ANTIBODIES THAT BIND EGFR AND cMET

Novel bispecific antibodies targeting EGFR and cMET provide enhanced therapeutic efficacy by inhibiting ligand-induced activation and receptor degradation, addressing resistance in cancer treatment.

JP2025176063APending Publication Date: 2025-12-03MERJUS
View PDF 11 Cites 0 Cited by

Patent Information

Application Number
JP2025141508
Authority / Receiving Office
JP · JP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2017-08-09
Filing Date
2025-08-27
Publication Date
2025-12-03

AI Technical Summary

Technical Problem

Current therapies targeting EGFR and cMET for cancer treatment face challenges with resistance development and lack of clinical efficacy, necessitating novel bispecific antibodies that effectively inhibit both receptors to overcome treatment resistance.

Method used

Development of bispecific antibodies with a first variable domain binding to EGFR and a second variable domain binding to cMET, designed to inhibit ligand-induced activation and promote receptor degradation, with optimized affinity balance and engineered constant regions for enhanced efficacy.

Benefits of technology

The bispecific antibodies demonstrate superior inhibition of HGF-induced cell migration and proliferation in resistant tumor cell lines, reducing treatment resistance and associated toxicities, while maintaining effective therapeutic activity.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 2025176063000008
    Figure 2025176063000008
  • Figure 2025176063000009
    Figure 2025176063000009
  • Figure 2025176063000010
    Figure 2025176063000010
Patent Text Reader

Abstract

To provide bispecific antibodies that comprise a first variable domain that can bind an extracellular part of epidermal growth factor receptor (EGFR), and a second variable domain that can bind an extracellular part of MET Proto-Oncogene, Receptor Tyrosine Kinase (cMET).SOLUTION: An antibody may comprise a common light chain, and may be a human antibody. The antibody may be a full-length antibody. In some embodiments, the bispecific antibody is an IgG1 format antibody having an anti-EGFR, anti-cMET stoichiometry of 1:1. In some embodiments, the antibody has one variable domain that can bind EGFR and one variable domain that can bind cMET.SELECTED DRAWING: None
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] The present invention relates to the field of antibodies. In particular, the present invention relates to the field of therapeutic antibodies, including human antibodies, for the treatment of diseases involving abnormal cells. Furthermore, the present invention relates to antibodies that bind to EGFR and cMET, including multispecific antibodies, and their use in binding EGFR- and cMET-positive cells, particularly tumor cells. [Background technology]

[0002] The epidermal growth factor (EGF) receptor (EGFR) is a cell surface receptor for a member of the epidermal growth factor family (EGF family) of extracellular protein ligands. EGFR is also known as the ErbB-1 receptor. The receptor has traditionally been given various names (EGFR; ERBB; ERBB1; HER1; PIG61; mENA). In the present invention, the human names ErbB-1, EGFR, or HER1 are used interchangeably. EGFR is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: ErbB-1 (EGFR), ErbB-2 (HER2 / c-neu; Her2), ErbB-3 (Her3), and ErbB-4 (Her4).

[0003] EGFR is present on the cell surface and can be activated by the binding of its specific ligands, including epidermal growth factor and transforming growth factor alpha (TGFα). Upon activation by its growth factor ligand, the receptor can transition from an inactive, mostly monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR can pair with another member of the ErbB receptor family, such as ErbB2, to form activated heterodimers. Dimers can also form in the absence of ligand binding, and clusters of activated EGFR can form after ligand binding.

[0004] EGFR dimerization stimulates intrinsic intracellular protein tyrosine kinase (PTK) activity, which induces several signaling cascades that lead to cell proliferation and differentiation. The kinase domain of EGFR can cross-phosphorylate tyrosine residues of other receptors that form complexes with it, and in that way can become activated itself.

[0005] Mutations involving EGFR have been identified in several types of cancer, and it is the target of an expanding class of anticancer therapies, including EGFR tyrosine kinase inhibitors (EGFR-TKIs) such as gefitinib and erlotinib for lung cancer, and antibodies such as cetuximab and panitumumab for colorectal and head and neck cancers.

[0006] Cetuximab and panitumumab are monoclonal antibodies that inhibit receptors. Other monoclonal antibodies in clinical development are zalutumumab, nimotuzumab, and matuzumab. Monoclonal antibodies primarily block extracellular ligand-induced receptor activation by blocking ligand binding to the receptor. When the binding site is blocked, signaling molecules cannot effectively bind and thereby activate downstream signal transduction. Ligand-induced receptor activation can also be inhibited by stabilizing an inactive receptor conformation (matuzumab).

[0007] To date, EGFR-targeted therapy has been associated with the development of treatment resistance over time. Various mechanisms of resistance to EGFR-TKIs have been described. In patients with advanced non-small cell lung cancer (NSCLC), mechanisms of resistance include the development of secondary mutations (e.g., T790M, C797S), activation of alternative signaling pathways (e.g., Met, HGF, AXL, Hh, IGF-1R), aberrant downstream pathways (e.g., AKT mutations, PTEN deficiency), impaired EGFR-TKI-mediated apoptosis pathways (e.g., BCL2-like 11 / BIM deletion polymorphism), and histological transformation. Some mechanisms of resistance have been identified, while others remain unidentified. Similarly, patients with colorectal cancer treated with EGFR antibodies also develop resistance over time. This may be due to the emergence of KRAS mutations. Among those without KRAS mutations, amplification of the MET proto-oncogene can be associated with acquired resistance during anti-EGFR therapy (Bardelli et al., 2013; Cancer Discov. Jun;3(6):658-73. doi: 10.1158 / 2159-8290.CD-12-0558). Tumors may be resistant initially or develop resistance during treatment. Resistance to EGFR-targeted therapy is seen in many EGFR-positive cancers, demonstrating a need in the art for more effective EGFR cancer treatments that improve on standard therapy and are superior in their ability to address EGFR-targeted therapy resistance.

[0008] Dysregulation of the MET proto-oncogene, receptor tyrosine kinase (cMET), and hepatocyte growth factor (HGF) has been reported in various tumors. Ligand-driven cMET activation has been observed in several cancers. Elevated serum and intratumoral HGF levels have been observed in lung and breast cancers and various myelomas (JM Siegfried et al., Ann Thorac Surg 66, 1915 (1998); PC Ma et al., Anticancer Res 23, 49 (2003); BE Elliott et al., Can J Physiol Pharmacol 80, 91 (2002); C. Seidel, et al., Med Oncol 15, 145 (1998)). Overexpression, amplification, or mutation of cMET has been reported in various cancers, such as colorectal, lung, gastric, and renal cancers, and can drive ligand-independent receptor activation (C. Birchmeier et al., Nat Rev Mol Cell Biol 4, 915 (2003); G. Maulik et al., Cytokine Growth Factor Rev 13, 41 (2002)). HGF expression is also associated with activation of the HGF / cMET signaling pathway and is one of the mechanisms by which tumors under selection by EGFR-targeted therapy escape.

[0009] The cMET receptor is formed by proteolytic processing of a common precursor into a single-pass transmembrane, disulfide-linked α / β heterodimer. The extracellular portion of cMET consists of three domain types. Folding of the N-terminal region forms a large semaphorin (Sema) domain encompassing the entire α subunit and part of the β subunit. The plexin-semaphorin-integrin (PSI) domain follows the Sema domain and contains four disulfide bonds. This domain is connected to the transmembrane helix via four immunoglobulin-plexin-transcription (IPT) domains related to immunoglobulin-like domains. Intracellularly, the cMET receptor contains a tyrosine kinase catalytic domain flanked by unique juxtamembrane and carboxy-terminal sequences (Organ and Tsao. Therapeutic Advances in Medical Oncology 3.1_suppl (2011): S7-S19, incorporated herein by reference in its entirety).

[0010] The cMET ligand, hepatocyte growth factor (HGF; also known as scatter factor), and its splicing isoforms (NK1 and NK2) are known ligands of the cMET receptor. HGF was identified in 1991 as a potent mitogen / morphogen. The HGF / cMET signaling pathway plays an important role in the development and progression of various cancers. Dysregulation and / or overactivation of HGF or cMET in human cancers is associated with poor prognosis. cMET can be activated by overexpression, amplification, or mutation. Activation can promote cancer development, progression, invasive growth, and metastasis. cMET can be activated in both HGF-related and HGF-independent manners. HGF-independent activation occurs in the case of cMET overexpression. High levels of cMET can induce (hetero)dimerization and intracellular signaling even in the absence of ligand. Additional ligands do not appear to affect the function of such cMET-overexpressing cells. cMET amplification is associated with cMET overexpression and has become a biomarker for tumor subtypes.

[0011] HGF is ubiquitously expressed throughout the body, indicating that this growth factor is a systemically available cytokine, as well as originating from the tumor stroma. Positive paracrine and / or autocrine loops of cMET activation can lead to further cMET expression. The HGF-specific antibody rilotumumab (AMG102) was developed for gastric cancer. Although phase I and phase II trials appeared promising, a phase III trial (RILOMET-2) with cisplatin and capecitabine as first-line treatment for gastric cancer was terminated following a safety review by the pre-planned data monitoring committee for clinical trial 20070622.

[0012] The relevance of cMET / HGF signaling in resistance to EGFR-targeted therapy has stimulated the development of methods to address resistance. To date, antibody-based approaches, including anti-HGF antibodies; anti-cMET or cMET antibodies; and cMET / EGFR (described in Lee et al., 2015; Immunotargets and Therapy 4: 35-44), have not been clinically effective. The cMET antibodies, onartuzumab (MetMab™) and emibetuzumab (LY-2875358), have been evaluated in Phase II clinical trials. Onartuzumab appears to be effective in combination with the EGFR inhibitor erlotinib against colorectal cancer. However, these results have not been replicated in randomized Phase III clinical trials. MetMAb is a monovalent monoclonal antibody (mAb) against cMET that blocks HGF binding to cMET and subsequent pathway activation (Jin et al., 2008 Cancer Research Vol. 68: 4360-68).

[0013] To overcome problems with anti-EGFR, cMET and HGF immunotherapy, the present invention provides novel bispecific antibodies comprising a first variable domain capable of binding to the extracellular portion of the epidermal growth factor receptor (EGFR) and a second variable domain capable of binding to the extracellular portion of the cMET proto-oncogene, receptor tyrosine kinase (cMET).

[0014] To date, certain bispecific EGFR x cMET antibodies have been described in the art. Castoldi R. et al. (2013) describe a bispecific EGFR x cMET antibody named MetHer1, which has the cMET binding site of antibody 5D5 (or MetMAb) and the EGFR binding site of cetuximab. The bispecific antibody has a fixed EGFR and cMET binding stoichiometry of 2:1 (see accompanying figures).

[0015] U.S. Patent Application Publication No. 20140378664 describes a cMETxEGFR bispecific antibody, among other bispecific antibodies. The complete bispecific antibody is produced as a single protein and subsequently proteolytically cleaved. The two VH / VL domains are produced as single-chain Fv fragments. Antibody binding induces cMET degradation and Akt phosphorylation in gastric cancer cell lines. Moores et al. (2016) describe a potentially immunogenic cMETxEGFR bispecific antibody, designated JNJ-61186372, produced by controlled Fab arm exchange (cFAE) with mutations at positions 405 and 409 according to EU numbering. JNJ-61186372 was shown to be active in vivo using a xenograft model with the tumor cell line H1975, which expresses the cMET ligand HGF. This tumor model is known to depend on the antibody's ADCC activity (Ahmed et al., 2015). JNJ-61186372 has a reported affinity imbalance, with approximately 40x greater affinity for cMET than EGFR (Moores et al., 2016), and the anti-EGFR arm derived from zalutumumab is known to cause infusion-related reactions, skin disorders, among other issues.

[0016] LY3164530 is a bispecific cMET×EGFR antibody that contains the EGFR-binding domain of cetuximab as a single-chain Fv fragment fused to the heavy-chain variable domain of the cMET-binding antibody LY2875358 (emibetuzumab; Kim and Kim 2017). It is a so-called dual variable domain antibody, containing two binding sites for each antigen. No data are provided regarding HGF inhibition by the antibody. The antibody reportedly binds and internalizes cMET and EGFR without active agonism. The authors describe various cMET-, EGFR-, and cMET×EGFR-targeted therapies and conclude that, to date, none of these inhibitors have demonstrated significant efficacy in clinical trials. [Prior art documents] [Patent documents]

[0017] [Patent Document 1] U.S. Patent Application Publication No. 20140378664 [Patent Document 2] International patent application PCT / NL2015 / 050124 [Patent Document 3] International Publication No. 2015 / 130172 [Patent Document 4] International Publication No. 2009 / 157771 [Patent Document 5] U.S. Patent Application Publication No. 13 / 866,747 (now issued as U.S. Patent No. 9,248,181) [Patent Document 6] U.S. Patent Application Publication No. 14 / 081,848 (now issued as U.S. Patent No. 9,358,286) [Patent Document 7] International application PCT / NL2013 / 050294 (published as WO 2013 / 157954) [Patent Document 8] International Publication No. 2013 / 157954 [Patent Document 9] International Publication No. 2013 / 157953 [Patent Document 10] International Publication No. 2017 / 069628 [Non-licensed literature]

[0018] [Non-licensed Document 1] Bardelli, 2013; Cancer Discov. Jun;3(6):658~73 pages doi: 10.1158 / 2159-8290.CD-12-0558 [Non-licensed Document 2] JM Siegfried, Ann Thorac Surg 66, 1915 (1998) [Non-licensed Document 3] PC Maら, Anticancer Res 23, 49 (2003) [Non-licensed Document 4] BE Elliott, Can J Physiol Pharmacol 80, 91 (2002) [Non-licensed Document 5] C. Seidel, Med Oncol 15, 145 (1998) [Non-licensed Document 6] C. Birchmeier, Nat Rev Mol Cell Biol 4, 915 (2003) [Non-licensed Document 7] G. Maulik, Cytokine Growth Factor Rev 13, 41 (2002) [Non-licensed Document 8] Organ and Tsao. Therapeutic advances in medical oncology 3.1_suppl (2011): S7~S19 [Non-licensed Document 9] Leeら, 2015; Immunotargets and Therapy 4: pages 35~44 [Non-licensed Document 10] Jinら, 2008 Cancer Research Vol. 68: 4360~68 pages [Non-licensed Document 11] Olayioye MA et al; EMBO J (2000) Vol 19:3159–3167 [Non-Patent Document 12] Cancer Sci. September 2009;100(9):1566~72 Engineered therapeutic antibodies with improved effector functions. Kubota T, Niwa R, Satoh M, Akinaga S, Shitara K, Hanai N [Non-Patent Document 13] Junttila, TT, K. Parsons et al. (2010). "Superior In vivo Efficacy of Afucosylated Trastuzumab in the Treatment of HER2-Amplified Breast Cancer." Cancer Research 70(11): pp. 4481-4489 [Non-Patent Document 14] JC Almagro1 and J. Fransson (2008) Frontiers in Bioscience 13, pp. 1619-1633 [Non-Patent Document 15] Vecchione et al., EGFR-targeted therapy." Experimental cell research Vol 317 (2011): pp. 2765-2771 [Non-Patent Document 16] Ji H., Zhao X; PNAS 103:7817~7822 (2006) Summary of the Invention [Problem to be solved by the invention]

[0019] Thus, there is a need for novel bispecific cMETxEGFR antibodies, including those that may have the superior properties described herein. [Means for solving the problem]

[0020] In one aspect, the invention provides a bispecific antibody comprising a first variable domain capable of binding to the extracellular portion of the human epidermal growth factor receptor (EGFR) and a second variable domain capable of binding to the extracellular portion of the human MET proto-oncogene, receptor tyrosine kinase (cMET).

[0021] The bispecific antibody may comprise a common light chain. The first and second variable domains preferably comprise the same or substantially the same (common) light chain variable region. The common light chain variable region may be one known to pair well with various recombined human variable region gene segments. More preferably, the common light chain is a variable region encoded by a germline Vk gene segment, preferably an O12 / IgVκ1-39*01 variable region gene segment. Preferred light chain variable regions include rearranged IgVκ1-39*01 / IGJκ1*01 or IgVκ1-39*01 / IGJκ5*01. The light chain of the cMET-binding arm and the light chain of the EGFR-binding arm are preferably the same (common) light chain. The common light chain is preferably a rearranged kappa light chain IgVκ1-39*01 / IGJκ1*01 or IgVκ1-39*01 / IGJκ5*01 joined to a human light chain constant region. The bispecific antibody may be a human antibody. The bispecific antibody may be a full-length antibody. It may have one variable domain capable of binding to EGFR and one variable domain capable of binding to cMET. In one embodiment, the variable domain capable of binding to human EGFR may also advantageously bind to mouse EGFR and / or cynomolgus monkey EGFR. The variable domain capable of binding to human EGFR may bind to domain III of human EGFR. The variable domain capable of binding to cMET may block the binding of antibody 5D5 to cMET. The variable domain capable of binding to cMET may block the binding of HGF to cMET. The Kd of the antibody against cMET is at least 10-fold lower than the Kd of the antibody against EGFR. The amino acids at positions 405 and 409 of one CH3 domain may be the same as the amino acids at the corresponding positions in the other CH3 domain (EU numbering).

[0022] The first variable domain comprises a heavy chain variable region having a CDR1 sequence SYGIS; a CDR2 sequence WISAYX1X2NTNYAQKLQG; and a CDR3 comprising the sequence X3X4X5X6HWWLX7A, where X1 = N or S; X2 = A or G; X3 = D or G; X4 = R, S, or Y; X5 = H, L, or Y; X6 = D or W, and X7 = D or G; and optionally has 0 to 5 amino acid insertions, deletions, substitutions, additions, or combinations thereof, at positions other than X1 to X7.

[0023] The second variable domain may comprise a heavy chain variable region having the amino acid sequence of one of the sequences of SEQ ID NOs: 1 to 23, with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof.

[0024] Bispecific antibodies are described, wherein: X1=N; X2=G; X3=D; X4=S; X5=Y; X6=W and X7=G; X1=N; X2=A; X3=D; X4=S; X5=Y; X6=W and X7=G; X1=S; X2=G; X3=D; X4=S; X5=Y; X6=W and X7=G; X1=N; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D; X1=N; X2=A; X3=D; X4=R; X5=H; X6=W and X7=D; X1=S; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D; X1=N; X2=G; X3=G; X4=Y; X5=L; X6=D and X7=G; X1=N; X2=A; X3=G; X4=Y; X5=L; X6=D and X7=G; or X1=S; X2=G; X3=G; X4=Y; X5=L; X6=D and X7=G. In some embodiments, X1=N; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D; X1=N; X2=A; X3=D; X4=R; X5=H; X6=W and X7=D; or X1=S; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D.

[0025] In a preferred embodiment, X3-X7 = DRHWD and X1 and X2 are NG; SG or NA.

[0026] Bispecific antibodies are described, wherein the heavy chain variable region of the second variable domain comprises the amino acid sequence of one of the sequences of SEQ ID NOs: 1-3; 7; 8; 10; 13; 15; 16; 17; 21; 22 or 23, with 0-10, preferably 0-5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0027] The present invention also provides a method of treating a subject having a tumor, comprising administering a bispecific antibody described herein to an individual in need thereof. Typically, the individual is suffering from a disease involving abnormal cells, for example, the individual may be suffering from a tumor.

[0028] The present invention also provides a bispecific antibody comprising a first variable domain capable of binding to the extracellular portion of the epidermal growth factor receptor (EGFR) and a second variable domain capable of binding to the extracellular portion of the MET proto-oncogene, receptor tyrosine kinase (cMET), wherein the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYX1X2NTNYAQKLQG and a CDR3 comprising the sequence X3X4X5X6HWWLX7A, wherein X1 = N or S; X2 = A or G; X3 = D or G; X4 = R, S or Y; X5 = H, L or Y; X6 = D or W; and X7 = D or G, and having 0 to 5 amino acid insertions, deletions, substitutions, additions, or a combination thereof at positions other than X1 to X7, wherein the second variable domain comprises a heavy chain variable region having one of the amino acid sequences of SEQ ID NOs: 1 to 23, having 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof.

