , -SO 2 NH 2 , -COR a , -CONH 2 or 【Chem.99】 and optionally, R 8 Each occurrence of 3 , C.H. 2 CH 3 , CH(CH 3 ) 2 or CF 3 and / or (iii) R a Each occurrence of H, (C 2 ~C 6 ) alkenyl or (C 1 ~C 6 ) alkyl, and optionally R a Each occurrence of 3 or CH 2 CH 3 is; or R 7 Each entity of 【Chemistry 100】 each of which is optionally substituted with one or more of alkyl, OH, or halogen; or Any two R 7 The groups, together with the carbon atoms to which they are attached, form (C 3 ~C 7 ) cycloalkyl, (C 3 ~C 7 ) forming a heterocycloalkyl, aryl or heteroaryl; or c) 【Chemistry 101】 That is, 3. The compound according to claim 1 or 2, or a pharmaceutically acceptable salt thereof. 【Request Item 14】 【Chemistry 102】 【Chemistry 103】 【Chemical 104】 2. The compound of claim 1, selected from the group consisting of: or a pharmaceutically acceptable salt thereof.
15. 19. A pharmaceutical composition comprising a compound according to any one of claims 1 to 2 or 14 or a pharmaceutically acceptable salt thereof for use in a method of treating a disease in a subject in need thereof, the method comprising administering to the subject an effective amount of the compound; and optionally the disease is selected from the group consisting of neurodegenerative diseases, cachexia, anorexia, obesity, complications of obesity, inflammatory diseases, virally induced inflammatory responses, Gulf War syndrome, tuberous sclerosis, retinitis pigmentosa, transplant rejection, cancer, autoimmune diseases, ischemic tissue injury, traumatic tissue injury, and combinations thereof; optionally a) the disease is a neurodegenerative disease; optionally the neurodegenerative disease is selected from the group consisting of Parkinson's disease, Alzheimer's disease, amyotrophic lateral sclerosis, motor neuron disease, Huntington's disease, HIV-induced neurodegeneration, Lewy body disease, spinal muscular atrophy, prion disease, spinocerebellar degeneration, familial amyloid polyneuropathy, multiple sclerosis, and combinations thereof; or b) the disease is cachexia or anorexia; or c) the disorder is obesity or a complication of obesity; optionally The complications of obesity are selected from the group consisting of impaired glucose tolerance, fatty liver, dyslipidemia, and combinations thereof; or d) the disease is an inflammatory disease; optionally the inflammatory disease is selected from the group consisting of atopic dermatitis, allergies, asthma, and combinations thereof; or e) the disease is a virus-induced inflammatory response; optionally The virus-induced inflammatory response is SARS-induced inflammatory pneumonia, COVID-19 infection, or a combination thereof; or f) the disease is Gulf War syndrome or tuberous sclerosis complex; or g) the disease is retinitis pigmentosa or graft rejection; or h) the disease is ischemic or traumatic tissue injury; or i) the disease is cancer; optionally the cancer is selected from the group consisting of adult T-cell leukemia / lymphoma, bladder, brain, breast, cervical, colorectal, esophageal, kidney, liver, lung, nasopharyngeal, pancreatic, prostate, skin, stomach, uterine, ovarian, and testicular cancer; optionally The cancer is leukemia; optionally Optionally, the leukemia is adult T-cell leukemia / lymphoma; Adult T-cell leukemia / lymphoma caused by human T-cell lymphotropic virus; or j) the disease is an autoimmune disease; optionally Autoimmune diseases include achalasia, Addison's disease, adult Still's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-glomerular basement membrane disease, anti-tubular basement membrane antibody nephritis, antiphospholipid syndrome, autoimmune angioedema, autoimmune autonomic neuropathy, autoimmune encephalomyelitis, autoimmune hepatitis, autoimmune inner ear disease, autoimmune myocarditis, autoimmune oophoritis, autoimmune orchitis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune urticaria, axonal and neuronal neuropathy, Barrow's disease, Behçet's disease, benign mucous membrane pemphigoid, bullous pemphigoid, and Cass disease. Lehmann's disease, celiac