[0029] The first variable domain preferably comprises a heavy chain variable region having the CDR1 sequence SYGIS; the CDR2 sequence WISAYNGNTNYAQKLQG and a CDR3 comprising the sequence DRHWHWWLDAFDY, and the second variable domain preferably comprises a heavy chain variable region having the CDR1 sequence SYSMN; the CDR2 sequence WINTYTGDPTYAQGFTG and a CDR3 sequence ETYYYDRGGYPFDP.

[0030] The present invention also provides bispecific antibodies of the invention disclosed herein for use in treating a subject having a disease involving abnormal cells, such as a tumor.

[0031] Also provided is the use of a bispecific antibody of the invention disclosed herein in the manufacture of a medicament for the treatment of a disease involving abnormal cells, such as a tumor or cancer.

[0032] Also provided is a method of treating a subject having a tumor, preferably an EGFR-positive tumor, a cMET-positive tumor or an EGFR- and cMET-positive tumor, comprising administering the bispecific antibody to an individual in need thereof.

[0033] The antibodies of the invention disclosed herein preferably inhibit HGF-induced EBC1 cell migration in a wound healing assay. Preferably, inhibition is superior to the combination of cetuximab and MetMab. For example, inhibition is preferably achieved by preventing wound closure in the presence of HGF with or without EGF (HGF present at 15 ng / ml, and EGF, if present, at 12.5 ng / ml).

[0034] The antibodies of the presently disclosed invention inhibit HGF and EGF / HGF-induced proliferation of EGFR TKI-resistant tumor cell lines PC-9 and HCC827 when used in combination with a TKI, preferably gefitinib.

[0035] The antibodies of the presently disclosed invention inhibit HGF-induced proliferation of HGF-responsive cells, preferably the EGFR TKI-resistant tumor cell lines PC-9 or HCC827.

[0036] The antibodies of the invention disclosed herein inhibit EGF-induced proliferation of EGF-responsive cells without inducing the toxicities, such as rash and diarrhea, associated with high affinity bivalent EGFR antibodies, making them ideal for combination with TKIs, which have their own toxicity profiles.

[0037] The present invention further includes pharmaceutical compositions comprising the bispecific antibodies disclosed herein.

[0038] The antibodies of the invention may be used to treat tumors that are resistant to treatment with EGFR tyrosine kinase inhibitors, for example erlotinib, gefitinib, or afatinib, analogs of erlotinib, gefitinib, or afatinib, or combinations of one or more of the respective compounds and / or analogs thereof.

[0039] Treatment according to the present invention may further comprise treatment with an EGFR tyrosine kinase inhibitor, for example where the EGFR tyrosine kinase inhibitor is erlotinib.

[0040] Thus, the bispecific antibodies of the present invention may be administered simultaneously, sequentially, or separately from the EGFR tyrosine kinase inhibitor.

[0041] The present invention further includes a nucleic acid molecule or group of nucleic acid molecules that encode, either alone or together, the heavy chain or heavy chain variable regions of the bispecific antibodies or variants thereof disclosed herein. Also provided is a nucleic acid molecule or group of nucleic acid molecules that encode the antibodies disclosed herein.

[0042] In a preferred embodiment, the heavy chain comprises the constant region of an IgG1 antibody, preferably a human IgG1 antibody. The CH2 region of the IgG1 constant region may be engineered to alter or not alter the ADCC and / or CDC activity of the antibody. In a preferred embodiment, the alteration results in enhanced ADCC and / or CDC activity. In a preferred embodiment, the CH3 region of the antibody is engineered to promote heterodimerization of heavy chains comprising a first heavy chain that binds EGFR and a second heavy chain that binds cMET.

[0043] The present invention further includes cells comprising one or more nucleic acid molecules encoding the bispecific antibodies or variants thereof disclosed herein, either alone or together. Also provided are methods for producing the bispecific antibodies or variants thereof disclosed herein using the described cells, preferably together with recovery of the bispecific antibodies or variants thereof from cell culture.

[0044] The present invention further includes cell systems comprising the bispecific antibodies or variants thereof disclosed herein.

[0045] The present invention further provides cells that express the bispecific antibody and / or contain a nucleic acid molecule encoding said bispecific antibody.

[0046] The present invention further includes bispecific antibodies disclosed herein that further comprise a label, preferably a label for in vivo imaging.

[0047] EGFR is a member of a family of four receptor tyrosine kinases (PTKs), designated HerbB-1, -2, -3, and -4. EGFR has an extracellular domain (ECD) consisting of four subdomains, two of which are involved in ligand binding and one of which is involved in homodimerization and heterodimerization (Ferguson, 2008). Reference numbers used in this section refer to the numbering of references in the list, each of which is incorporated by reference, prefixed with "cited herein." EGFR integrates extracellular signals from various ligands and generates diverse intracellular responses (Yarden et al., 2001; and Jorrisen et al., 2003). EGFR is involved in several human epithelial malignancies, particularly breast cancer, bladder cancer, non-small cell lung cancer, lung cancer, colorectal cancer, ovarian cancer, head and neck cancer, and brain cancer. Activating mutations in the gene and overexpression of the receptor and its ligand have been found, leading to autocrine activation loops (for a review, see Robertson et al., 2000). Therefore, this RTK is widely used as a target for cancer therapy. Both small molecule inhibitors targeting the RTK and monoclonal antibodies (mAbs) against the extracellular ligand-binding domain have been developed and have shown some clinical success to date, despite limited patient population selection. The database accession number for the human EGFR protein and its encoding gene is (GenBank NM_005228.3). Other database identifiers for the gene and / or protein are HGNC: 3236; Entrez Gene: 1956; Ensembl: ENSG00000146648; OMIM: 131550, and UniProtKB: P00533. The accession numbers are provided primarily to provide further identification of the EGFR protein as a target; the actual sequence of the EGFR protein bound by the antibody may vary due to mutations in the encoding gene, such as those that occur in some cancers. Reference to EGFR herein refers to human EGFR unless otherwise specified. The antigen-binding site that binds to EGFR binds to EGFR and its various variants, such as those expressed in some EGFR-positive tumors.

[0048] As used herein, the term "EGFR ligand" refers to a polypeptide that binds to and activates EGFR. Examples of EGFR ligands include, but are not limited to, EGF, TGF-α, HB-EGF, amphiregulin, betacellulin, and epiregulin (for review, see Olayioye MA et al.; EMBO J (2000) Vol 19:3159-3167). The term includes biologically active fragments and / or variants of naturally occurring polypeptides.

[0049] cMET, also known as the tyrosine-protein kinase MET or hepatocyte growth factor receptor (HGFR), is a protein encoded by the MET gene in humans. The protein has tyrosine kinase activity. The initial single-chain precursor protein is posttranscriptionally cleaved to produce alpha and beta subunits, which are disulfide-linked to form the mature receptor.

[0050] Abnormally activated cMET can induce tumor growth, the formation of new blood vessels to supply nutrients to the tumor (angiogenesis), and the spread of cancer to other organs (metastasis). cMET is deregulated in many types of human malignancies, including kidney, liver, stomach, breast, and brain cancers. The cMET gene is known under several different names, including MET proto-oncogene, receptor tyrosine kinase; hepatocyte growth factor receptor, tyrosine-protein kinase Met; scatter factor receptor; proto-oncogene c-Met; HGF / SF receptor; HGF receptor; SF receptor; EC 2.7.10.1; Met proto-oncogene; EC 2.7.10; DFNB97; AUTS9; RCCP2; c-Met; MET; HGFR; other identifiers for cMET include HGNC: 7029; Entrez Gene: 4233; Ensembl: ENSG00000105976; OMIM: 164860, and UniProtKB: P08581. The accession numbers are provided primarily to provide further method of identification of the cMET protein as a target; the actual sequence of the cMET protein bound by an antibody may vary due to mutations in the encoding gene, such as those that occur in some cancers. References herein to cMET refer to human cMET unless otherwise specified. Antigen-binding sites that bind to cMET bind to cMET and its various variants, such as those expressed in some cMET-positive tumors.

[0051] Antibodies typically recognize only a portion of an antigen. Antigens are typically, but not necessarily, proteins. The recognition or binding site of an antigen bound by an antibody is called an epitope, which can be linear or conformational. The binding of an antibody to an antigen is typically specific. The "specificity" of an antibody refers to its selectivity for a particular epitope, and "affinity" refers to the strength of the interaction between the antigen-binding site of the antibody and the epitope it binds.

[0052] Exemplary antibodies of the invention disclosed herein bind to EGFR and cMET, preferably human EGFR and human cMET. The EGFR / cMET bispecific antibodies of the invention disclosed herein bind to EGFR, under otherwise identical conditions, at least 100-fold less strongly than the homologous receptors ErbB-2 and ErbB-4 of the same species. The EGFR / cMET bispecific antibodies of the invention disclosed herein bind to cMET, under otherwise identical conditions, at least 100-fold less strongly than the receptors ErbB-2 and ErbB-4 of the same species. Given that the receptors are cell surface receptors, binding can be assayed on cells expressing the receptors. The bispecific antibodies of the invention disclosed herein preferably bind to human, cynomolgus EGFR, and / or mouse EGFR.

[0053] Antibodies that bind to EGFR and cMET may also bind to other proteins as well, if such other proteins contain the same epitope. Thus, the term "bind" does not exclude binding of the antibody to another protein or proteins containing the same epitope. Such binding is typically referred to as cross-reactivity. EGFR / cMET bispecific antibodies typically do not bind to other proteins other than EGFR and / or cMET on the membrane of postnatal, preferably adult, cells. Antibodies according to the invention disclosed herein can typically bind to EGFR with a binding affinity (i.e., equilibrium dissociation constant Kd) of at least 1×10e-6 M, as outlined in more detail below.

[0054] The term "antibody" as used herein refers to a proteinaceous molecule, preferably belonging to the immunoglobulin class of proteins. Antibodies typically contain two variable domains that bind to epitopes on antigens. Such domains are derived from or share sequence homology with antibody variable domains. Bispecific antibodies of the invention disclosed herein preferably contain two variable domains. Antibodies for therapeutic use preferably resemble as closely as possible the natural antibodies of the subject to be treated (e.g., human antibodies for human subjects). Antibody binding can be expressed in terms of specificity and affinity. Specificity determines which antigens or their epitopes are specifically bound by a binding domain. Typically, antibodies for therapeutic use may have an affinity of up to 1×10e-10 M or higher. Antibodies such as the bispecific antibodies of the invention disclosed herein preferably contain the constant domains (Fc portions) of natural antibodies. Antibodies of the invention disclosed herein are typically bispecific full-length antibodies, preferably of the human IgG subclass. Preferably, antibodies of the invention are of the human IgG1 subclass. Such antibodies of the invention disclosed herein have good ADCC properties, advantageous half-lives upon in vivo administration to humans, and CH3 engineering techniques exist to provide modified heavy chains that preferentially form heterodimers over homodimers upon co-expression in clonal cells. The ADCC activity of antibodies can also be improved by techniques known to those skilled in the art.

[0055] The antibodies of the invention disclosed herein are preferably "full-length" antibodies. The term "full-length" according to the invention disclosed herein is defined to include essentially the entire antibody, but not necessarily all of the functions of an intact antibody. For the avoidance of doubt, a full-length antibody contains two heavy chains and two light chains. Each chain contains a constant (C) region and a variable (V) region, which can be broken down into domains designated CH1, CH2, CH3, VH, CL, and VL. Typically, antibodies bind to antigens via the variable domains contained in the Fab portion, and after binding, can interact with molecules and cells of the immune system via the constant domains, usually the Fc portion. Full-length antibodies according to the invention disclosed herein encompass antibodies that may contain mutations that provide desired characteristics. Antibodies in which one or several amino acid residues have been deleted without essentially altering the specificity and / or affinity characteristics of the resulting antibody are encompassed by the term "full-length antibody." For example, an IgG antibody may have 1 to 20 amino acid residue insertions, deletions, or substitutions, or a combination thereof, in the constant region.

[0056] The antibodies according to the invention disclosed herein are preferably bispecific IgG antibodies, preferably bispecific full-length IgG1 antibodies, and more preferably human IgG1. Full-length IgG antibodies are preferred due to their typically advantageous half-life and the need to remain close to fully self (human) molecules for immunogenicity. In some embodiments, the antibodies of the invention are full-length IgG1, IgG2, IgG3, or IgG4 antibodies.

[0057] The invention disclosed herein includes a bispecific antibody comprising a first variable domain capable of binding to the extracellular portion of EGFR and a second variable domain capable of binding to the extracellular portion of cMET, wherein the first variable domain binds to EGFR with lower affinity than cetuximab, which has a Kd of 0.39 nM (Kim et al., 2008). The first variable domain preferably binds to EGFR with a Kd between 10e-6 M and 10e-9 M. The Kd is preferably between 10e-7 M and 10e-9 M, and preferably between 10e-8 M and 10e-9 M. The second variable domain preferably binds to cMET with a Kd of 10e-7 M or less. The Kd is preferably between 10e-7 M and 10e-11 M. The second variable domain preferably has a higher affinity for cMET than the first variable domain for EGFR. In other words, in this preferred embodiment, the Kd of the antibody for cMET is lower than the Kd of the antibody for EGFR. In a preferred embodiment, the Kd of the antibody to cMET is at least 5-fold, preferably 10-fold, lower than the Kd of the antibody to EGFR. In this embodiment, the Kd values ​​for each antigen are preferably as set forth in this section. This appropriate imbalance in affinity allows the bispecific antibodies of the presently disclosed invention to dock to cells, preferably via binding to EGFR, and block binding of the ligand HGF to cMET.

[0058] The variable domain capable of binding to EGFR is preferably a variable domain that, in the context of a bivalent monospecific antibody, inhibits EGF-induced death of A431 cells. Inhibition of EGF-induced cell death is preferably measured at a concentration of 10 mM EGF and 10 μg / ml antibody. Inhibition of EGF-induced cell death can be detected by comparing the number of cells with and without the antibody after 3 to 7 days of culturing A431 cells under conditions permissive for A431 cell growth (but not EGF). Without being bound by theory, it is believed that binding of the antibody to EGFR blocks EGF binding to EGFR. The variable domain capable of binding to EGFR is preferably a variable domain that, in the context of a bivalent monospecific antibody, inhibits EGF-induced proliferation of BxPC3 or BxPC3-luc2 cells.

[0059] The antibodies of the invention disclosed herein preferably inhibit HGF-induced EBC1 cell migration in a wound healing assay. The wound healing assay is preferably the assay described in the Examples. The inhibition of wound healing is superior to the combination of cetuximab and MetMab. The inhibition is typically not 100%. Some wound healing occurs even in the presence of the inhibitory antibody.

[0060] The antibodies of the presently disclosed invention inhibit HGF and EGF / HGF-induced proliferation of EGFR TKI-resistant tumor cell lines PC-9 and HCC827 when used in combination with a TKI, preferably gefitinib.

[0061] The antibodies of the invention disclosed herein inhibit HGF-induced proliferation of HGF-responsive cells, preferably the EGFR TKI-resistant tumor cell lines PC-9 or HCC827.

[0062] The antibodies of the presently disclosed invention inhibit EGF-induced proliferation of EGF-responsive cells without inducing significant common toxicities, such as rash and diarrhea, associated with high affinity bivalent EGFR antibodies, making them ideal for combination with TKIs that have their own toxicity profiles.

[0063] Induced proliferation is preferably measured using the assays described in the Examples. Inhibition is typically not 100%; some proliferation occurs even in the presence of inhibitory antibodies.

[0064] The variable domain, which can bind to EGFR and comprises the amino acid sequence of MF3370 or a variant thereof as set forth herein, preferably binds to EGFR domain III (see Table 4 in International Patent Application No. PCT / NL2015 / 050124; WO 2015 / 130172, incorporated herein by reference). Binding of the variable domain to EGFR can be inhibited by cetuximab. The variable domain binds to an epitope that is different from the epitope recognized by cetuximab and zalutumumab. For example, the variable domain binds to mouse EGFR, but cetuximab and zalutumumab do not, indicating that one or more residues that differ between mouse and human EGFR domain III play a role in cetuximab and zalutumumab binding, but not in the antibodies of the invention described herein. An advantage of the bispecific antibodies of the invention described herein that have human, mouse, and cynomolgus EGFR cross-reactivity is that they allow the use of xenograft studies in human cancer models, which are more predictive with respect to efficacy and toxicity as antibodies that also bind to receptor-bearing normal mouse cells, but can also be used in cynomolgus toxicity studies. In one aspect, the invention provides a bispecific antibody comprising a first variable domain capable of binding to the extracellular portion of the human epidermal growth factor receptor (EGFR) and a second variable domain capable of binding to the extracellular portion of the human MET proto-oncogene, receptor tyrosine kinase (cMET), wherein said first variable domain is also capable of binding to mouse EGFR, cynomolgus EGFR, or both.

[0065] The cMET variable domain preferably comprises the amino acid sequence of MF4356 or a variant thereof as set forth herein and preferably blocks the binding of the antibody MetMab to cMET. The variable domain preferably blocks the binding of the ligand HGF to cMET. The variable domain blocks the binding of the antibody MetMab to cMET if, in the presence of a saturating amount of said variable domain, the binding of MetMab to cMET under half-maximal binding conditions is reduced by at least 40%, preferably at least 60%. The variable domain is preferably provided in the context of a bivalent monospecific antibody. The cMET variable domain is preferably capable of binding to the sema domain of cMET. The cMET variable domain of the present invention may compete with 5D5 for binding to cMET, but may not compete with reported anti-cMET reference antibodies such as 5D5.

[0066] The variable domain of the invention disclosed herein is capable of binding to EGFR (first variable domain) and preferably comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYX1X2NTNYAQKLQG and CDR3 comprising the sequence X3X4X5X6HWWLX7A, where X1=N or S; X2=A or G; X3=D or G; X4=R, S or Y; X5=H, L or Y; X6=D or W and X7=D or G.

[0067] X 1~7 is preferably: X1=N; X2=G; X3=D; X4=S; X5=Y; X6=W and X7=G; X1=N; X2=A; X3=D; X4=S; X5=Y; X6=W and X7=G; X1=S; X2=G; X3=D; X4=S; X5=Y; X6=W and X7=G; X1=N; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D; X1=N; X2=A; X3=D; X4=R; X5=H; X6=W and X7=D; X1=S; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D; X1=N; X2=G; X3=G; X4=Y; X5=L; X6=D and X7=G; X1=N; X2=A; X3=G; X4=Y; X5=L; X6=D and X7=G; or X1=S; X2=G; X3=G; X4=Y; X5=L; X6=D and X7=G.

[0068] In a preferred embodiment, X1=N; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D; X1=N; X2=A; X3=D; X4=R; X5=H; X6=W and X7=D; or X1=S; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D. Preferably, X1=N; X2=G; X3=D; X4=R; X5=H; X6=W and X7=D.

[0069] The amino acid following amino acid A in the sequence X3X4X5X6HWWLX7A in the CDR3 sequence of the first variable domain may be varied. The amino acid sequence following the sequence X3X4X5X6HWWLX7A may be FDY. The CDR3 of the first variable domain preferably comprises the sequence X3X4X5X6HWWLX7AF, preferably X3X4X5X6HWWLX7AFD, more preferably X3X4X5X6HWWLX7AFDY.

[0070] The first variable domain preferably comprises a heavy chain variable region having the CDR1 sequence SYGIS; CDR2 sequence WISAYNGNTNYAQKLQG and CDR3 sequence X3X4X5X6HWWLX7A.

[0071] The first variable domain preferably comprises a heavy chain variable region having a CDR1 sequence SYGIS; a CDR2 sequence WISAYNGNTNYAQKLQG; and a CDR3 comprising the sequence DRHWHWWLDA. The amino acids following the sequence LDA in the CDR3 sequence of the first variable domain may vary. The amino acid sequence following the sequence LDA may be FDY. The CDR3 of the first variable domain preferably comprises the sequence DRHWHWWLDAF, preferably DRHWHWWLDAFD, more preferably DRHWHWWLDAFDY.

[0072] The first variable domain preferably comprises a heavy chain variable region having the amino acid sequence of MF3353; MF8229; MF8228; MF3370; MF8233; MF8232; MF3393; MF8227 or MF8226 as shown in Figure 7, with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or combinations thereof with respect to the shown sequence. In a preferred embodiment, the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF3353; MF8229; MF8228; MF3370; MF8233; MF8232; MF3393; MF8227 or MF8226 as shown in Figure 7.

[0073] The variable domain (second variable domain) capable of binding to cMET comprises a heavy chain variable region comprising one of the amino acid sequences of SEQ ID NOs: 1 to 23, preferably with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. The heavy chain variable region of the second variable domain comprises one of the amino acid sequences of SEQ ID NOs: 1 to 3; 7; 8; 10; 13; 15; 16; 17; 21; 22, or 23, preferably with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. The heavy chain variable region of the second variable domain comprises one of the amino acid sequences of SEQ ID NOs: 2; 7; 8; 10; 13, or 23, preferably with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. The heavy chain variable region of the second variable domain preferably comprises the amino acid sequence of SEQ ID NO: 13 or SEQ ID NO: 23, with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0074] In a preferred embodiment, the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS, CDR2 sequence WISAYNGNTNYAQKLQG, and CDR3 sequence DRHWHWWLDA, preferably DRHWHWWLDAFDY, and the second variable domain comprises a heavy chain variable region having CDR1 sequence SYSMN, CDR2 sequence WINTYTGDPTYAQGFTG, and CDR3 sequence ETYYYDRGGYPFDP. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0075] In a preferred embodiment, the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS, CDR2 sequence WISAYNGNTNYAQKLQG, and CDR3 comprising the sequence DRHWHWWLDA, and the second variable domain comprises a heavy chain variable region having CDR1 sequence TYSMN, CDR2 sequence WINTYTGDPTYAQGFTG, and CDR3 comprising the sequence ETYFYDRGGYPFDP. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0076] The bispecific antibody comprises a first variable domain capable of binding to the extracellular portion of EGFR and a second variable domain capable of binding to the extracellular portion of cMET, wherein the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYNANTNYAQKLQG and CDR3 comprising the sequence DRHWHWWLDA, and wherein the second variable domain comprises a heavy chain variable region having CDR1 sequence SYSMN; CDR2 sequence WINTYTGDPTYAQGFTG and CDR3 sequence ETYYYDRGGYPFDP. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0077] The bispecific antibody comprises a first variable domain capable of binding to the extracellular portion of EGFR and a second variable domain capable of binding to the extracellular portion of cMET, wherein the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYNANTNYAQKLQG and CDR3 comprising the sequence DRHWHWWLDA, and the second variable domain comprises a heavy chain variable region having CDR1 sequence TYSMN; CDR2 sequence WINTYTGDPTYAQGFTG and CDR3 comprising the sequence ETYFYDRGGYPFDP. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0078] The bispecific antibody comprises a first variable domain capable of binding to the extracellular portion of EGFR and a second variable domain capable of binding to the extracellular portion of cMET, wherein the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYSGNTNYAQKLQG and CDR3 comprising the sequence DRHWHWWLDA, and wherein the second variable domain comprises a heavy chain variable region having CDR1 sequence SYSMN; CDR2 sequence WINTYTGDPTYAQGFTG and CDR3 sequence ETYYYDRGGYPFDP. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0079] The bispecific antibody comprises a first variable domain capable of binding to the extracellular portion of EGFR and a second variable domain capable of binding to the extracellular portion of cMET, wherein the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYSGNTNYAQKLQG and CDR3 comprising the sequence DRHWHWWLDA, and the second variable domain comprises a heavy chain variable region having CDR1 sequence TYSMN; CDR2 sequence WINTYTGDPTYAQGFTG and CDR3 comprising the sequence ETYFYDRGGYPFDP. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0080] CDR1, CDR2, and CDR3 of the light chains of the first and second variable domains described herein preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT). In some embodiments of the bispecific antibodies described herein, the first and second variable domains comprise a common light chain, preferably the light chain of Figure 9B.

[0081] In another preferred embodiment, the EGFR / cMET bispecific antibody comprises a first variable domain capable of binding to the extracellular portion of human EGFR, the first variable domain comprising CDR1, CDR2, and CDR3 of the heavy chain variable region of MF3755 shown in Figure 1, and a second variable domain capable of binding to the extracellular portion of human cMET, the second variable domain comprising CDR1, CDR2, and CDR3 of the heavy chain variable region of MF4297 shown in Figure 1. The light chain variable regions of the first and second variable domains are preferably the common light chain variable region described herein. The light chain CDR1, CDR2, and CDR3 of the first and second variable domains preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT). In a preferred embodiment, the antibody comprises a heavy chain variable region having the amino acid sequence of MF3755 shown in Figure 1 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, and preferably 0, 1, 2, 3, 4, or 5 amino acid insertions, deletions, substitutions, or a combination thereof, with respect to the sequence shown. In a preferred embodiment, the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF3755 shown in Figure 1. The variable domain capable of binding to cMET (second variable domain) comprises a heavy chain variable region comprising the amino acid sequence of MF4297 shown in Figure 1 with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. The heavy chain variable region of the second variable domain preferably comprises the amino acid sequence of MF4297 shown in Figure 1.

[0082] In the context of the present invention, the term "bispecific" (bs) means that an antibody can bind to two different targets or two epitopes of the same target; for example, one variable domain (as described above) of the antibody binds to an epitope of EGFR, and the second variable domain binds to an epitope of cMET. Depending on the expression level, (sub)cellular localization, and stoichiometry of the two antigens recognized by the bispecific antibody, both Fab arms of the antibody may or may not simultaneously bind to their epitopes. One arm of a bispecific antibody typically contains the variable domain of one antibody, and the other arm contains the variable domain of another antibody (i.e., one arm of the bispecific antibody is formed by one heavy chain paired with one light chain, and the other arm is formed by a different heavy chain paired with a light chain). Thus, the stoichiometry of a preferred bispecific antibody of the invention disclosed herein is 1:1, EGFR:cMET binding.

[0083] The heavy chain variable regions of the bispecific antibodies of the invention disclosed herein are typically different from each other, while the light chain variable regions are preferably the same. Bispecific antibodies in which different heavy chain variable regions are associated with the same light chain variable region are also called bispecific antibodies with a common light chain variable region (cLcv). The light chain constant regions are preferably also the same. Such bispecific antibodies are said to have a common light chain (cLc). Thus, there is further provided a bispecific antibody according to the invention disclosed herein, in which both arms comprise a common light chain.

[0084] The term "common light chain" according to the invention disclosed herein refers to two or more light chains of a bispecific antibody that may be identical or have the same amino acid sequence differences, but the binding specificity of the full-length antibody is not affected. For example, within the definition of common light chain used herein, it is possible to prepare or find a non-identical but still functionally equivalent light chain by introducing and testing, for example, conservative amino acid changes, changes in amino acids in regions that do not contribute or only partially contribute to binding specificity when paired with a heavy chain, etc. The terms "common light chain," "common LC," "cLC," and "single light chain," with or without the addition of the term "rearranged," are all used interchangeably. The terms "common light chain variable region," "common VL," "common LCv," "cLCv," and "single VL," with or without the addition of the term "rearranged," are all used interchangeably. A preferred embodiment of the present invention is a bispecific antibody having a common light chain (variable region) that can bind to at least two, preferably multiple, heavy chains (variable regions) of different binding specificities to form an antibody having a functional antigen-binding domain (see, for example, WO 2009 / 157771). The common light chain (variable region) is preferably a human light chain (variable region). The common light chain (variable region) preferably has a germline sequence. Preferred germline sequences are light chain variable regions with good thermodynamic stability, yield, and solubility. A preferred germline light chain is O12. The common light chain preferably comprises a light chain encoded by a germline human Vk gene segment, preferably the rearranged germline human kappa light chain IgVκ1-39*01 / IGJκ1*01 (FIG. 9A). The common light chain variable region is preferably the variable region of the rearranged germline human kappa light chain IgVκ1-39*01 / IGJκ1*01. The common light chain preferably comprises the light chain variable region shown in Figure 9B or Figure 9D with 0-5 amino acid insertions, deletions, substitutions, additions, or a combination thereof. The common light chain preferably further comprises a light chain constant region, preferably a kappa light chain constant region. The nucleic acid encoding the common light chain can be codon-optimized for the cell system used to express the common light chain protein. The encoding nucleic acid can deviate from the germline nucleic acid sequence.

[0085] In a preferred embodiment, the light chain comprises a light chain region comprising the amino acid sequence of the O12 / IgVκ1-39*01 gene segment shown in FIG. 9A with 0-10, preferably 0-5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. The phrase "O12 light chain" is used throughout the specification as shorthand for "a light chain comprising a light chain variable region comprising the amino acid sequence of the O12 / IgVκ1-39*01 gene segment shown in FIG. 9A with 0-10, preferably 0-5, amino acid insertions, deletions, substitutions, additions, or a combination thereof." IgVκ1-39 is short for the immunoglobulin variable kappa 1-39 gene. The gene is also known as immunoglobulin kappa variable 1-39; IGKV139; IGKV1-39; O12a; or O12. Other IDs for the gene are HGNC: 5740; Entrez Gene: 28930; Ensembl: ENSG00000242371. A preferred amino acid sequence of IgVκ1-39 is shown in Figure 9E, which lists the sequence of the V region. The V region can be combined with one of five J regions. Figures 9B and 9D describe two preferred sequences of IgVκ1-39 combined with a J region. The combined sequences are designated IGKV1-39 / jk1 and IGKV1-39 / jk5, with alternative names being IgVκ1-39*01 / IGJκ1*01 or IgVκ1-39*01 / IGJκ5*01 (designation according to the IMGT database worldwide web at imgt.org).

[0086] Preferably, the O12 / IgVκ1-39*01 comprising the light chain variable region is a germline sequence. More preferably, the IGJκ1*01 or / IGJκ5*01 comprising the light chain variable region is a germline sequence. In a preferred embodiment, the IGKV1-39 / jk1 or IGKV1-39 / jk5 light chain variable region is a germline sequence.

[0087] In a preferred embodiment, the light chain variable region comprises germline O12 / IgVκ1-39*01. In a preferred embodiment, the light chain variable region comprises kappa light chain IgVκ1-39*01 / IGJκ1*01 or IgVκ1-39*01 / IGJκ5*01. In a preferred embodiment, IgVκ1-39*01 / IGJκ1*01. The light chain variable region preferably comprises germline kappa light chain IgVκ1-39*01 / IGJκ1*01 or germline kappa light chain IgVκ1-39*01 / IGJκ5*01, preferably germline IgVκ1-39*01 / IGJκ1*01.

[0088] Mature B cells producing antibodies with O12 light chains often produce light chains with one or more mutations relative to the germline sequence, i.e., the normal sequence in non-lymphoid cells of an organism. The process leading to these mutations is often called somatic (hyper)mutation. The resulting light chain is called an affinity-matured light chain. If such a light chain is derived from the O12 germline sequence, it is an O12-derived light chain. As used herein, the phrase "common light chain" includes common light chain-derived light chains, and the phrase "O12 light chain" includes O12-derived light chains. Mutations introduced by somatic (hyper)mutation can also be artificially introduced in the laboratory. Other mutations can also be introduced in the laboratory without substantially affecting the properties of the light chain, although not necessarily in quantity. A light chain is at least an O12 light chain if it contains the sequence shown in Figure 9A, 9B, 9D, or 9E with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. In a preferred embodiment, the O12 light chain is a light chain comprising the sequence shown in Figure 9A; 9B; 9D or 9E with 0 to 9, 0 to 8, 0 to 7, 0 to 6, 0 to 5, or 0 to 4 amino acid insertions, deletions, substitutions, additions, or a combination thereof. In a preferred embodiment, the O12 light chain is a light chain comprising the sequence shown in Figure 9A, 9B, 9D or 9E with 0 to 5, preferably 0 to 4, and more preferably 0 to 3 amino acid insertions, deletions, substitutions, additions, or a combination thereof. In a preferred embodiment, the O12 light chain is a light chain comprising the sequence shown in Figure 9A, 9B; 9D or 9E with 0 to 2, more preferably 0 to 1, and most preferably 0 amino acid insertions, deletions, substitutions, additions, or a combination thereof. In a preferred embodiment, the O12 light chain is a light chain comprising the sequence shown in Figure 9A or 9B with the amino acid insertions, deletions, substitutions, additions, or a combination thereof as described. In a preferred embodiment, the light chain comprises the sequence of Figure 9A. In a preferred embodiment, the light chain variable region comprises the sequence of Figure 9B. The 1, 2, 3, 4 or 5 amino acid substitutions described are preferably conservative amino acid substitutions, and the insertions, deletions, substitutions or combinations thereof are preferably not in the CDR3 region of the VL chain, and preferably not in the CDR1, CDR2 or CDR3 regions or the FR4 region of the VL chain.

[0089] The common light chain may comprise a lambda light chain, which is therefore also provided in the context of the invention disclosed herein, although a kappa light chain is preferred. The constant portion of the common light chain of the invention disclosed herein may be a kappa or lambda light chain constant region. It is preferably a kappa light chain constant region, preferably wherein said common light chain is a germline light chain, preferably a rearranged germline human kappa light chain comprising an IgVK1-39 gene segment, most preferably the rearranged germline human kappa light chain IgVK1-39*01 / IGJK1*01 (Figure 9). The terms rearranged germline human kappa light chain IgVκ1-39*01 / IGJκ1*01, IGKV1-39 / IGKJ1, huVκ1-39 light chain, or simply huVκ1-39 for short, are used interchangeably throughout this specification.

[0090] Cells producing the consensus light chain can produce a light chain comprising, for example, the rearranged germline human kappa light chain IgVκ1-39*01 / IGJκ1*01 and the variable region of the described light chain fused to a lambda constant region.

[0091] In a preferred embodiment, the light chain variable region comprises the amino acid sequence DIQMT QSPSS LSASV GDRVT ITCRA SQSIS SYLNW YQQKP GKAPK LLIYA ASSLQ SGVPS RFSGS GSGTD FTLTI SSLQP EDFAT YYCQQ SYSTP PTFGQ GTKVE IK or DIQMT QSPSS LSASV GDRVT ITCRA SQSIS SYLNW YQQKP GKAPK LLIYA ASSLQ SGVPS RFSGS GSGTD FTLTI SSLQP EDFAT YYCQQ SYSTP PITFG QGTRL EIK, having 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions, or a combination thereof. In preferred embodiments, the light chain variable region has 0 to 9, 0 to 8, 0 to 7, 0 to 6, 0 to 5, 0 to 4, preferably 0 to 3, preferably 0 to 2, preferably 0 to 1, and preferably 0 amino acid insertions, deletions, substitutions, additions, or a combination thereof with respect to the amino acid sequence shown. A combination of insertions, deletions, additions, or substitutions is claimed if the aligned sequences differ at no more than 5 positions. In a preferred embodiment, the light chain variable region comprises the amino acid sequence DIQMT QSPSS LSASV GDRVT ITCRA SQSIS SYLNW YQQKP GKAPK LLIYA ASSLQ SGVPS RFSGS GSGTD FTLTI SSLQP EDFAT YYCQQ SYSTP PTFGQ GTKVE IK or DIQMT QSPSS LSASV GDRVT ITCRA SQSIS SYLNW YQQKP GKAPK LLIYA ASSLQ SGVPS RFSGS GSGTD FTLTI SSLQP EDFAT YYCQQ SYSTP PITFG QGTRL EIK. In a preferred embodiment, the light chain variable region comprises the amino acid sequence DIQMT QSPSS LSASV GDRVT ITCRA SQSIS SYLNW YQQKP GKAPK LLIYA ASSLQ SGVPS RFSGS GSGTD FTLTI SSLQP EDFAT YYCQQ SYSTP PTFGQ GTKVE IK.In another preferred embodiment, the light chain variable region comprises the amino acid sequence DIQMT QSPSS LSASV GDRVT ITCRA SQSIS SYLNW YQQKP GKAPK LLIYA ASSLQ SGVPS RFSGS GSGTD FTLTI SSLQP EDFAT YYCQQ SYSTP PITFG QGTRL EIK.

[0092] The amino acid insertions, deletions, substitutions, additions, or combinations thereof are preferably not in the CDR3 region of the light chain variable region, and preferably not in the CDR1 or CDR2 regions of the light chain variable region. In a preferred embodiment, the light chain variable region does not contain deletions, additions, or insertions with respect to the sequence shown. In this embodiment, the heavy chain variable region may have 0 to 5 amino acid substitutions with respect to the amino acid sequence shown. The amino acid substitutions are preferably conservative amino acid substitutions. The CDR1, CDR2, and CDR3 of the light chain of the antibody of the present invention preferably comprise the amino acid sequences CDR1-QSISSY, CDR2-AAS, and CDR3-QQSYSTP, respectively, i.e., the CDRs of IGKV1-39 (from IMGT).

[0093] The bispecific antibodies described herein preferably have one heavy chain variable region / light chain variable region (VH / VL) combination that binds to the extracellular portion of EGFR and a second VH / VL combination that binds to the extracellular portion of cMET. In a preferred embodiment, the VL of the first VH / VL combination is similar to the VL of the second VH / VL combination. In a more preferred embodiment, the VLs of the first and second VH / VL combinations are identical. In a preferred embodiment, the bispecific antibody is a full-length antibody having one heavy / light (H / L) chain combination that binds to the extracellular portion of EGFR and one H / L chain combination that binds to the extracellular portion of cMET. In a preferred embodiment, the light chain of the first H / L chain combination is similar to the light chain of the second H / L chain combination. In a more preferred embodiment, the light chains of the first and second H / L chain combinations are identical.

[0094] Several methods have been reported for producing host cells whose expression favors the production of bispecific antibodies or, conversely, monospecific antibodies. In the present invention, cellular expression of antibody molecules favors the production of bispecific antibodies over the production of individual monospecific antibodies. This is typically achieved by modifying the heavy chain constant regions so that they favor heterodimerization (i.e., dimerization with heavy chains of other heavy / light chain combinations) over homodimerization. In a preferred embodiment, the bispecific antibodies of the present invention comprise two different immunoglobulin heavy chains with compatible heterodimerization domains. Various compatible heterodimerization domains have been described in the art. The compatible heterodimerization domains are preferably compatible immunoglobulin heavy chain CH3 heterodimerization domains. When wild-type CH3 domains are used, coexpression of two different heavy chains (A and B) and a common light chain results in three different antibody species: AA, AB, and BB. AA and BB represent two monospecific, bivalent antibodies, while AB represents a bispecific antibody. To increase the proportion of the desired bispecific product (AB), CH3 engineering can be used, or in other words, heavy chains with compatible heterodimerization domains can be used, as described below. Various methods by which such heavy chain heterodimerization can be achieved have been described in the art. One method is to generate "knobs-into-holes" bispecific antibodies.

[0095] As used herein, the term "compatible heterodimerization domains" refers to protein domains that have been engineered such that engineered domain A' preferentially forms heterodimers with engineered domain B', and conversely, homodimerization between A'-A' and B'-B' is precluded.