disease, Chagas' disease, chronic inflammatory demyelinating polyneuropathy, chronic relapsing multifocal osteomyelitis, Churg-Strauss syndrome, eosinophilic granulomatosis, cicatricial pemphigoid, Cogan's syndrome, cold agglutinin disease, congenital heart block, Coxsackie-myocarditis, CREST syndrome, Crohn's disease, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), discoid lupus erythematosus, Dressler's syndrome, endometriosis, eosinophilic esophagitis, eosinophilic fasciitis, erythema nodosum, essential mixed cryoglobulinemia, Evans' syndrome, fibromyalgia, fibrosing alveolitis, giant cell arteritis (temporal arteritis) , giant cell myocarditis, glomerulonephritis, Goodpasture's syndrome, granulomatosis with polyangiitis, Graves' disease, Guillain-Barré syndrome, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schönlein purpura, herpes gestationis, hidradenitis suppurativa (acne suppurativa), hypogammaglobulinemia, IgA nephropathy, IgG4-related sclerosing disease, immune thrombocytopenic purpura, inclusion body myositis, interstitial cystitis, juvenile arthritis, juvenile diabetes mellitus (type 1 diabetes), juvenile myositis, Kawasaki disease, Lambert-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, lignified conjunctivitis, linear IgA disease, lupus, chronic Lyme disease , Meniere's disease, microscopic polyangiitis, mixed connective tissue disease, Mooren's ulcer, Muscha-Habermann's disease, multifocal motor neuropathy, multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neonatal lupus, neuromyelitis optica, neutropenia, ocular pemphigoid, optic neuritis, relapsing rheumatism, pediatric autoimmune neuropsychiatric disorders, paraneoplastic cerebellar degeneration, paroxysmal nocturnal hemoglobinuria, Parry-Romberg syndrome, pars planitis (peripheral uveitis), Parsonage-Turner syndrome, pemphigus, peripheral neuropathy, perivenous encephalomyelitis, pernicious anemia, POEMS syndrome, polyarteritis nodosa,Polyglandular syndrome type I, polyglandular syndrome type II, polyglandular syndrome type III, polymyalgia rheumatica, polymyositis, post-myocardial infarction syndrome, post-pericardiotomy syndrome, primary biliary cirrhosis, primary sclerosing cholangitis, progestational dermatitis, psoriasis, psoriatic arthritis, pure red cell aplasia, pyoderma gangrenosum, Raynaud's phenomenon, reactive arthritis, reflex sympathetic dystrophy, relapsing polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoid or, k) the compound modulates Akt3 in immune cells; optionally the immune cells are selected from the group consisting of T cells, B cells, macrophages and glial cells; optionally the glial cells are astrocytes, microglia, or oligodendrocytes; optionally the T cells are regulatory T cells; or the compound activates Akt3 signaling; or the compound inhibits Akt3 signaling; or the compound increases the activity or production of regulatory T cells; or the compound reduces the activity or production of regulatory T cells; or l) further comprising administering a second therapeutic agent to the subject; optionally the second therapeutic agent is selected from the group consisting of nutritional supplements, chemotherapeutic agents, anti-inflammatory agents, immunosuppressants, cholinesterase inhibitors, antidepressants, anxiolytics, antipsychotics, riluzole, edaravone, dopamine agonists, MAO B inhibitors, catechol O-methyltransferase inhibitors, anticholinergics, anticonvulsants, tetrabenazine, carbidopa-levodopa, antispasmodics, antibodies, fusion proteins, enzymes, nucleic acids, ribonucleic acids, antiproliferative agents, cytotoxic agents, appetite stimulants, 5-HT3 antagonists, Cox-2 inhibitors, and combinations thereof; or m) further comprising treating the subject with an immunotherapeutic agent, an immune modulator, a costimulatory activating agonist, a cytokine, a chemokine, a chemokine factor, an oncolytic virus, a biologic, a vaccine, a small molecule, a targeted therapy, an anti-inflammatory agent, a cell therapy, chemotherapy, or radiation therapy; Pharmaceutical compositions.