[0096] US Patent Application Publication No. 13 / 866,747 (now issued as US Patent No. 9,248,181), US Patent Application Publication No. 14 / 081,848 (now issued as US Patent No. 9,358,286), and International Application PCT / NL2013 / 050294 (published as WO 2013 / 157954; incorporated herein by reference) disclose methods and means for producing bispecific antibodies using interchangeable heterodimerization domains. These means and methods may also be advantageously used in the present invention. In particular, the bispecific antibodies of the invention disclosed herein preferably contain mutations that result in substantial expression of bispecific full-length IgG molecules in host cells. Preferred mutations are the amino acid substitutions L351K and T366K in the first CH3 domain ('KK-mutant' heavy chain) and the amino acid substitutions L351D or L368E in the second domain ('DE-mutant' heavy chain), or vice versa. U.S. Patent Nos. 9,248,181 and 9,358,286 and PCT Publication WO 2013 / 157954 (incorporated herein by reference) demonstrated that DE and KK mutants preferentially pair to form heterodimers (so-called 'DEKK' bispecific molecules). Homodimerization of DE mutant heavy chains (DEDE homodimers) is disfavored due to repulsion between charged residues at the CH3-CH3 interface between identical heavy chains.

[0097] Bispecific antibodies can be generated by (transient) transfection of plasmids encoding two different heavy chains and a light chain whose CH3 has been engineered to ensure efficient heterodimerization and bispecific antibody formation. Producing these chains in a single cell favors the formation of bispecific antibodies over monospecific antibodies. Preferred mutations that produce essentially only bispecific full-length IgG1 molecules are amino acid substitutions at positions 351 and 366, e.g., L351K and T366K (EU numbering) in the first CH3 domain ('KK mutant' heavy chain), and amino acid substitutions at positions 351 and 368, e.g., L351D and L368E in the second CH3 domain ('DE mutant' heavy chain), or vice versa (see, e.g., Figures 10E and 10F).

[0098] In one embodiment, the heavy chain / light chain combination containing the variable domain that binds to EGFR contains a DE mutant of the heavy chain. In this embodiment, the heavy chain / light chain combination containing the variable domain that can bind to cMET contains a KK mutant of the heavy chain. The KK mutant of the heavy chain that binds to cMET does not produce homodimers, thereby making the observed effect of inhibiting HGF-induced cMET activation by the bispecific antibody very accurate. It inhibits the activation of cMET (agonism) that can be observed with bivalent cMET antibodies.

[0099] The Fc region mediates antibody effector functions such as complement-dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC), and antibody-dependent cellular phagocytosis (ADCP). Depending on the therapeutic antibody or Fc fusion protein application, it may be desirable to reduce or increase effector function. Reduced effector function may be desirable when an immune response is to be activated, enhanced, or stimulated, as in some of the embodiments of the invention disclosed herein. Antibodies with reduced effector function can be used to target cell surface molecules of immune cells, among others.

[0100] Antibodies with reduced effector function are preferably IgG antibodies comprising a modified CH2 / lower hinge region, e.g., to reduce Fc receptor interaction or reduce C1q binding. In some embodiments, the antibodies of the present invention are IgG antibodies with mature CH2 and / or lower hinge domains such that the bispecific IgG antibody has reduced interaction with Fc gamma receptors. Antibodies comprising a mutated CH2 region are preferably IgG1 antibodies. Such mutated IgG1 CH2 and / or lower hinge domains preferably comprise amino acid substitutions at positions 235 and / or 236 (EU numbering), preferably L235G and / or G236R substitutions (Figure 10D).

[0101] The antibodies of the invention disclosed herein preferably have effector function. The bispecific antibodies of the invention disclosed herein preferably include antibody-dependent cellular cytotoxicity (ADCC). Antibodies can be engineered to enhance ADCC activity (for a review, see Cancer Sci. 2009 Sep;100(9):1566-72, Engineered therapeutic antibodies with improved effector functions. Kubota T, Niwa R, Satoh M, Akinaga S, Shitara K, Hanai N). Several in vitro methods exist for determining the effectiveness of antibodies or effector cells in inducing ADCC. These include the chromium-51 [Cr51] release assay, the europium [Eu] release assay, and the sulfur-35 [S35] release assay. Typically, a labeled target cell line expressing a particular surface-exposed antigen is incubated with an antibody specific for the antigen. After washing, effector cells expressing the Fc receptor CD16 are co-incubated with the antibody-labeled target cells. Target cell lysis is then measured by the release of intracellular label by scintillation counting or spectrophotometry. In one embodiment, the bispecific antibodies of the invention disclosed herein exhibit ADCC activity. In such embodiments, the bispecific antibodies may have improved ADCC activity. In another embodiment, the bispecific antibodies of the invention disclosed herein do not exhibit ADCC activity. In such embodiments, the antibodies may have reduced ADCC by means of one or more CH2 mutations described elsewhere herein and by techniques known in the art. One technique for enhancing the ADCC of antibodies is afucosylation (see, e.g., Junttila, TT, K. Parsons et al. (2010). "Superior In vivo Efficacy of Afucosylated Trastuzumab in the Treatment of HER2-Amplified Breast Cancer." Cancer Research 70(11): 4481-4489).Thus, further provided are bispecific antibodies according to the invention disclosed herein that are afucosylated. Alternatively, or in addition, several other strategies can be used to achieve ADCC enhancement, including, for example, glycoengineering (Kyowa Hakko / Biowa, GlycArt (Roche), and Eureka Therapeutics) and mutagenesis, all of which seek to improve Fc binding to the low-affinity activating FcγRIIIa and / or reduce binding to the low-affinity inhibitory FcγRIIb. The bispecific antibodies of the invention disclosed herein are preferably afucosylated to enhance ADCC activity. The bispecific antibodies of the invention disclosed herein comprise a reduced amount of fucosylation of N-linked carbohydrate structures in the Fc region compared to the same antibodies produced in normal CHO cells.

[0102] Variants of the antibodies or bispecific antibodies described herein include functional parts, derivatives and / or analogs of the antibodies or bispecific antibodies. The variants maintain the binding specificity of the (bispecific) antibody. The functional parts, derivatives and / or analogs maintain the binding specificity of the (bispecific) antibody. The binding specificity is defined by the ability to bind to the extracellular portions of the first membrane protein and the second membrane protein described herein.

[0103] The bispecific antibodies of the present invention are preferably used in humans. Preferred antibodies of the present invention are human or humanized antibodies. The constant regions of the bispecific antibodies of the present invention are preferably human constant regions. The constant regions may contain one or more, preferably not more than 10, and preferably not more than 5, amino acid differences from the constant regions of naturally occurring human antibodies. The constant portions are preferably derived entirely from naturally occurring human antibodies. The various antibodies produced herein are derived from a human antibody variable domain library. As such, these variable domains are human. The unique CDR regions may be human, synthetic, or derived from another organism. A variable region is considered a humanized variable region if it has an amino acid sequence identical to that of the variable region of a naturally occurring human antibody but not the CDR region. In such embodiments, the VH of the variable domain of the EGFR- or cMET-binding antibody of the present invention may contain one or more, preferably not more than 10, and preferably not more than 5, amino acid differences from the variable region of a naturally occurring human antibody, not counting possible differences in the amino acid sequence of the CDR region. The light chain variable region of the EGFR-binding domain and / or the cMET-binding domain in the antibodies of the invention disclosed herein may contain one or more, preferably not more than 10, preferably not more than 5 amino acid differences from the variable region of a naturally occurring human antibody, not counting possible differences in the amino acid sequence of the CDR regions. The light chain of the antibodies of the invention disclosed herein may contain one or more, preferably not more than 10, preferably not more than 5 amino acid differences from the variable region of a naturally occurring human antibody, not counting possible differences in the amino acid sequence of the CDR regions. Such mutations also occur naturally in the context of somatic (hyper)mutation.

[0104] Antibodies, at least with respect to the heavy chain variable region, can be derived from various animal species. Humanization of, for example, a murine heavy chain variable region is a common method. This can be achieved in various ways, including CDR-grafting onto a human heavy chain variable region having a 3-D structure that matches that of the murine heavy chain variable region; deimmunization of the murine heavy chain variable region, preferably by removing known or predicted T- or B-cell epitopes from the murine heavy chain variable region. Removal is typically achieved by substituting one or more amino acids of the epitope with other (typically conservative) amino acids, such that the sequence of the epitope is altered so that it is no longer a T- or B-cell epitope.

[0105] Deimmunized mouse heavy chain variable regions are less immunogenic in humans than the original mouse heavy chain variable region. Preferably, the variable regions or domains of the invention disclosed herein are further humanized, e.g., veneering. Using veneering techniques, external residues readily encountered by the immune system are selectively replaced with human residues to provide hybrid molecules containing either weakly immunogenic or substantially non-immunogenic veneering surfaces. Animals used in the invention disclosed herein are preferably mammals, more preferably primates, and most preferably humans.

[0106] The bispecific antibodies according to the invention disclosed herein preferably comprise a human antibody constant region. Depending on the differences in their heavy chain constant regions, antibodies are grouped into five classes or isotypes: IgG, IgA, IgM, IgD, and IgE. These classes or isotypes comprise at least one heavy chain designated by its corresponding Greek letter. A preferred embodiment includes antibodies in which the constant region is selected from the group consisting of IgG, IgA, IgM, IgD, and IgE constant regions; more preferably, the constant region comprises an IgG constant region, i.e., selected from the group consisting of IgG1, IgG2, IgG3, and IgG4. Preferably, the constant region is an IgG1 or IgG4 constant region, more preferably a mutated IgG1 constant region. Some mutations in the IgG1 constant region are possible without altering the immunological properties of naturally occurring and / or derived antibodies. Mutations can be artificially introduced to confer specific desirable properties to antibodies or portions thereof. Such properties are described herein, for example, in the context of CH2 and CH3. Typically, between about 1 and 10 amino acid insertions, deletions, substitutions, or a combination thereof, are possible in the constant region.

[0107] The VH chain of Figure 1, 7 or 8 preferably has up to 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid insertions, deletions, substitutions or a combination thereof with respect to the VH chain shown in Figure 1, 7 or 8, preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof with respect to the VH chain shown in Figure 1, 7 or 8, preferably 0, 1, 2, 3 or 4 insertions, deletions, substitutions or a combination thereof with respect to the VH chain shown in Figure 1, 7 or 8, preferably 0, 1, 2 or 3 insertions, deletions, substitutions or a combination thereof, more preferably 0, 1 or 2 insertions, deletions, substitutions or a combination thereof, and preferably 0 or 1 insertion, deletion, substitution or a combination thereof. The one or more amino acid insertions, deletions, substitutions or a combination thereof are preferably not in the CDR1, CDR2 and / or CDR3 regions of the VH chain. They are also preferably not present in the Fr4 region. The amino acid substitutions are preferably conservative amino acid substitutions.

[0108] Rational methods have evolved to minimize the content of non-human residues in the human context. Various methods are available for successfully grafting the antigen-binding properties of an antibody onto another antibody. The binding properties of an antibody reside primarily in the correct sequence of the CDR3 region, and are often supported by the sequences of the CDR1 and CDR2 regions of the variable domain, combined with the appropriate structure of the variable domain as a whole. The amino acid sequences of the CDR regions presented herein are determined by the Kabat definition. Various methods are currently available for grafting CDR regions onto a suitable variable domain of another antibody. Some of these methods are described in JC Almagro1 and J. Fransson (2008) Frontiers in Bioscience 13, pp. 1619-1633, which is incorporated herein by reference. The invention disclosed herein therefore further provides a human or humanized bispecific antibody comprising a first antigen-binding site that binds to EGFR and a second antigen-binding site that binds to cMET, wherein the variable domain comprises an EGFR-binding site comprising the VH CDR3 sequence shown in Figure 1 (MF3370), and wherein the variable domain comprises a cMET-binding site comprising the VH CDR3 region shown in Figure 1 (MF4356). The VH variable region comprising the EGFR-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 1 (MF3370). The VH variable region comprising the cMET-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 1 (MF4356). CDR-grafting can also be used to generate a VH chain having the CDR regions of the VH in Figure 1 but with a different framework. The different framework may be that of another human VH or from a different mammal. The invention disclosed herein therefore further provides a human or humanized bispecific antibody comprising a first antigen-binding site that binds EGFR and a second antigen-binding site that binds cMET, wherein the variable domain comprises an EGFR-binding site comprising the VH CDR3 sequence shown in Figure 7 as MF8233, and wherein the variable domain comprises a cMET-binding site comprising the VH CDR3 region shown in Figure 8 as MF8230.The VH variable region comprising the EGFR-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in MF8233 of Figure 7. The VH variable region comprising the cMET-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in MF8230 of Figure 8. CDR-grafting can also be used to produce a VH chain having the CDR regions of the VH of Figure 7 or Figure 8 but with a different framework. The different framework may be that of another human VH or that of a different mammal.

[0109] The invention disclosed herein therefore further provides a human or humanized bispecific antibody comprising a first antigen-binding site that binds to EGFR and a second antigen-binding site that binds to cMET, wherein the variable domain comprises an EGFR-binding site comprising the VH CDR3 sequence shown in Figure 1 (MF3370), and wherein the variable domain comprises a cMET-binding site comprising the VH CDR3 region shown in Figure 8 (MF8230). The VH variable region comprising the EGFR-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 1 (MF3370). The VH variable region comprising the cMET-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 8 (MF8230). CDR-grafting can also be used to generate a VH chain having the CDR regions of the VH of Figure 7 or Figure 8 but with a different framework. The different framework may be that of another human VH or a different mammal.

[0110] The invention disclosed herein therefore further provides a human or humanized bispecific antibody comprising a first antigen-binding site that binds to EGFR and a second antigen-binding site that binds to cMET, wherein the variable domain comprises an EGFR-binding site comprising the VH CDR3 sequence shown in Figure 7 (MF8233), and wherein the variable domain comprises a cMET-binding site comprising the VH CDR3 region shown in Figure 8 (MF4356). The VH variable region comprising the EGFR-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 7 (MF8233). The VH variable region comprising the cMET-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 8 (MF4356). CDR-grafting can also be used to generate a VH chain having the CDR regions of the VH of Figure 7 or Figure 8 but with a different framework. The different framework may be that of another human VH or a different mammal.

[0111] The invention disclosed herein therefore further provides a human or humanized bispecific antibody comprising a first antigen-binding site that binds to EGFR and a second antigen-binding site that binds to cMET, wherein the variable domain comprises an EGFR-binding site comprising the VH CDR3 sequence shown in MF8232 of Figure 7, and wherein the variable domain comprises a cMET-binding site comprising the VH CDR3 region shown in MF8230 of Figure 8. The VH variable region comprising the EGFR-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in MF8233 of Figure 7. The VH variable region comprising the cMET-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in MF8230 of Figure 8. CDR-grafting can also be used to generate a VH chain having the CDR regions of the VH of Figure 7 or Figure 8 but with a different framework. The different framework may be that of another human VH or a different mammal.

[0112] The invention disclosed herein therefore further provides a human or humanized bispecific antibody comprising a first antigen-binding site that binds to EGFR and a second antigen-binding site that binds to cMET, wherein the variable domain comprises an EGFR-binding site comprising the VH CDR3 sequence shown in Figure 7 (MF8232), and wherein the variable domain comprises a cMET-binding site comprising the VH CDR3 region shown in Figure 8 (MF4356). The VH variable region comprising the EGFR-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 7 (MF8232). The VH variable region comprising the cMET-binding site preferably comprises the sequences of the CDR1, CDR2, and CDR3 regions of the VH chain shown in Figure 8 (MF4356). CDR-grafting can also be used to generate a VH chain having the CDR regions of the VH of Figure 7 or Figure 8 but with a different framework. The different framework may be that of another human VH or a different mammal.

[0113] The present invention further provides a human or humanized bispecific antibody comprising a first variable domain that binds to EGFR and a second variable domain that binds to cMET, wherein the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF3370 shown in Figure 7 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof; and wherein the second variable domain comprises a heavy chain variable region having the amino acid sequence of MF4356 shown in Figure 8 (SEQ ID NO: 23) with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof. The present invention further provides a human or humanized bispecific antibody comprising a first variable domain that binds EGFR and a second variable domain that binds cMET, wherein the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF8233 as shown in Figure 7 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof; and wherein the second variable domain comprises a heavy chain variable region having the amino acid sequence of MF8230 as shown in Figure 8 (SEQ ID NO: 13) with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0114] The present invention further provides a human or humanized bispecific antibody comprising a first variable domain that binds to EGFR and a second variable domain that binds to cMET, wherein the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF3370 as shown in Figure 7 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof; and wherein the second variable domain comprises a heavy chain variable region comprising the amino acid sequence of MF8230 as shown in Figure 8 (SEQ ID NO: 13) with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0115] The present invention further provides a human or humanized bispecific antibody comprising a first variable domain that binds EGFR and a second variable domain that binds cMET, wherein the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF8233 as shown in Figure 7 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof; and wherein the second variable domain comprises a heavy chain variable region having the amino acid sequence of MF4356 as shown in Figure 8 (SEQ ID NO: 23) with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0116] The present invention further provides a human or humanized bispecific antibody comprising a first variable domain that binds EGFR and a second variable domain that binds cMET, wherein the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF8232 as shown in Figure 7 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof; and wherein the second variable domain comprises a heavy chain variable region having the amino acid sequence of MF4356 as shown in Figure 8 (SEQ ID NO: 23) with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0117] The present invention further provides a human or humanized bispecific antibody comprising a first variable domain that binds EGFR and a second variable domain that binds cMET, wherein the first variable domain comprises a heavy chain variable region having the amino acid sequence of MF8232 as shown in Figure 7 with up to 10, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid insertions, deletions, substitutions or a combination thereof; and wherein the second variable domain comprises a heavy chain variable region having the amino acid sequence of MF8230 as shown in Figure 8 (SEQ ID NO: 23) with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

[0118] The stated up to 15, preferably 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, and preferably 0, 1, 2, 3, 4 or 5 amino acid substitutions are preferably conservative amino acid substitutions, and the insertions, deletions, substitutions or combinations thereof are preferably not in the CDR3 region of the VH chain, preferably not in the CDR1, CDR2 or CDR3 regions of the VH chain, preferably not in the FR4 region.

[0119] Various methods for producing bispecific antibodies are available. One method involves expressing two different heavy chains and two different light chains in cells and recovering the antibodies produced by the cells. Antibodies produced in this manner typically contain a collection of antibodies with different combinations of heavy and light chains, some of which are the desired bispecific antibodies. The bispecific antibodies can then be purified from the collection. The ratio of bispecific antibodies to other antibodies produced by the cells can be increased in various ways. In a preferred embodiment, the ratio is increased by expressing a common light chain in the cells rather than two different light chains. When a common light chain is expressed with two different heavy chains, the ratio of bispecific antibodies to other antibodies produced by the cells is significantly improved compared to the expression of two different light chains. The ratio of bispecific antibodies produced by the cells can be further improved by stimulating the pairing of two different heavy chains with each other rather than the pairing of two identical heavy chains. Methods and means for producing bispecific antibodies (from a single cell) are disclosed, thereby providing a means for favoring the formation of bispecific antibodies over the formation of monospecific antibodies. These methods can also be advantageously used in the present invention. Accordingly, in one aspect, the invention disclosed herein provides a method for producing a bispecific antibody from a single cell, wherein the bispecific antibody comprises two CH3 domains capable of forming an interface, the method comprising producing in the cell: (a) a first nucleic acid molecule encoding a first CH3 domain comprising a heavy chain; and (b) a second nucleic acid molecule encoding a second CH3 domain comprising a heavy chain, the nucleic acid molecules being provided by means of selective pairing of the first and second CH3 domains comprising a heavy chain; the method allows for culturing the host cell and recovering the bispecific antibody from the expression and culture of the two nucleic acid molecules. The first and second nucleic acid molecules may be part of the same nucleic acid molecule, vector, or gene delivery vehicle, and may be integrated into the same site in the genome of the host cell. Alternatively, the first and second nucleic acid molecules are provided separately to the cell.

[0120] A preferred embodiment provides, according to the invention disclosed herein, a method for producing a bispecific antibody from a single cell, wherein said bispecific antibody comprises two CH3 domains capable of forming an interface, said method comprising: - a cell comprising: a) a first nucleic acid molecule encoding a heavy chain that binds to EGFR and comprises an antigen-binding site that contains a first CH3 domain; and b) a second nucleic acid molecule encoding a heavy chain that binds to ErbB-3 and comprises an antigen-binding site that contains a second CH3 domain. wherein the nucleic acid molecule is provided by means of selective pairing of the first and second CH3 domains; The method allows for the steps of culturing the cells, expressing proteins encoded by the two nucleic acid molecules, and recovering the bispecific IgG antibody from the culture. In a particularly preferred embodiment, the cells also contain a third nucleic acid molecule encoding a common light chain. The first, second, and third nucleic acid molecules may be part of the same nucleic acid molecule, vector, or gene delivery vehicle and may be integrated into the same site in the genome of the host cell. Alternatively, the first, second, and third nucleic acid molecules are provided to the cells separately. A preferred common light chain is the O12-based, preferably rearranged germline human kappa light chain IgVκ1 39*01 / IGJκ1*01, as described above. The means for selective pairing of the first and second CH3 domains is preferably a corresponding mutation in the CH3 domain of the heavy chain coding region. Preferred mutations that selectively produce bispecific antibodies are the amino acid substitutions L351K and T366K (EU numbering) in the first CH3 domain and the amino acid substitutions L351D and L368E in the second CH3 domain, or vice versa. Thus, there is further provided a method according to the invention disclosed herein for producing a bispecific antibody, wherein said first CH3 domain comprises the amino acid substitutions L351K and T366K (EU numbering) and said second CH3 domain comprises the amino acid substitutions L351D and L368E, said method allowing for the steps of culturing said cells and expressing proteins encoded by said nucleic acid molecules and recovering said bispecific antibody from the culture. Also provided are methods according to the invention disclosed herein for producing a bispecific antibody, wherein the first CH3 domain comprises the amino acid substitutions L351D and L368E (EU numbering) and the second CH3 domain comprises the amino acid substitutions L351K and T366K, the method further comprising culturing the cells and recovering the bispecific antibody from expression and culture of the nucleic acid molecule. Antibodies producible by these methods are also part of the present invention. The CH3 heterodimerization domain is preferably an IgG1 heterodimerization domain. The heavy chain constant region comprising the CH3 heterodimerization domain is preferably an IgG1 constant region.

[0121] One embodiment of the present invention comprises a nucleic acid molecule encoding an antibody heavy chain variable region. The nucleic acid molecule (typically an in vitro, isolated, or recombinant nucleic acid molecule) preferably encodes a heavy chain variable region as shown in Figure 7 or Figure 8, or a heavy chain variable region as shown in Figure 7 or Figure 8 with one, two, three, four, or five amino acid insertions, deletions, substitutions, or a combination thereof. In a preferred embodiment, the nucleic acid molecule comprises a codon-optimized nucleic acid sequence encoding the amino acid sequence shown in Figure 7 or Figure 8. The codon optimization is optimized for the species and / or cell type of the antibody-producing cell. For example, for CHO production, the nucleic acid sequence of the molecule is codon-optimized for Chinese hamster cells. The present invention further provides a nucleic acid molecule encoding the heavy chain of Figure 7 or Figure 8.

[0122] Nucleic acid molecules used in the inventions disclosed herein are typically, but not exclusively, ribonucleic acid (RNA) or deoxyribonucleic acid (DNA). Alternative nucleic acids are available to those of skill in the art. A nucleic acid according to the inventions disclosed herein is, for example, contained in a cell. When the nucleic acid is expressed in the cell, the cell can produce an antibody according to the inventions disclosed herein. Thus, one embodiment of the present invention includes a cell comprising an antibody according to the inventions disclosed herein and / or a nucleic acid according to the inventions disclosed herein. The cell is preferably an animal cell, more preferably a mammalian cell, more preferably a primate cell, and most preferably a human cell. Suitable cells are any cells that contain and preferably are capable of producing an antibody according to the inventions disclosed herein and / or a nucleic acid according to the inventions disclosed herein.

[0123] The invention disclosed herein further provides a cell comprising an antibody according to the invention disclosed herein. Preferably, the cell (typically an in vitro, isolated, or recombinant cell) produces the antibody. The cell may be a preserved cell that, when removed from storage and cultured, is capable of producing the antibody. In a preferred embodiment, the cell is a hybridoma cell, a Chinese hamster ovary (CHO) cell, an NSO cell, or a PER-C6™ cell. In a particularly preferred embodiment, the cell is a CHO cell. Also provided is a cell culture comprising a cell according to the invention disclosed herein. Various laboratories and companies have developed cell lines for large-scale production of antibodies, e.g., for clinical use. Non-limiting examples of such cell lines are CHO cells, NSO cells, or PER-C6™ cells. These cells are also used for other purposes, such as protein production. Cell lines developed for industrial-scale production of proteins and antibodies are further referred to herein as industrial cell lines. Thus, preferred embodiments include the use of cell lines developed for large-scale production of antibodies for the production of the antibodies of the invention disclosed herein, preferably comprising cells for producing antibodies comprising nucleic acid molecules encoding the VH, VL and / or heavy chains shown in Figure 7 or Figure 8.

[0124] The present invention further provides a method for producing an antibody, comprising culturing a cell of the invention disclosed herein and recovering the antibody from the culture. Preferably, the cells are cultured in a serum-free medium. Preferably, the cells are adapted to suspension growth. Also provided is an antibody obtainable by the method for producing an antibody according to the invention disclosed herein. The antibody is preferably purified from the culture medium. Preferably, the antibody is affinity purified.

[0125] The cells of the invention disclosed herein may be, for example, hybridoma cell lines, CHO cells, 293F cells, NS0 cells, or another cell type known for its suitability for antibody production for clinical purposes. In certain preferred embodiments, the cells are human cells. Preferably, the cells are transformed with an adenovirus E1 region or a functional equivalent thereof. A preferred example of such a cell line is the PER.C6™ cell line or its equivalent. In certain preferred embodiments, the cells are CHO cells or variants thereof. Preferably, the variants use a glutamine synthetase (GS) vector system for antibody expression.

[0126] The antibodies of the invention disclosed herein can be produced at levels >50 mg / L after transient transfection in suspension 293F cells. The bispecific antibodies can be purified to greater than 98% purity with yields >70%. Analytical characterization studies show a bispecific IgG1 antibody profile that is comparable to a bivalent monospecific IgG1. With regard to functional activity, the bispecific antibodies of the invention disclosed herein can demonstrate superior potency compared to cetuximab in vitro and in vivo.

[0127] The present invention further provides a pharmaceutical composition comprising an antibody according to the invention disclosed herein, which preferably comprises a pharmaceutically acceptable excipient or carrier.

[0128] The antibody can include a label, preferably a label for in vivo imaging. Such labels are typically not necessarily for therapeutic use. For example, in a diagnostic setting, the label can be useful, for example, in visualizing target cells in the body. A variety of labels are suitable, many of which are well known in the art. In a preferred embodiment, the label is a radiolabel for detection. In another preferred embodiment, the label is an infrared label. Preferably, the infrared label is suitable for in vivo imaging. A variety of infrared labels are available to those skilled in the art. Preferred infrared labels are, for example, IRDye 800; IRDye 680RD; IRDye 680LT; IRDye 750; IRDye 700DX; IRDye 800RS IRDye 650; IRDye 700 phosphoramidite; IRDye 800 phosphoramidite (LI-COR USA; 4647 Superior Street; Lincoln, Nebraska).

[0129] The present invention further provides a method for treating a subject having or at risk of having a tumor, comprising the step of administering to a subject in need thereof an antibody or pharmaceutical composition according to the invention disclosed herein. The tumor is preferably an EGFR-, cMET-, or EGFR / cMET-positive tumor. Prior to initiating the treatment, the method preferably further comprises the step of determining whether the subject has such an EGFR-, cMET-, or EGFR / cMET-positive tumor. The present invention further provides an antibody or pharmaceutical composition of the invention disclosed herein for use in treating a subject having or at risk of having an EGFR-, cMET-, or EGFR / cMET-positive tumor.

[0130] To establish whether a tumor is EGFR-positive, one skilled in the art can determine, for example, EGFR amplification and / or immunohistochemical staining. At least 10% of the tumor cells in the biopsy should be positive. The biopsy may also contain 20%, 30%, 40%, 50%, 60%, 70% or more positive cells. To establish whether a tumor is cMET-positive, one skilled in the art can determine, for example, cMET amplification and / or immunohistochemical staining. At least 10% of the tumor cells in the biopsy should be positive. The biopsy may also contain 20%, 30%, 40%, 50%, 60%, 70% or more positive cells.

[0131] The invention disclosed herein may be applicable to a wide range of cancers, such as breast cancer, colon cancer, pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer, head and neck cancer, lung cancer including non-small cell lung cancer, bladder cancer, etc. The tumor may be an EGFR-, cMET-, or EGFR / cMET-positive cancer. An embodiment of the invention may treat a positive cancer, preferably breast cancer, for example, early stage breast cancer. Another embodiment of the invention may treat an EGFR-, cMET-, or EGFR / cMET-positive cancer, preferably colorectal cancer. The invention disclosed herein may be applicable to a wide range of EGFR-, cMET-, or EGFR / cMET-positive cancers, such as breast cancer, colon cancer, pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer, head and neck cancer, lung cancer including non-small cell lung cancer, bladder cancer, etc. The subject is preferably a human subject. The subject is preferably eligible for antibody therapy using an EGFR-specific antibody such as cetuximab. In a preferred embodiment, the present invention may treat a subject preferably comprising a tumor, preferably an EGFR / cMET positive cancer, preferably a tumor / cancer with an EGFR RTK resistance phenotype, an EGFR monoclonal antibody resistance phenotype, or a combination thereof.

[0132] The amount of antibody administered to a patient is typically within the therapeutic window, meaning that an amount sufficient to achieve a therapeutic effect is used, but not exceeding the threshold that causes unacceptable side effects. The therapeutic window typically increases as the amount of antibody required to achieve the desired therapeutic effect decreases. The antibodies of the invention disclosed herein exert sufficient therapeutic effects at low doses and are therefore preferred. The dose may be within the range of the dosing regimen for cetuximab. The dose may also be lower.

[0133] The bispecific antibodies of the invention disclosed herein preferably have reduced skin toxicity compared to cetuximab under otherwise similar conditions. The bispecific antibodies of the invention disclosed herein preferably cause less inflammatory cytokine production, preferably CXCL14, compared to cetuximab under otherwise similar conditions. The bispecific antibodies of the invention disclosed herein preferably cause less antimicrobial RNAse, preferably RNAse 7, interference compared to cetuximab under otherwise similar conditions.

[0134] The present invention describes antibodies that target, among others, EGFR and cMET receptors, resulting in strong growth inhibition of cancer cell lines in vitro and tumor growth inhibition in vivo. The bispecific antibodies of the invention disclosed herein may combine high efficacy with a low toxicity profile. The antibodies of the invention disclosed herein may be useful in various types and systems of EGFR-targeted therapy. The antibodies of the invention disclosed herein may have an increased therapeutic window compared to antibodies that bind to the same antigen with both arms. The bispecific antibodies of the invention disclosed herein may exhibit better growth inhibitory effects in vitro, in vivo, or a combination thereof compared to cetuximab antibodies.

[0135] The present invention also provides a bispecific antibody of the present invention for use in treating a subject who may have one or more of a variety of different tumor types. The tumor may be an EGFR-positive tumor, a cMET-positive tumor, or an EGFR- and cMET-positive tumor. The tumor may be breast cancer, colon cancer, pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer, head and neck cancer, lung cancer, including non-small cell lung cancer, or bladder cancer. The tumor may be resistant to treatment with an EGFR tyrosine kinase inhibitor. The EGFR tyrosine kinase inhibitor is preferably erlotinib, gefitinib, or afatinib, an analog of erlotinib, gefitinib, or afatinib, or a combination of one or more of the respective compounds and / or analogs thereof. The treatment preferably further includes treatment with an EGFR tyrosine kinase inhibitor. When treated in combination with an EGFR tyrosine kinase inhibitor, the tumor may be resistant to treatment with an EGFR tyrosine kinase inhibitor. The combined treatment at least partially restores the tumor's sensitivity to the tyrosine kinase inhibitor. The EGFR tyrosine kinase inhibitor can be a first-generation EGFR tyrosine kinase inhibitor. Examples of clinically relevant first-generation EGFR tyrosine kinase inhibitors are erlotinib and gefitinib. In this and other embodiments, the tumor can be an HGF-associated tumor.

[0136] EGFR-positive tumors typically harbor EGFR-activating mutations. EGFR-activating mutations are mutations in EGFR that result in activation of the EGF / EGFR signaling pathway. EGFR-activating mutations may be important in the cancerous state of tumors. One way in which such tumors can become insensitive to EGFR-targeted therapy is through activation of the HGF / cMET signaling pathway. The tumor may be an HGF-associated tumor. Activation of the cMET / HGF signaling pathway is one way in which EGFR-positive tumors can evade treatment with EGFR-targeted therapy. The cMET / HGF pathway can be activated in various ways. Various methods of activation have been described in the art, some of which are described in detail herein. The antibodies of the present invention are particularly suitable for treating tumors in which activation of the cMET / HGF signaling pathway is associated with the presence or excess of HGF. Such cMET-positive tumors are referred to as HGF-associated or HGF-dependent tumors. The antibodies of the present invention can also be used to at least partially inhibit this possible evasion mechanism of EGFR-positive tumors. Such tumors may also evade EGFR-targeted therapy due to the selective outgrowth of tumor cells in which the cMET / HGF signaling pathway is activated. Such cells may be present at the onset of EGFR-targeted therapy. Such cells have a selective growth advantage over HGF / cMET signaling-negative tumor cells. The tumor may be a tumor in which the HGF / cMET signaling pathway is activated. The tumor may be a tumor associated with elevated levels of hepatocyte growth factor (HGF) or overexpression of the HGF receptor cMET. The tumor may be a tumor whose growth is driven by EGF and / or HGF. A tumor is said to be growth-driven by a particular growth factor if the signaling pathway is activated in tumor cells in response to the presence of the growth factor and removal of the growth factor results in inhibition of tumor cell growth. The reduction can be measured by a decrease in cell division and / or induction of cell death, such as apoptosis. A tumor is an HGF-associated tumor if tumor growth or growth acceleration occurs in the presence of HGF under conditions that otherwise permit tumor growth.

[0137] EGFR-targeted therapy for various tumors is described in Vecchione et al., "EGFR-targeted therapy," Experimental cell research Vol. 317 (2011): pp. 2765-2771. A typical EGFR-targeted therapy is a treatment with a molecule that interacts with EGFR and inhibits EGFR-mediated signaling in cells.

[0138] The methods of treatment or antibodies for use in the treatment provided herein preferably further comprise the step of determining whether the tumor is an HGF-associated tumor.

[0139] The antibodies of the invention disclosed herein can inhibit the growth of HGF-associated tumors.

[0140] In some embodiments where the cMET-binding variable domain is described as having the CDR2 sequence "WINTYTGDPTYAQGFTG," the CDR2 sequence may be "WINTYTGDPTYAQGFT."

[0141] When a range is given herein between the number 1 and the number 2, the range includes the numbers 1 and 2. For example, a range between 2 and 5 includes the numbers 2 and 5.

[0142] When referring herein to an affinity that is higher than another, Kd = lower than the other Kd. For the avoidance of doubt, a Kd of 10e-9M is lower than a Kd of 10e-8M. An antibody with a Kd of 10e-9M for a target has higher affinity than one with a Kd of 10e-8M.

[0143] The mention of a patent document or other matter cited herein should not be taken as an admission that the document or matter was publicly known or that the information it contains was part of the common general knowledge at the priority date of any claim.

[0144] Although, for clarity and conciseness of description, features may be described herein as part of the same or separate embodiments, it will be recognized that the scope of the inventions disclosed herein may include embodiments having combinations of all or any of the described features. [Brief explanation of the drawings]

[0145] [Figure 1] FIG. 1 shows the amino acid sequences of the heavy chain variable regions of the variable domains referred to in this application. [Figure 2] Figure 2 shows the functionality of anti-EGFR cLC bivalent antibodies in inhibiting EGF-induced death of A431 cells. The Y-axis (number) represents the fluorescence detection of the assay, which represents the number of metabolically active cells, as a function of the antibody concentration used (X-axis). PG3370 was able to inhibit EGF-induced cell death, thus demonstrating that increasing antibody concentration enhanced cell proliferation. A molecule with the variable region amino acid sequence of cetuximab / erbitux, referred to herein as cetuximab or reference antibody cetuximab, was used as an internal standard in the experiments (black dots). [Figure 3] Figure 3 shows the effect of cMETxEGFR bispecifics on wound healing in H385 cells (panel A) and EBC-1 cells (panel B). Cells were incubated either without (mock) or with the addition of five individual cMETxEGFR bispecifics, EGF 12.5 ng / ml, HGF 15 ng / ml, or a combination of HGF and EGF (15 ng / ml and 12.5 ng / ml). Cetuximab in combination with 2994Fab was included as a control. The Y-axis indicates the percentage of wound closure as measured by microscopy over time. [Figure 4]Figure 4 shows FACS analysis of EGFR and cMET expression in TKI-resistant NSCLC cells, HCC827 cells, and PC-9 cells. (A) Both cell lines were characterized for EGFR (x-axis) and cMET (y-axis) expression using fluorescently labeled antibodies. All HCC827 cells showed EGFR expression and could be divided into EGFRhigh, cMETpos and EGFRpos, cMETneg populations. PC-9 cells contained a small population of EGFRhigh and cMETpos cells and a minimal population of EGFRpos and cMETneg cells. (B) The graph depicts the distribution of different cell populations in PC-9 and HCC827 cells. [Figure 5] Figure 5 shows examples of the effects of PB8532 and PB8388 on HGF-induced resistance to TKI inhibitors in PC-9 cells (Panel A) and HCC827 cells (Panel B). Cells were pretreated with bispecific PB8532, PB8388, or a cetuximab / 5D5 Fab mixture, incubated with HGF and / or EGF in combination with the TKI inhibitors, and then proliferation was measured. PB8532 inhibits HGF- and EGF-mediated gefitinib resistance in PC-9 and HCC827 cells. [Figure 6] Figure 6 shows the effect of treatment with the indicated antibodies on HGF-induced cMET phosphorylation or EGF-induced EGFR phosphorylation in PC-9 and HCC827 cells. After cell extracts were generated, antibodies (100 nM) were incubated at 37°C for 15 minutes and subjected to Western blot analysis for the detection of (p)EGFR and (p)cMET. Anti-vinculin antibody was included as a protein loading control. [Figure 7] Figure 7 shows MF3370 and its variants. The CDR1, CDR2, and CDR3 sequences of MF8226 are underlined from left to right. The CDRs of the other sequences are in the corresponding positions. [Figure 8-1] Figure 8 shows MF4356 and its variants. The CDR1, CDR2, and CDR3 sequences of MF4356 are underlined from left to right. The CDRs of the other sequences are in the corresponding positions. [Figure 8-2] This is a continuation of Figure 8-1. [Figure 9ABC] Figure 9 shows the common light chain used in monospecific and bispecific IgGs. Figure 9A shows the common light chain amino acid sequence. Figure 9B shows the common light chain variable domain DNA sequence and translation (IGKV1-39 / jk1). Figure 9C shows the common light chain constant region DNA sequence and translation. [Figure 9DE] Figure 9 shows the common light chain used in monospecific and bispecific IgGs. Figure 9D shows the IGKV1-39 / jk5 common light chain variable domain translation. Figure 9E shows the V region IGKV1-39A. [Figure 10ABC] Figure 10 shows an IgG heavy chain for the generation of bispecific molecules. Figure 10A shows the CH1 region. Figure 10B shows the hinge region. Figure 10C shows the CH2 region. [Figure 10DEF] Figure 10 shows an IgG heavy chain for the generation of bispecific molecules. Figure 10D shows a CH2 containing L235G and G236R silencing substitutions. Figure 10E shows a CH3 domain containing L351K and T366K (KK) substitutions. Figure 10F shows a CH3 domain containing L351D and L368E (DE) substitutions. [Figure 11] Figure 11 shows the inhibition of EGF binding to recombinant EGFR in an ELISA. Biotinylated EGF is bound to coated EGFR in the presence of serially diluted IgG. Cetuximab was used as a positive control, and PG2708 was used as a negative control antibody (Neg ctrl Ab). EGF binding was detected by streptavidin-HRP. [Figure 12]Figure 12 shows the determination of cynomolgus EGFR cross-reactivity by FACS analysis. CHO-K1 cells were transfected with human EGFR or cynomolgus EGFR constructs. Antibodies were bound to the transfected cells and CHO-K1 cells at 5 μg / ml. Cetuximab was used as a positive control, and PG2708 was used as a negative control antibody (Neg ctrl Ab). Bound antibodies were detected with PE-conjugated antibodies. [Figure 13] Figure 13 shows the determination of mouse EGFR and cMET cross-reactivity by ELISA. Top panel: Fixed concentrations of antibody (5 μg / ml) were tested in a serial titration on microtiter plates coated with mouse EGFR and human EGFR. Anti-EGFR antibody and PG2708 (neg Ctrl Ab) were bound and detected with an HRP-conjugated antibody. Bottom panel: A serial titration of antibody was allowed to bind to coated human and mouse cMET. The human / mouse cross-reactive antibody BAF527 was included as a positive control antibody, and PG2708 was added as a negative control (Neg Ctrl Ab). Bound antibody was detected with streptavidin-HRP. [Figure 14A] Figure 14 shows ligand-dependent inhibition of N87 proliferation. Stepwise antibody titrations were incubated with N87 cells in the presence of HGF (A). Cell proliferation was measured by Alamar Blue. Equimolar concentrations of Fab 5D5 / cetuximab were included as a positive control antibody. The Y-axis represents fluorescence intensity as an index of cell proliferation. The X-axis represents different concentrations of the antibody tested. [Figure 14B] Figure 14 shows ligand-dependent inhibition of N87 proliferation. Stepwise antibody titrations were incubated with N87 cells in the presence of EGF (B). Cell proliferation was measured by Alamar Blue. Equimolar concentrations of Fab 5D5 / cetuximab were included as a positive control antibody. The Y-axis represents fluorescence intensity as an indicator of cell proliferation. The X-axis represents different concentrations of the antibody tested. [Figure 14C]Figure 14 shows ligand-dependent inhibition of N87 proliferation. Stepwise antibody titrations were incubated with N87 cells in the presence of EGF / HGF(C). Cell proliferation was measured by Alamar Blue. Equimolar concentrations of Fab 5D5 / cetuximab were included as a positive control antibody. The Y-axis represents fluorescence intensity as an index of cell proliferation. The X-axis represents different concentrations of the antibody tested. [Figure 15A] Figure 1 shows an example of ADCC activity of cMETxEGFR bispecific antibodies in N87 cells (A) using a high affinity FcγRIIIa ADCC reporter assay. The X-axis represents the antibody concentration added. The Y-axis represents luminescence (RLU) as a detection of ADCC activity. The anti-EGFR antibody cetuximab was included as a positive control antibody. [Figure 15B] Figure 1 shows an example of ADCC activity of cMETxEGFR bispecific antibodies in MKN-45 cells (B) using a high affinity FcγRIIIa ADCC reporter assay. (X-axis represents added antibody concentration.) (Y-axis represents luminescence (RLU) as detection of ADCC activity.) The anti-EGFR antibody cetuximab was included as a positive control antibody. [Figure 16A] Figure 1 shows the effect of HGF on the efficacy of the TKIs erlotinib and gefitinib in PC-9 cells (A). Cells were incubated with increasing concentrations of HGF (0-120 ng / mL) in combination with 300 nM erlotinib or gefitinib, and cell proliferation was then measured. In both cell lines, HGF induced dose-dependent resistance to the TKIs. [Figure 16B] (B) Effect of HGF on the efficacy of the TKIs erlotinib and gefitinib in HCC827 cells. Cells were incubated with increasing concentrations of HGF (0-120 ng / mL) in combination with 300 nM erlotinib or gefitinib, and cell proliferation was then measured. In both cell lines, HGF induced dose-dependent resistance to the TKIs. [Figure 17]Figure 1 shows affinity binding assays of ADCC-enhanced cMET×EGFR mutants. CHO-K1 cells stably expressing EGFR (A) or MKN-45 cells endogenously expressing c-MET (B) were incubated with increasing concentrations of antibody as indicated at 2 × 10 cells / well. After washing, binding was detected with anti-human IgG-PE (3 μg / ml). Stained cells were analyzed using the iQue system, and mean fluorescence intensity (MFI) was calculated. Control antibodies were MF1337×MF1337 (TT×TT negative control; lower dark triangles) and MF4356×MF3770 (PB8532p04; c-MET×EGFR positive control for c-MET; closed triangles). TT stands for tetanus toxoid. ADCC indicates antibodies with enhanced ADCC function due to cotransfection with DNA encoding an RMD enzyme that removes fucose residues from the Fc region of IgG1. [Figure 18] This figure shows the results of an ADCC reporter assay confirming enhanced ADCC effector function. EGFR-expressing B×PC-3 cells (left) or c-MET-expressing MKN-45 cells (right) were mixed with ADCC effector cells at an E:T ratio of 15:1 and incubated in the presence of a titration of test antibody (0.01–10 μg / ml). After 6 hours, Bio-Glo reagent was added, and luminescence was measured using a microplate reader. The stronger the level of luminescence, the greater the degree of interaction between the target and effector cells induced by the test antibody. The top panel shows the results of a high-affinity assay, and the bottom panel shows those of a low-affinity assay. The negative control antibody was PG1337p218 (anti-TT, lower light triangle); other control antibodies were 3178x4280 (HER3xEGFR, ADCC-enhanced, light closed circle (top left panel); 3178x4280 (HER3xEGFR, non-ADCC-enhanced, black cross, bottom); 4356x3370 (c-METxEGFR, ADCC-enhanced, open light circle); 3370x4356 (EGFRxcMET, non-ADCC-enhanced, black cross and dotted line); and cetuximab (anti-EGFR, small black circle). [Figure 19]Figure 19 shows that erlotinib induces anti-tumor responses in NGS-hHGFki mice implanted with HCC827 cells as long as the mice receive treatment. The black arrow indicates the start of treatment. [Figure 20] Figure 20 shows that PB8532 alone and in combination with erlotinib induces anti-tumor responses in NGS-hHGFki mice implanted with HCC827 cells. Black arrows indicate the start of treatment; gray arrows on the X-axis indicate weekly antibody treatments. [Figure 21] Figure 21 shows that the anti-tumor responses induced by PB8532 alone and in combination with erlotinib are superior to those of erlotinib, even after treatment has stopped. Black arrows indicate the start of treatment; gray arrows on the X-axis indicate weekly antibody treatments. [Figure 22] Figure 22 shows that the anti-tumor responses induced by PB8532 alone and in combination with erlotinib are superior to those induced by erlotinib. Black arrows indicate the start of treatment; gray arrows on the X-axis indicate weekly antibody treatment. Treatment with the cMET antibody LY2875358, with or without erlotinib treatment, was not more effective than PB8532, even without erlotinib treatment. [Figure 23] Figure 23 shows that the anti-tumor response induced by the cMETxEGFR bispecific antibody PB19478 is effective even when tumors develop resistance to erlotinib. Black arrows indicate the start of erlotinib treatment and the start of PB19478 treatment. DETAILED DESCRIPTION OF THE INVENTION

[0146] As used herein, "MFXXXX," where X is independently a number from 0 to 9, refers to a Fab in which the VH comprises a variable domain having the amino acid sequence identified by the four Arabic numerals. Unless otherwise specified, the light chain variable region of the variable domain typically has the sequence of Figure 9A, typically Figure 9B. "MFXXXX VH" refers to the amino acid sequence of the VH identified by the four Arabic numerals. MF further comprises a light chain constant region and a heavy chain constant region that typically interacts with the light chain constant region. PG refers to a monospecific antibody comprising identical heavy and light chains. PB refers to a bispecific antibody having two different heavy chains. The heavy chain VH variable regions are different, typically in the CH3 regions, with one heavy chain having a KK mutation in its CH3 domain and the other having a complementary DE mutation in its CH3 domain (see International Application PCT / NL2013 / 050294 (published as WO 2013 / 157954) for a review).

[0147] Example 1 Materials and Methods Cell line: EBC-1 [JCRB0820], PC-9 [RCB0446], H358 [ATCC® CRL-5807™], HCC827 [ATCC® CRL-2868™], MKN-45 [DSMZ ACC 409], N87 [ATCC® CRL-5822™], and A431 [ATCC® CRL-1555™] cell lines were purchased and routinely maintained in growth medium supplemented with 10% heat-inactivated fetal bovine serum (FBS). HEK293F FreeStyle cells were obtained from Invitrogen and routinely maintained in 293 FreeStyle medium.

[0148] cDNA construct: Generation of cMET and EGFR expression vectors for generation of stable expressing cell lines (cMET and EGFR) and for immunization (cMET) Full-length cDNAs of each target containing unique restriction sites for cloning and Kozak consensus sequences for efficient translation were synthesized or obtained by PCR amplification of commercially available expression constructs containing the target cDNAs with specific primers that introduced unique restriction sites for cloning and Kozak consensus sequences for efficient translation. Full-length cDNAs of each target were cloned into eukaryotic expression constructs such as pcDNA3.1, while the extracellular domains were cloned into pVAX1 and pDisplay. Insert sequences were confirmed by comparison with the NCBI reference amino acid sequence.

[0149] Amino acid sequence of full-length human EGFR insert for cell surface expression (identical to GenBank: NP_00533): the: - MRPSGTAGAALLALLAALCPASR: signal peptide. - : ECD of human EGFR. - IATGMVGALLLLLVVALGIGLFM: predicted TM region. - :Intracellular tail.

[0150] Amino acid sequence of the extracellular domain of the naturally occurring human EGFR varIII variant VAR_066493 [Ji H., Zhao X; PNAS 103:7817-7822 (2006)], which is caused by an in-frame deletion of exons 2 to 7. The following _ indicates the position where amino acids 30-297 are deleted. MRPSGTAGAALLALLAALCPASRALEEKK_GNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKE ISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS the: - MRPSGTAGAALLALLAALCPASR: signal peptide. - always INWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS:EGFRvarIII ECD

[0151] Amino acid sequence of a chimeric macaque (rhesus) extracellular EGFR domain hybrid with human EGFR transmembrane and intracellular domains for cell surface expression (identical to GenBank: XP_014988922.1). The human EGFR sequence is underlined in the example below.

[0152] [ka]

[0153] the: - MGPSGTAGAALLALLAALCPASR: signal peptide. - :ECD of cyEGFR

[0154] Amino acid sequence of the full-length human cMET insert for cell surface expression (identical to GenBank: P08581-2). The sequence differs from the reference sequence by the 755:S→STWWKEPLNIVSFLFCFAS insertion at position 755. the: - MKAPAVLAPGILVLLFTLVQRSNG: signal peptide -: ECD of human cMET - GLIAGVVSISTALLLLLGFFLWL: Transmembrane region - KKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQA VQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHN PTVKDLIGFGLQVAKGMKYASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPD VNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS: Intracellular region

[0155] Reference antibody Anti-cMET antibodies are known in the art (Table 1). Monospecific, bivalent cMET antibodies were constructed according to published information and expressed in 293F Freestyle cells. Table 1 shows the relevant disclosed information. Monospecific, bivalent antibodies against cMET were constructed according to published information and expressed in 293F Freestyle cells. For HGF ligand blocking assays, the VH- and VL-encoding gene segments of the patent-derived anti-cMET antibody were recloned into a phage display vector for display on filamentous bacteriophage.

[0156] The reference antibody cetuximab (Erbitux) was used as the reference antibody for the EGFR Fab panel.

[0157] The 2994 Fab protein was generated from purified PG2994 IgG by papain digestion. PG2994 was then incubated with bead-bound papain (Pierce #44985) and digested for 5.5 hours at 37°C with rotation. The Fab fragment was purified from the digestion mixture by filtration on a MabSelectSure LX. The flow-through fraction containing the Fab protein was concentrated to 3 ml using a Vivaspin 20 10 kDa column and further purified by gel filtration using a Superdex 75 16 / 600 column in PBS.

[0158] Example 2 Generation of bivalent monoclonal antibodies and antibody characterization The VH genes of unique antibodies, as determined by VH gene sequence and several variants of these sequences, were cloned into an IgG1 backbone vector. Suspension-adapted 293F Freestyle cells were cultured at 3.0 × 10 6 Cells were cultured in T125 flasks on a constant shaker to a density of 0.3–0.5 × 10 cells / ml in each well of a 24-deep-well plate. 6 Cells were seeded at a density of 1000 viable cells / ml. Cells were transiently transfected with the respective sterile DNA:PEI mixtures and further cultured. Seven days after transfection, supernatants were harvested, filtered through 0.22 μM (Sartorius), purified with Protein A beads using batch purification, and buffer-exchanged into PBS.

[0159] Inhibition of EGF-mediated apoptosis High concentrations (10 nM) of EGF induce (apoptotic) cell death in A431 cells (Gulli et al., 1996), an effect that can be reverted in a dose-dependent manner by the addition of ligand-blocking anti-EGFR antibodies such as cetuximab.

[0160] To test the ability of bivalent anti-EGFR IgG to inhibit EGF-induced cell death of A431 cells, the antibodies were incubated in serial titrations starting from 10 μg / ml in the presence of 10 nM EGF. Each assay plate contained serial dilutions of a negative (Ctrl Ab; PG2708) and a positive control antibody (cetuximab) as reference controls. On day 3, Alamar Blue (Invitrogen, #DAL1100) was added (20 μl per well), and fluorescence was measured using 560 nm excitation and 590 nm detection in a Biotek Synergy 2 Multi-mode microplate reader after 6 hours of incubation with Alamar Blue (37°C). Figure 2 shows the activity of the cLC EGFR antibodies compared to that of cetuximab and control antibodies. Antibodies PG4280, 3755, and 3752 were more potent than cetuximab, while antibodies PG4281 and PG3370 showed reduced efficacy.

[0161] EGF blockade ELISA EGFR-specific phages were tested for binding to recombinant EGFR in the absence and presence of a molar excess of ligand (EGF). Therefore, 5 μg / ml goat anti-human IgG was coated onto MAXISORP™ ELISA plates overnight at 4°C. The wells of the ELISA plates were blocked with 2% ELK in PBS (pH 7.2) for 1 hour at room temperature with shaking (700 rpm). Next, 5 μg / ml recombinant human EGFR-Fc was incubated for 1 hour at room temperature. Meanwhile, the IgG was mixed with human biotinylated EGF in serial titrations for 1 hour at room temperature. After washing away unbound human EGFR-Fc, the antibody / EGF mixture was added and allowed to bind for 1 hour at room temperature. Bound EGF was detected with HRP-streptavidin for 1 hour at room temperature. As controls, the procedure was performed simultaneously with antibodies specific for the coated antigen (not shown) and a negative control phage (Neg Ctrl Ab). Bound secondary antibodies were visualized by TMB / H2O2 staining, and staining was observed at OD 450nmFigure 11 shows that the PG3370 antibody, which is less potent at inhibiting EGF-mediated apoptosis, exhibits similar EGF blocking activity compared to cetuximab.

[0162] Cross-reactivity test between cynomolgus monkey EGFR and mouse EGFR To test whether anti-EGFR IgGs are reactive with cynomolgus monkey EGFR, both a construct encoding full-length human EGFR and an expression construct encoding the cynomolgus monkey ECD fused to intracellular human EGFR were transfected into (antigen-negative) CHO cells. The cells were then stained with anti-EGFR antibodies at 5 μg / ml and finally analyzed by FACS. As a positive staining control, the clinically used antibody cetuximab was used, as it is known to cross-react with cynomolgus monkey EGFR. PG3370, PG3752, PG4280, and PG4281 were shown to be reactive with cynomolgus monkey EGFR, as staining of cells expressing human EGFR was visually indistinguishable from that of cells expressing the chimeric receptor (Figure 12).

[0163] To test the cross-reactivity of anti-EGFR IgGs with mouse EGFR, an ELISA was performed. A serial titration of recombinant mouse EGFR ECD-Fc, starting at 5 μg / ml and diluted to 0.038 μg / ml, was coated onto a MAXISORP™ ELISA plate overnight at 4°C. The binding of anti-EGFR IgG to this antigen was tested at a fixed concentration of 5 μg / ml and allowed to bind for 1 hour at room temperature. As a positive control for antibody immunoreactivity, the same ELISA setup was performed using human EGFR ECD-Fc fusion protein (R&D systems) as the antigen. Next, goat anti-mouse IgG HRP conjugate (BD Biosciences) was allowed to bind for 2 hours at room temperature. Bound IgG was detected by measuring OD450nm. Antibody PG3370 was shown to recognize mouse EGFR as well as human EGFR with similar affinity (Figure 13, upper panel). Cetuximab does not recognize mouse EGFR (125084 Erbitux Pharmacology Review Part 2 - FDA). Therefore, PG3370 and cetuximab do not recognize the same epitope on human EGFR.

[0164] Mouse cMET cross-reactivity test To test the cross-reactivity of PG3342 with mouse cMET, an ELISA was performed. A fixed concentration of mouse HGF R / c-MET Fc (R&D Systems) was diluted to 2.5 μg / ml in PBS and coated onto a MAXISORP™ ELISA plate overnight at 4°C. Anti-cMET IgG binding to this antigen was tested using semi-logarithmic titration starting at 10 μg / ml. The antibody was allowed to bind for 1 hour at room temperature. As a positive control for antibody immunoreactivity, the same ELISA setup was performed using human HGF R / c-MET Fc fusion protein (R&D Systems) as the antigen. Next, goat anti-mouse IgG HRP conjugate (BD Biosciences) was added and allowed to bind for 2 hours at room temperature. Bound IgG was detected by measuring OD at 450 nm. BAF527, an affinity-purified polyclonal goat IgG against biotin-conjugated mouse cMET, was included as a positive control antibody. No cross-reactivity to mouse cMET was observed with the PG3342 antibody (FIG. 13, lower panel).

[0165] Cross-blocking assay of cMET antibodies cMET-specific phage were tested for competition with a cMET reference antibody in an ELISA. Therefore, 2.5 μg / ml of cMET-Fc fusion protein was coated onto a MAXISORP™ ELISA plate overnight at 4°C. The wells of the ELISA plate were blocked with PBS (pH 7.2) containing 2% ELK for 1 hour at room temperature with shaking (700 rpm). Reference or negative control IgG was then added at a concentration of 5 μg / ml and allowed to bind for 15 minutes at room temperature at 700 rpm. Five μl of PEG-precipitated phage was then added and allowed to bind for 1 hour at room temperature at 700 rpm. Bound phage were detected with an HRP-labeled anti-M13 antibody for 1 hour at room temperature at 700 rpm. As a control, the procedure was performed simultaneously with antibodies specific for the coated antigen and the negative control phage. Bound secondary antibodies were visualized by TMB / H2O2 staining, and staining was measured at OD . 450nmThe antibody competition assay was quantified by measurement. Table 2 demonstrates that MF4040 and MF4356 exhibit competition with the 5D5 reference antibody. MF4297 competes to a lesser extent with 13.3.2 and C8H241. All positive control phages exhibit perfect competition with the corresponding IgG, but the antibody controls do not affect the competition assay.

[0166] Generation of bispecific antibodies Bispecific antibodies have been generated by transient co-transfection of two plasmids encoding IgGs with different VH domains, using proprietary CH3 engineering technology to ensure efficient heterodimerization and bispecific antibody formation. A common light chain is also co-transfected into the same cell, either on the same plasmid or on a separate plasmid. In our co-pending applications (e.g., WO 2013 / 157954 and WO 2013 / 157953; incorporated herein by reference), we have disclosed methods and means for producing bispecific antibodies from a single cell, thereby providing means for forming bispecific antibodies rather than monospecific antibodies. These methods may also be advantageously used in the present invention. In particular, preferred mutations that produce essentially only bispecific full-length IgG molecules are amino acid substitutions at positions 351 and 366, such as L351K and T366K (EU numbering) in the first CH3 domain ("KK-mutant" heavy chain) and amino acid substitutions at positions 351 and 368, such as L351D and L368E in the second CH3 domain ("DE-mutant" heavy chain), or vice versa. In our cognate pending application, we previously demonstrated that negatively charged DE mutant heavy chains and positively charged KK mutant heavy chains preferentially pair to form heterodimers (so-called "DEKK" bispecific molecules). Homodimerization of DE mutant heavy chains (DE-DE homodimers) or KK mutant heavy chains (KK-KK homodimers) is unfavorable due to strong repulsion between charged residues at the CH3-CH3 interface between identical heavy chains.

[0167] The cMET and EGFR Fab arms were cloned into the appropriate KK and DE vectors (Table 3). After production, the bispecific IgGs were purified by Protein A batch purification and buffer exchanged into PBS. Successful production yields a minimum concentration of 0.1 mg / ml of IgG1 full-length antibody assigned a unique code (PBnnnnn; where nnnnn represents a randomly generated number) that identifies the specific combination of two different target-binding Fab fragments. Successfully produced bispecific IgGs were tested for binding to their respective targets by ELISA.

[0168] Example 3 Screening of c-MET×EGFR bispecific antibodies in EGF / HGF and HGF and EGF proliferation assays The potency of the cMET x EGFR bispecific antibody panel was tested in N87 cells using HGF / EGF, HGF, and EGF assays. The N87 cell line, formally designated NCl-N87, is a metastatic-derived gastric cancer cell line with high EGFR expression, which mediates cMET expression (Zhang et al., 2010). Antibodies were tested at eight semi-logarithmic titrations ranging from 10 μg / ml to 3.16 ng / ml. Each antibody was tested in duplicate. The anti-RSV-G antibody PG2708 was used as a negative control. The reference antibody 2994Fab was used as a positive control for the HGF assay, and the reference antibody cetuximab was used as a positive control for the EGF assay.

[0169] Equimolar 1:1 cetuximab / 5D5 Fab was used as a positive control for EGF, HGF and EGF / HGF assays.

[0170] Wells containing either one of the ligands or a combination of ligands, as well as a medium control, were included in the determination of the assay window. Antibodies were diluted in chemically defined starvation medium (CDS: RPMI 1640 medium containing 80 U penicillin and 80 μg streptomycin per ml, 0.05% (w / v) BSA, and 10 μg / ml holo-transferrin), and 50 μl of diluted antibody was added to wells of a 96-well black clear-bottom plate (Costar). Ligands were added (400 ng / ml HGF and 4 ng / ml EGF diluted in CDS, and 50 μl per well of a stock solution containing EGF / HGF concentrations of 4 ng / ml EGF and 400 ng / ml HGF; R&D Systems, catalog numbers 396-HB and 236-EG). N87 cells were trypsinized, harvested, and counted, and 8000 cells in 100 μl of CDS were added to each well of the plate. To avoid edge effects, the plates were incubated at room temperature for 1 hour before being placed in a 37°C cell culture incubator for 3 days. On day 4, Alamar Blue (Invitrogen, #DAL1100) was added (20 μl per well), and fluorescence was measured using 560 nm excitation and 590 nm detection in a Biotek Synergy 2 Multi-mode microplate reader after 6 hours of incubation with Alamar Blue (37°C). Fluorescence values ​​were normalized to uninhibited proliferation (no antibody, but both ligands added). Examples of HGF, EGF, and EGF / HGF proliferation assays are shown in Figure 14 (Figures 14A, B, and C, respectively).

[0171] Table 4 lists the results of various experiments. In the N87 HGF / EGF assay, 14 different cMETxEGFR bispecifics were identified with potency comparable to that of a reference monospecific antibody (an equimolar mix of cetuximab and 5D5 Fab): PB7679, PB7686, PB8218, PB8244, PB8292, PB8316, PB8340, PB8364, PB8388, PB8511, PB8535, PB8583, PB8607, and PB8640.

[0172] The N87 EGF assay identified 11 different cMETxEGFR bispecifics with potency comparable to the monospecific cetuximab: PB7679, PB8244, PB8292, PB8340, PB8364, PB8388, PB8511, PB8535, PB8583, PB8607, and PB8640, all of which contain the EGFR Fab arm MF3755. The HGF N87 assay identified nine bispecifics that showed increased potency compared to the monospecific 5D5 Fab reference antibody: PB8218, PB8388, PB8511, PB8532, PB8535, PB8545, PB8583, PB8639, and PB8640. They contain six different cMET Fab arms MF4040, MF4297, MF4301, MF4356, MF4491 and MF4506.

[0173] ADCC activity The ADCC activity of 24 cMetxEGFR bispecifics was tested against the tumor cell lines N87 (EGFR-high, cMET-low) and MKN-45 (EGFR-low, cMET-amplified). ADCC assays were performed using a Promega ADCC Bioassay kit in a 384-well plate format. Antibodies were tested in duplicate at nine different concentrations in semi-log serial dilutions ranging from 10 μg / ml to 1 ng / ml.

[0174] A reference cetuximab antibody was included as a positive control for the assay, and PG2708 was used as a negative control antibody. Antibodies or assay medium controls (no IgG) were incubated with ADCC effector and target cells (N87 or MKN-45) for 6 hours of induction at 37°C. Luciferase activity was quantified using Bio-Glo Luciferase Reagent.

[0175] An example of an ADCC assay is shown in Figure 15. None of the cMETxEGFR bispecifics showed significant ADCC activity in both cell lines. The positive control reference cetuximab antibody showed dose-dependent ADCC activity in both cell lines.

[0176] Five bispecifics consisting of EGFR and cMET arms that showed high efficiency in the N87 HGF / EGF assay and high sequence diversity (Table 5) were selected for further analysis. Two of the five bispecifics contain MF4356, which competes with 5D5 for binding to cMET (Table 2). Table 5 summarizes the characteristics of the selected candidates.

[0177] Wound healing cell migration assay Two NSCLC cell lines were tested in the wound healing assay: EBC-1 and H358. These cell lines were selected because they express high levels of EGFR and cMET (Zhang et al., 2010; Fong et al., 2013). The assay was performed using a CytoSelect™ 24-well plate wound healing assay (Cell Biolabs, CBA-120) according to the manufacturer's instructions. Briefly, 2.5–4 × 10 5 Cancer cells were seeded into each well and incubated overnight at 37°C to form a monolayer. The well inserts were then removed, creating a 0.9 mm wound field. After washing with PBS to remove dead cells and debris from the wound area, the cells were incubated for 15 minutes at 37°C in complete medium (0.5% FBS) containing the bispecific (100 nM) or cetuximab:Fab2994 control antibody mixture (100 nM, 1:1 molar ratio). Each well was then supplemented with growth factors: HGF (15 ng / ml), EGF (12.5 ng / ml), or a combination of both (15 and 12.5 ng / ml). Time-lapse monitoring of wound closure was performed for 14 hours at 37°C using a confocal microscope (Zeiss LSM780). The degree of wound closure (%) is shown relative to the untreated control.

[0178] H358 cells showed increased migration (percent wound closure) upon exposure to either HGF or EGF alone, which was most effective with the combination of HGF and EGF (Figure 3). This increased migration was abolished by the addition of many bispecifics, most evident with PB8532. This inhibition was comparable to the cetuximab and 5D5 Fab combination, except for the inhibition of migration in the presence of EGF / HGF.

[0179] EBC-1 cells showed a slight increase in migration with the addition of HGF, but not in the presence of EGF or the EGF / HGF combination. However, wound closure could be inhibited by the bispecifics, particularly PB8532, in all assay conditions. PB8532 was more effective than the cetuximab / 5D5 Fab combination, or more effective (EGF / HGF).

[0180] Analysis of EGFR and cMET expression in PC-9 and HCC827 cells by flow cytometry Acquired resistance to erlotinib may result from aberrant activation of HGF-mediated c-MET activation. NSCLC cell lines PC-9 and HCC827 were selected to examine the ability of a cMET x EGFR bispecific antibody to inhibit ligand-mediated proliferation in the setting of tyrosine kinase inhibitor (TKI) resistance. Both cell lines lack EGFR mutations and are resistant to both erlotinib and gefitinib or the combination of gefitinib and erlotinib (PC-9 alone) in the presence of HGF. It has been reported that HGF-induced erlotinib resistance in PC-9 cells can be abrogated by a cMET inhibitor (Nakade et al., 2014), and gefitinib resistance can be abrogated by an anti-HGF antibody (Yano, 2008). PC-9 and HCC827 were characterized for cMET and EGFR expression by FACS analysis using fluorescently labeled antibodies. Cells were harvested in PBS 2 mM EDTA. Single-cell suspensions (10e6 cells in 50 μl) were incubated with fluorescently labeled antibodies in staining buffer (PBS 2% FBS 2 mM EDTA) for 20 minutes on ice. The following antibodies were used alone or in combination: Met Alexa Fluor 488 conjugate (Clone D1C2, Cell Signaling, 1:50 dilution); EGF Receptor Alexa Fluor 647 conjugate (Clone D38B1, Cell Signaling, 1:50 dilution). After incubation, cells were washed with staining buffer, and FACS analysis was performed on a BD FACSVerse flow cytometer.

[0181] All HCC827 cells showed EGFR expression, and EGFR high , cMET pos Population and EGFR pos , cMET neg PC-9 cells can be subdivided into EGFR subpopulations (Figure 4). high and cMET pos A small population of cells, as well as EGFR pos and cMET neg Contains a minimal population of cells.

[0182] PC-9 and HCC827 proliferation assays Initial experiments were conducted to determine the concentration of HGF required to establish erlotinib and gefitinib resistance in PC-9 and HCC827 cells. Following overnight starvation in medium containing 0.5% FBS, cells were incubated with increasing concentrations of HGF ranging from 0 to 120 ng / mL in 10% FBS supplemented with 300 nM erlotinib or gefitinib. After 72 h of incubation, cell proliferation was assessed using WST-1 reagent according to the manufacturer's instructions. Absorbance was measured by a microplate reader at reference wavelengths of 450 nm and 630 nm, respectively, during the assay. In both PC-9 (Figure 16A) and HCC827 (Figure 16B), the addition of HGF induced resistance to TKIs in a dose-dependent manner.

[0183] PB8532 and PB8388 were tested for their efficacy in the TKI-resistant setting. 3 Cancer cells were seeded in 100 μL of complete RPMI 1640 (10% FBS) in a 96-well plate. After overnight starvation in medium containing 0.5% FBS, the cells were preincubated with Biclonics® (100 nM) or a cetuximab:Fab2994 control monospecific antibody mixture (100 nM, 1:1 molar ratio) for 15 minutes at 37°C. Each well was then supplemented with complete medium (10% FBS) containing gefitinib or erlotinib (300 nM) with or without HGF (30 ng / ml), EGF (30 ng / ml), or a combination of both (30 ng / ml). After 72 hours of incubation, cell proliferation was assessed using the WST-1 method.

[0184] Figure 5 shows that PB8532 can inhibit HGF- and EGF-mediated gefitinib resistance in PC-9 cells. In HCC827 cells, PB8532 inhibited HGF-mediated TKI resistance more potently than the combined administration of dual monospecific cetuximab 5D5 Fab. Comparable results were obtained with the TKI erlotinib.

[0185] Example 4 PB8532 inhibition of EGF and cMET phosphorylation After overnight starvation in FBS-free medium, cells were incubated with medium (0.5% FBS) containing PB8532 (100 nM) or a cetuximab:Fab2994 control monospecific antibody mixture (100 nM, 1:1 molar ratio) for 15 min at 37°C. Cells were then stimulated with growth factors: HGF (30 ng / ml) or EGF (50 ng / ml) for 15 min at 37°C. After stimulation, cells were washed with PBS in the presence of 1 mM orthovanadate (Sigma-Aldrich). Protein extraction was performed using RIPA lysis buffer (50 mM Tris HCl pH 8, 150 mM NaCl, 1% Triton X-100, 0.5% sodium deoxycholate, 0.1% SDS) supplemented with Complete Protease Inhibitor Cocktail (Roche), PhosSTOP phosphatase inhibitor (Roche), and orthovanadate (1 mM, Sigma-Aldrich). Lysates were incubated on ice for 30 min before being centrifuged at 4°C for 15 min to remove cellular debris. After centrifugation, the supernatant was collected, and protein concentration was determined using bicinchoninic acid (BCA) reagent (Pierce) according to the manufacturer's instructions. Protein samples were denatured by adding loading buffer 6X (β-mercaptoethanol 0.6 M; SDS 8%; Tris-HCl 0.25 M pH 6.8; glycerol 40%; bromophenol blue 0.2%) and incubating at 95°C for 5 minutes. After electrophoresis, proteins were transferred to a nitrocellulose membrane using the Trans-Blot® Turbo™ Blotting System (Bio-Rad). The membrane was blocked for nonspecific binding with 5% nonfat dry milk in Tris-buffered saline-Tween 0.1% (50 mM Tris HCl pH 7.6, 150 mM NaCl, 0.1% Tween; TBS-T) for 1 hour at room temperature (RT) and then incubated with primary antibodies overnight (ON) at 4°C.The following primary antibodies were used: Phospho-Met (Tyr1234 / 1235, Clone D26, Cell Signaling) 1:500 in TBS-T 5% BSA; Met (Clone D1C2, Cell Signaling) 1:1000 in TBS-T 5% BSA; Phospho-EGF Receptor (Tyr1068, Clone D7A5, Cell Signaling) 1:1000 in TBS-T 5% nonfat dry milk; EGF Receptor (Clone D38B1, Cell Signaling) 1:1000 in TBS-T 5% BSA; and Vinculin (Monoclonal anti-Vinculin, V9131, Sigma-Aldrich) 1:4000 in TBS-T 5% nonfat dry milk. After incubation with the indicated primary antibodies, the membranes were washed in TBS-T for 15 minutes and then incubated with secondary antibodies (1:5000 in TBS-T 5% nonfat dry milk) for 1 hour at room temperature. The following secondary antibodies were used: goat anti-rabbit IgG-HRP (sc-2004, Santa Cruz Biotechnology); goat anti-mouse IgG-HRP (sc-2005, Santa Cruz Biotechnology). Signals were visualized using Enhanced Chemiluminescent Reagents (ECL; Invitrogen) or SuperSignal West Femto Chemiluminescent Substrate (Thermo Scientific) on a digital imager (ImageQuant LAS 4000, GE Healthcare Life Science Technologies).

[0186] Figure 6 shows a Western blot analysis of the experiments performed. In PC-9 cells, PB8532 and 5D5 / cetuximab can reduce HGF-induced phosphorylation. Furthermore, both antibodies slightly reduced EGF phosphorylation in the absence and presence of EGF.

[0187] In HCC827 cells, PB8532 reduced cMET phosphorylation in the presence and absence of HGF. No effect was observed with the 5D5 / cetuximab combination. Furthermore, in this cell line, PB8532 reduced EGF-induced phosphorylation of EGFR, in contrast to the combination of 5D5 with cetuximab.

[0188] Example 5 Figure 7 shows various sequences of the variable region of the heavy chain alternatives of the EGFR-binding variable domain disclosed herein. Figure 8 shows various sequences of the variable region of the heavy chain alternatives of the cMET-binding variable domain disclosed herein. The heavy chain variable regions were used to generate a number of different cMETxEGFR bispecific antibodies. The light chains of these antibodies have the sequences shown in Figure 9B. The bispecific antibodies were produced as described in Example 1. The antibodies were also produced as ADCC-enhanced versions. The ADCC-enhanced versions were produced by including DNA encoding a reductase that removes fucose residues from the Fc region of IgG1 in the co-transfection of the antibody construct.

[0189] Figure 17 shows the titration of various produced bispecific antibodies on CHO-K1 EGFR cells described in Example 2 (Panel A) and on MKN-45 cells that endogenously express c-MET (Panel B). Cells were incubated with increasing concentrations of antibody as indicated and 2 x 10 5Cells were incubated at 1000 cells / well. After washing, binding was detected with anti-human IgG-PE (3 μg / ml). Stained cells were analyzed using the iQue system, and mean fluorescence intensity (MFI) and area under the curve (AUC) were calculated. Control antibodies were MF1337×MF1337 (PG1337p218; TT×TT negative control; lower dark triangles) and MF4356×MF3770 (PB8532p04; c-MET×EGFR positive control; closed triangles). TT stands for tetanus toxoid. The variable domains comprising the VH of MF1337 (see Figure 1) and the common light chain described herein bind to tetanus toxoid and are therefore not expected to bind to CHO-K1 EGFR cells or MKN-45 cells. The annotation (ADCC) indicates that antibodies with enhanced ADCC function were produced by cotransfection with DNA encoding an RMD enzyme that removes fucose residues from the Fc region of IgG1. See Table 6 for a list of the bispecific antibodies used and their PB codes.

[0190] ADCC reporter assay ADCC reporter assays were performed to determine whether cotransfection of RMD-encoding DNA successfully enhanced ADCC effector function. All samples were tested in duplicate in BxPC3 cells (expressing EGFR) and MKN-45 cells (expressing c-MET) using both high-affinity and low-affinity assays. The high-affinity effector cells in the assay express the V variant of human FcyRIIIa, and the low-affinity effector cells express the F variant.

[0191] Briefly, BxPC3 and MKN45 target cells were harvested, plated at 1,000 cells / well in 30 μL, and incubated overnight at 37°C, 5% CO2, and 95% relative humidity. The following day, the medium was removed, and 10 μL of antibody dilution was added to each well (antibody dilution 1.5x; 9 serial dilutions with semi-logarithmic dilution steps yielding assay concentrations from 1 ng / ml to 10 μg / ml). On the same day, effector cells were thawed at 37°C, and 630 μL was added to 3.6 ml of assay buffer in a 1.5 ml tube and mixed by rotation; 5 μL of this solution (15,000 cells) was then added to the wells of the assay plate. The plate was incubated for 6 hours at 37°C, 5% CO2, and 95% relative humidity before the addition of 15 μL of Bio-Glo reagent to the assay wells. Luminescence was measured using an EnVision plate reader.

[0192] A list of the samples tested is provided in Table 6, and the assay results are provided in Figure 18. A non-ADCC-enhanced anti-HER-3 x EGFR control antibody (batch PB4522p25; MF4280 x MF3178 described in WO 2015 / 130172) was negative in all four assays (shown in Figure 18 by the black cross and solid line (fourth from the top)). In contrast, an ADCC-enhanced version of this antibody (PB4522p34) was positive in all four assays (shown by the orange solid circle). Similarly, a non-ADCC-enhanced cMET x EGFR control antibody (PB8532p04) was negative in all four assays (shown in Figure 18 by the black cross and dotted line), and the PB8532p05 batch was also non-ADCC-enhanced (shown by the green asterisk). All three lines with asterisks are at the bottom of all four panels. However, the ADCC-enhanced p06 mutant (PB8532p06) was positive in all assays (indicated by the orange open circle). Enhanced ADCC effector function similar to that of PB8532p06 was also observed in five bispecifics (PB19474 to PB19478). This indicates that cotransfection of RMD-encoding DNA successfully enhanced ADCC effector function.

[0193] Example 6 The heavy chain variable region (VH) of the cMET variable domain of PB8532 contains, for example, the amino acid sequence of MF4356 shown in Figure 8. The VH of the cMET variable domain of PB19748 contains, for example, the amino acid sequence of MF8230 (see Figure 8). The VH of the EGFR variable domain of PB8532 contains, for example, the amino acid sequence of MF3370 shown in Figure 7. The VH of the EGFR variable domain of PB19748 contains, for example, the amino acid sequence of MF8233 shown in Figure 7. The light chains of PB8532 and PB19748 are the same and are shown in Figure 9B. The cMET antibody LY2875358 antibody was described, inter alia, in Kim and Kim 2017. The ability of the cMET x EGFR bispecific antibody PB8532 or PB19748 to inhibit tumor growth in vivo was tested in xenograft mouse models alone and in combination with the receptor tyrosine kinase inhibitor erlotinib. In the selected model, HCC827 tumor cells were transplanted into immunodeficient NOD SCID gamma (NSG) human hepatocyte growth factor knock-in (hHGF) mice, which express human HGF (the ligand for cMET) instead of endogenous mouse HGF. NSG hHGF mice are referred to in full as NOD.Cg-Hgf. tm1.1(HGF)Aveo Park dcscid Il2rgtm1Wjl / J (stk#014553) (NOD.Cg-Hgftm1.1(HGF)Aveo Prkdcscid Il2rgtm1Wjl / J). They have no T or B cells, lack functional NK cells, and are defective in cytokine signaling, making them more susceptible to tumor engraftment. HCC827 is an established human non-small cell lung cancer (NSCLC) cell line known to express EGFR and cMET and to be resistant to erlotinib in the presence of HGF.

[0194] To establish the effect of erlotinib on tumor growth in this model, the first experiment was conducted in two groups of mice. Prior to tumor cell implantation, the cell cycle of HCC827 cells was boosted by culturing the cells overnight in medium supplemented with 20% fetal bovine serum (FBS) at a confluency not exceeding 80%. The following day, NSG-hHGFki mice (The Jackson Laboratory) were subcutaneously inoculated with 17 x 10e6 HCC827 tumor cells suspended in 300 μl PBS plus 30% Matrigel containing a high concentration of basement membrane matrix. The resulting tumors were measured twice weekly using calipers. The mean tumor volume was approximately 200 mm 3 Once tumor size reached 0.05, mice were randomized into two groups (4-7 mice per group depending on tumor growth and volume) and drug treatment was initiated.

[0195] A microsuspension of erlotinib was prepared fresh weekly in 0.05% hydroxypropylmethylcellulose (HPMC) and 0.2% Tween-80 in water by sonication.

[0196] Starting on day 19, erlotinib solution was used to treat five mice (n=5) once daily (QD) via gavage at a dose of 6 mg / kg, and groups of four mice received 200 μl of vehicle (0.05% HPMC and 0.1% Tween 80 in water) via gavage once daily. Tumor volumes were measured twice weekly using calipers, and the mean tumor volume (and SEM) was calculated for each group. Tumors with a size of 1500 mm were 0.1% or greater than 1500 mm. 3 Mice were euthanized when tumor volume reached 48 days. Treatment was stopped after 48 days, and tumor volumes of surviving mice were measured up to 62 days.

[0197] In a second experiment testing the ability of the PB8532 bispecific antibody (alone and in combination with erlotinib) to inhibit tumor growth in this model, NSG-hHGFkI mice bearing tumors (generated as described above) received one of six treatments or a combination of treatments: the antibody was given weekly by intraperitoneal (ip) injection, and erlotinib or vehicle was given once daily (QD) by gavage. As a negative control, mice were also treated with PB17160, a bispecific antibody consisting of the same anti-c-MET Fab arm as PB8532, combined with a Fab arm specific for an unrelated target. The unrelated target is, for example, one not present in the mouse or tumor. Tetanus toxoid-specific variable domains are often used. A suitable tetanus toxoid-binding variable domain has the VH of MF1337 (see Figure 1) and the consensus light chain disclosed herein, preferably the sequence of Figure 9. Bispecific antibodies having a targeting arm and a non-targeting (TT) arm are described, inter alia, in International Publication No. WO 2017 / 069628, which is incorporated herein by reference, see MF1337. Another unrelated target is RSV-G. A suitable RSV-G variable domain has the VH and common light chain of MF2708 in Figure 1, preferably one of Figure 9, preferably Figure 9B.

[0198] On day 21, the mean tumor volume was approximately 200 mm 3Once tumor size reached 100 mg / kg, mice were randomized into six groups (5–7 mice per group depending on tumor growth and volume), and drug treatment was initiated: daily gavage of vehicle alone (n = 5); weekly IP injections of 25 mg / kg PB8532 antibody and daily gavage of vehicle (n = 7); weekly IP injections of 25 mg / kg PB17160 antibody and daily oral gavage of vehicle (n = 6); daily oral gavage of 6 mg / kg erlotinib (n = 7); weekly IP injections of 25 mg / kg PB8532 antibody and daily oral gavage of 6 mg / kg erlotinib (n = 7); or weekly IP injections of 25 mg / kg PB17160 antibody and daily oral gavage of 6 mg / kg erlotinib (n = 7). Tumor volume was monitored as described above, and the mean tumor volume (and SEM) was calculated for each group. After 60 days, all treatments were stopped and tumor volumes of surviving mice were measured up to 82 days.

[0199] In a third experiment, the ability of the PB19478 bispecific antibody (alone and in combination with erlotinib) to inhibit tumor growth in this model was tested. NSG-hHGFkI mice bearing tumors (generated as described above) received one of six treatments or a combination of treatments: antibody given weekly by intraperitoneal (ip) injection, and erlotinib or vehicle given once daily (QD) by gavage.

[0200] On day 23, the mean tumor volume was approximately 200 mm 3Once tumor size reached 100 mg / kg, mice were randomized into six groups (5–6 mice per group depending on tumor growth and volume), and drug treatment was initiated: daily gavage of vehicle alone (n = 5); weekly IP injections of 25 mg / kg PB19478 antibody and daily gavage of vehicle (n = 5); daily oral gavage of 6 mg / kg erlotinib (n = 6); weekly IP injections of 25 mg / kg PB19478 antibody and daily oral gavage of 6 mg / kg erlotinib (n = 4; one mouse died during the experiment); weekly IP injections of 25 mg / kg LY2875358 antibody and daily oral gavage of vehicle (n = 5); and weekly IP injections of 25 mg / kg LY2875358 antibody and daily oral gavage of 6 mg / kg erlotinib (n = 3; two mice died during the experiment). Tumor volumes were monitored as described above, and the mean tumor volume (and SEM) was calculated for each group. After 93 days, all treatments were stopped, and tumor volumes of surviving mice were measured up to day 93.

[0201] In a fourth experiment, the effect of slow administration of PB19478 was tested. NSG-hHGFkI mice bearing tumors (generated as described above) received one of two treatments: the antibody was given weekly by intraperitoneal (ip) injection, and erlotinib or vehicle was given once daily (QD) by gavage.

[0202] On day 21, the mean tumor volume was approximately 200 mm 3 On day 51, when the mean tumor volume reached 500 mm, all 14 mice were started on daily oral gavage treatment with 6 mg / kg erlotinib. 3 Once the tumors clearly passed the marker, the mice were randomized into two groups. One group of six mice was treated with daily oral gavage of 6 mg / kg erlotinib, and one group of eight mice received weekly IP injections of 25 mg / kg PB19478 antibody and daily gavage of 6 mg / kg erlotinib. Tumor volume was monitored as described above, and the mean tumor volume (and SEM) was calculated for each group. After 72 days, all treatments were discontinued.

[0203] The results of the first experiment demonstrate that erlotinib was able to induce anti-tumor responses in NGS-hHGFki mice implanted with HCC827 cells, but only as long as the mice received treatment (Figure 19). In a drug-free period beginning approximately 4 weeks after treatment, tumor volume clearly increased in mice treated with erlotinib.

[0204] The anti-cMET×EGFR bispecific antibody PB8532 was also able to induce antitumor responses in NGS-hHGFki mice implanted with HCC827 cells (Figure 20). This effect was greater when the antibody was given in combination with a daily dose of erlotinib. Within 2.5 weeks, the combination of PB8532 with erlotinib resulted in the disappearance of all tumors. The cMET-targeting control antibody PB17160, which has one Fab arm, did not induce antitumor responses, either with or without erlotinib. Thus, specific targeting of the cMET Fab arm in combination with the EGFR-targeting Fab arm of the bispecific antibody PB8532 may overcome HGF-mediated erlotinib resistance. In a drug-free period beginning approximately 5.5 weeks after treatment, PB8532 was clearly more effective than erlotinib in reducing tumor volume, and no tumor regrowth was observed in the PB8532 + erlotinib combination group (Figure 21).

[0205] The anti-cMET×EGFR bispecific antibody PB19478 was also able to induce an antitumor response in NSG-hHGFki mice implanted with HCC827 cells (Figure 22). This effect was greater when the antibody was given in combination with a daily dose of erlotinib. Within two weeks, all tumors disappeared with the combination of PB19478 with or without erlotinib. With erlotinib, tumors did not reappear throughout the study period. Without erlotinib, tumors reappeared after only approximately 50 days and remained at detectable levels until further growth at day 80. The humanized monoclonal antibody emibetuzumab (LY3875358) was also ineffective when combined with the EGFR inhibitor erlotinib. Thus, specific targeting of the cMET Fab arm in combination with an EGFR-targeting Fab arm in the bispecific antibodies PB8532 or PB19478 can overcome HGF-mediated erlotinib resistance.

[0206] FIG. 23 shows that there is an immediate effect of bispecific antibody PB19478 when treating tumors at the time when erlotinib resistance begins to develop.

[0207] Taken together, data from this xenograft model of HCC827 tumor cells implanted in immunodeficient NSG-hHGFki mice demonstrate that PB8532, PB19478, and antibodies with similar VH sequences shown in Figures 7 and 8 have the ability to overcome HGF-mediated erlotinib resistance in vivo. Combination treatment remains effective even after cessation of treatment.

[0208] [Cited documents]

[0209] [Table 1]

[0210] [Table 2]

[0211] Table 3

[0212] Table 4

[0213] Table 5

[0214] Table 6

Claims

1. A bispecific antibody comprising a first variable domain capable of binding to the extracellular portion of the human epidermal growth factor receptor (EGFR) and a second variable domain capable of binding to the extracellular portion of the human MET proto-oncogene, receptor tyrosine kinase (cMET).

2. 2. The bispecific antibody of claim 1, comprising a common light chain.

3. 3. The bispecific antibody of claim 1 or claim 2, which is a human antibody.

4. 4. The bispecific antibody of claim 1, which is a full-length antibody.

5. 5. The bispecific antibody of any one of claims 1 to 4, which is an IgG1 format antibody with a 1:1 anti-EGFR, anti-cMET stoichiometry.

6. 6. The bispecific antibody of claim 1, having one variable domain capable of binding to EGFR and one variable domain capable of binding to cMET.

7. 7. The bispecific antibody of claim 1 , wherein the variable domain capable of binding to human EGFR is also capable of binding to cynomolgus monkey and mouse EGFR.

8. 8. The bispecific antibody of claim 1, wherein the variable domain capable of binding to human EGFR binds to domain III of human EGFR.

9. 9. The bispecific antibody of claim 1, wherein the variable domain capable of binding to cMET blocks the binding of antibody 5D5 to cMET.

10. 10. The bispecific antibody of claim 1, wherein the variable domain capable of binding to cMET blocks binding of HGF to cMET.

11. 11. The bispecific antibody of claim 1, wherein the amino acids at positions 405 and 409 of one CH3 domain are the same as the amino acids at the corresponding positions in the other CH3 domain (EU numbering).

12. The first variable domain has the CDR1 sequence SYGIS; the CDR2 sequence WISAYX 1 X 2 NTNYAQKLQG and sequence X 3 X 4 X 5 X 6 HWWLX 7 a heavy chain variable region having a CDR3 comprising A, X 1 =N or S;X 2 =A or G;X 3 =D or G;X 4 = R, S or Y; X 5 = H, L or Y; X 6 =D or W and X 7 = D or G; X 1 ~X 7 12. The bispecific antibody of claim 1, wherein the second variable domain comprises a heavy chain variable region having the amino acid sequence of one of SEQ ID NOs: 1 to 23 with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof at positions other than SEQ ID NOs: 1 to 23, and the second variable domain comprises a heavy chain variable region having the amino acid sequence of one of SEQ ID NOs: 1 to 23 with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

13. X 1 =N; X 2 =G; X 3 =D; X 4 =S; X 5 =Y; X 6 =W and X 7 =G; X 1 = N; X 2 = A; X 3 = D; X 4 = S; X 5 = Y; X 6 = W and X 7 = G; X 1 =S; X 2 =G; X 3 =D; X 4 =S; X 5 =Y; X 6 =W and X 7 =G; X 1 = N; X 2 = G; X 3 = D; X 4 = R; X 5 = H; X 6 = W and X 7 = D; X 1 =N; X 2 =A; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D; X 1 =S; X 2 =G; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D; X 1 =N; X 2 =G; X 3 =G; X 4 =Y; X 5 =L; X 6 =D and X 7 =G; X 1 =N; X 2 =A; X 3 =G; X 4 =Y; X 5 =L; X 6 =D and X 7 =G; or X 1 =S; X 2 =G; X 3 =G; X 4 =Y; X 5 =L; X 6 =D and X 7 =G 13. The bispecific antibody of claim 12, wherein

14. X 1 =N; X 2 =G; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D; X 1 =N; X 2 =A; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D; or X 1 =S; X 2 =G; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D 14. The bispecific antibody of claim 12 or 13, wherein

15. X 1 =N; X 2 =G; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D; or X 1 =N; X 2 =A; X 3 =D; X 4 =R; X 5 =H; X 6 =W and X 7 =D 15. The bispecific antibody of claim 12, wherein

16. 16. The bispecific antibody of any one of claims 1 to 15, wherein the heavy chain variable region of the second variable domain comprises the amino acid sequence of one of the sequences SEQ ID NO: 1-3; 7; 8; 10; 13; 15; 16; 17; 21; 22 or 23 with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

17. 17. The bispecific antibody of any one of claims 1 to 16, wherein the heavy chain variable region of the second variable domain comprises the amino acid sequence of one of the sequences SEQ ID NO: 2; 7; 8; 10; 13 or 23 with 0 to 10, preferably 0 to 5, amino acid insertions, deletions, substitutions, additions or a combination thereof.

18. 18. The bispecific antibody of any one of claims 1 to 17, wherein the first variable domain comprises a heavy chain variable region with CDR1 sequence SYGIS; CDR2 sequence WISAYNGNTNYAQKLQG and CDR3 comprising the sequence DRHWHWWLDA, and the second variable domain comprises a heavy chain variable region with CDR1 sequence SYSMN; CDR2 sequence WINTYTGDPTYAQGFTG and CDR3 sequence ETYYYDRGGYPFDP.

19. 18. The bispecific antibody of any one of claims 1 to 17, wherein the first variable domain comprises a heavy chain variable region having CDR1 sequence SYGIS; CDR2 sequence WISAYNANTNYAQKLQG and CDR3 comprising the sequence DRHWHWWLDA, and the second variable domain comprises a heavy chain variable region having CDR1 sequence TYSMN; CDR2 sequence WINTYTGDPTYAQGFTG and CDR3 comprising the sequence ETYFYDRGGYPFDP.

20. 20. The bispecific antibody of any one of claims 1 to 19, wherein the first and second variable domains comprise a common light chain, preferably the light chain of Figure 9B.

21. 21. The antibody of any one of claims 1 to 20, which inhibits HGF-induced proliferation of HGF growth-responsive cells.

22. 22. The antibody of any one of claims 1 to 21, which inhibits EGF-induced proliferation of EGF growth-responsive cells.

23. 23. The antibody of any one of claims 1 to 22 for use in the treatment of a disease involving abnormal cells.

24. 24. The bispecific antibody of any one of claims 1 to 23 for use in treating a subject with a tumor.

25. 25. The bispecific antibody for use according to claim 24, wherein the tumor is an EGFR-positive tumor, a cMET-positive tumor or an EGFR- and cMET-positive tumor.

26. 26. The bispecific antibody for use according to claim 24 or claim 25, wherein the tumor is breast cancer, colon cancer, pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer, head and neck cancer, lung cancer including non-small cell lung cancer or bladder cancer.

27. 27. The bispecific antibody for use according to any one of claims 24 to 26, wherein the tumor is resistant to treatment with an EGFR tyrosine kinase inhibitor.

28. 28. The bispecific antibody of claim 27, wherein the EGFR tyrosine kinase inhibitor is erlotinib, gefitinib, or afatinib, an analogue of erlotinib, gefitinib or afatinib, or a combination of one or more of the respective compounds and / or analogues thereof.

29. 29. The bispecific antibody for use according to claim 28, wherein the EGFR tyrosine kinase inhibitor is erlotinib.

30. 30. The bispecific antibody for use according to any one of claims 23 to 29, wherein the treatment further comprises treatment with an EGFR tyrosine kinase inhibitor.

31. 31. The bispecific antibody for use according to claim 30, wherein the EGFR tyrosine kinase inhibitor is erlotinib.

32. 32. The bispecific antibody for use according to claim 30 or 31 , wherein said bispecific antibody is administered simultaneously, sequentially or separately from said EGFR tyrosine kinase inhibitor.

33. 23. The bispecific antibody of any one of claims 1 to 22 for use in treating a disease involving abnormal cells, wherein the bispecific antibody is administered simultaneously, sequentially or separately with an EGFR tyrosine kinase inhibitor.

34. 23. A method of treating a subject with a tumor, comprising administering to an individual in need thereof the bispecific antibody of any one of claims 1 to 22.

35. 35. The method of claim 34, wherein the individual has a disease involving abnormal cells.

36. 36. The method of claim 34 or claim 35, wherein the tumor is an EGFR-positive tumor, a cMET-positive tumor, or an EGFR- and cMET-positive tumor.

37. 37. The method of any one of claims 34 to 36, wherein the tumor is breast cancer, colon cancer, pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer, head and neck cancer, lung cancer including non-small cell lung cancer, or bladder cancer.

38. 38. The method of any one of claims 34 to 37, wherein the tumor is resistant to treatment with an EGFR tyrosine kinase inhibitor.

39. 39. The method of claim 38, wherein the EGFR tyrosine kinase inhibitor is erlotinib, gefitinib, or afatinib, an analogue of erlotinib, gefitinib, or afatinib, or a combination of one or more of the respective compounds and / or analogues thereof.

40. 40. The method of claim 39, wherein the EGFR tyrosine kinase inhibitor is erlotinib.

41. 41. The method of any one of claims 34 to 40, wherein the treatment further comprises administering an EGFR tyrosine kinase inhibitor to the individual in need thereof.

42. 42. The method of claim 41, wherein the EGFR tyrosine kinase inhibitor is erlotinib.

43. 43. The method of claim 41 or claim 42, wherein the bispecific antibody is administered simultaneously, sequentially, or separately from the EGFR tyrosine kinase inhibitor.

44. 23. The bispecific antibody of any one of claims 1 to 22 for use in the manufacture of a medicament for the treatment of a disease involving abnormal cells.

45. An antibody comprising a variable domain capable of binding to the extracellular portion of human EGFR, mouse EGFR, and cynomolgus monkey EGFR.

Citation Information

Patent Citations

  • Dual-specific EGFR / c-Met antibody

    JP2016505537A

  • Antibodies that bind egfr and erbb3

    JP2017512756A

  • ANTIBODIES THAT BIND EGFR AND cMET

    JP2024029049A

  • Binding molecules that inhibit cancer growth

    WO2017069628A2

  • Protein complex, bispecific antibody including the protein complex, and method of preparation thereof

    US20140378664A1