Compositions and methods for improved nucleases

Abstract

The present disclosure provides recombinant Cas9 proteins that have a more rapid degradation rate than wild-type Cas9. The present disclosure also provides recombinant Cas9 proteins and CRISPR-Cas systems with reduced off-target modifications. Methods of site-specific modification with reduced off-target modifications utilizing the recombinant Cas9 proteins of the present disclosure are also provided herein.

Description

[Technical field]

[0001] The present disclosure provides recombinant Cas9 proteins that have a more rapid degradation rate than wild-type Cas9. The present disclosure also provides recombinant Cas9 proteins and CRISPR-Cas systems with reduced off-target modifications. Methods of site-specific modification with reduced off-target modifications utilizing the recombinant Cas9 proteins of the present disclosure are also provided herein. [Background technology]

[0002] Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and CRISPR-associated (Cas) systems are prokaryotic immune systems first discovered by Ishino in E. coli (Non-Patent Document 1). Prokaryotic immune systems provide immunity against viruses and plasmids by sequence-specifically targeting their nucleic acids. See also (Non-Patent Document 2). The CRISPR immune response involves two main stages, the first of which is acquisition and the second is interference. The acquisition stage involves cleaving the genomes of invading viruses and plasmids and integrating segments of the genomes of invading viruses and plasmids into the CRISPR locus of the organism. The segments integrated into the CRISPR locus of the organism are known as protospacers and help protect the organism from subsequent attacks by the same virus or plasmid. The second stage involves attacking the invading virus or plasmid. In the second step, the protospacer is transcribed into RNA which, after some processing, hybridizes to complementary sequences in the DNA of the invading virus or plasmid while also associating with a protein or protein complex that effectively cleaves the DNA.

[0003] Depending on the bacterial species, CRISPR RNA processing proceeds differently. For example, in the type II system first described in the bacterium Streptococcus pyogenes, the transcribed RNA is paired with a transactivating RNA (tracrRNA) and then cleaved by RNase III to form individual CRISPR-RNAs (crRNAs). The crRNAs are further processed after binding by Cas9 nuclease to produce mature crRNAs. The crRNA / Cas9 complex then binds to DNA containing a sequence complementary to the capture region (termed the protospacer). The Cas9 protein then site-specifically cleaves both strands of DNA, forming a double-strand break (DSB). This provides a DNA-based "memory" and leads to rapid degradation of viral or plasmid DNA upon repeated exposure and / or infection. Natural CRISPR systems have been extensively reviewed (see, for example, (Non-Patent Document 3)).

[0004] Since its initial discovery, multiple groups have conducted extensive investigations into the potential applications of the CRISPR system in genetic engineering, including gene editing (Non-Patent Document 4, Non-Patent Document 5, and Non-Patent Document 6). The CRISPR-Cas9 gene editing system has been used successfully in a wide range of organisms and cell lines. In addition to genome editing, the CRISPR system has multiple other applications, including regulating gene expression, genetic circuit construction, and functional genomics, among others (reviewed in Non-Patent Document 7).

[0005] The suitability of CRISPR / Cas9 for therapeutic applications is a hot topic.However, off-target modification of target genome (i.e., double-stranded DNA breaks at loci other than the intended target sequence) can lead to unpredictable and undesirable results, which raises concerns about using CRISPR system in clinical applications.See, for example, (Non-Patent Document 8), (Non-Patent Document 9) and (Non-Patent Document 10).

[0006] The cytotoxicity of the CRISPR / Cas9 system is also a concern. Studies have demonstrated that increased Cas9 nuclease efficiency triggered a tp53-dependent toxic response in cells (Non-Patent Document 11).

[0007] Efforts have been made to reduce the off-target modification of Cas9. Fu et al. describe a method using truncated guide RNAs with short target-complementary regions to reduce the length of the guide RNA-target DNA interface and thereby reduce the off-target effects of Cas9 (Non-Patent Document 12). Kleinstiver et al. describe modified Cas9 mutants that reduce contact with the target DNA sequence to minimize off-target binding (Non-Patent Document 13). However, while the off-target activity of Cas9 was reduced, both studies showed a corresponding decrease in on-target nuclease efficiency. [Prior art documents] [Non-patent literature]

[0008] [Non-Patent Document 1] Ishino et al., Journal of Bacteriology 169(12):5429-5433(1987) [Non-Patent Document 2] Soret et al., Nature Reviews Microbiology 6(3):181-186(2008) [Non-Patent Document 3] Barrangou et al.,Cell 54(2):234-244(2014) [Non-Patent Document 4] Jinek et al.,Science 337(6096):816-821(2012) [Non-Patent Document 5] Cong et al.,Science 339(6121):819-823(2013) [Non-Patent Document 6] Mali et al.,Science 339(6121):823-826(2013) [Non-Patent Document 7] Sander et al.,Nature Biotechnology 32:347-355(2014) [Non-Patent Document 8] Hsu et al., Nature Biotechnology 31(9):827-834(2013) [Non-Patent Document 9] Hsu et al.,Cell 157(6):1262-1278(2014) [Non-Patent Document 10] Schaefer et al.,Nature Methods 14(6):547-548(2017) [Non-Patent Document 11] Ihry et al.,bioRxiv(2017),doi:10.1101 / 168443 [Non-Patent Document 12] Nature Biotechnology 32(3):279-284(2014) [Non-Patent Document 13] Nature 529(7587):490-495(2016) Summary of the Invention [Problem to be solved by the invention]

[0009] Thus, there remains a need in the art for improved CRISPR / Cas9 systems with reduced off-target activity that maintain on-target efficiency. [Means for solving the problem]

[0010] In some embodiments, the disclosure provides recombinant Cas9 proteins that have a more rapid degradation rate than wild-type Cas9. In some embodiments, the disclosure also provides recombinant Cas9 proteins and CRISPR-Cas systems with reduced off-target modifications. In some embodiments, the disclosure provides methods of site-specific modification with reduced off-target modifications utilizing recombinant Cas9 proteins described herein.

[0011] In some embodiments, the disclosure provides recombinant Cas9 proteins comprising a modified KFERQ motif or a KFERQ-like motif.

[0012] In some embodiments, the modified KFERQ motif or KFERQ-like motif is selected from KFERQ (SEQ ID NO:24), RKVEQ (SEQ ID NO:25), QDLKF (SEQ ID NO:26), QRFFE (SEQ ID NO:27), NRVVD (SEQ ID NO:28), QRDKV (SEQ ID NO:29), QKILD (SEQ ID NO:30), QKKEL (SEQ ID NO:31), QFREL (SEQ ID NO:32), IKLDQ (SEQ ID NO:33), DVVRQ (SEQ ID NO:34), QRIVE (SEQ ID NO:35), VKELQ (SEQ ID NO:36), QKVFD (SEQ ID NO:37), QELLR (SEQ ID NO:38), VDKLN (SEQ ID NO:39), RIKEN (SEQ ID NO:40), NKKFE (SEQ ID NO:41), and combinations thereof. In some embodiments, the modified KFERQ-like motif is VDKLN (SEQ ID NO:39).

[0013] In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the REC lobe of a recombinant Cas9 protein. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the Rec2 domain of the REC lobe. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the HNH domain, RuvC domain, or PI domain of a recombinant Cas9 protein.

[0014] In some embodiments, the modified KFERQ motif or KFERQ-like motif is in a surface-exposed region of a recombinant Cas9 protein. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at the N-terminus or C-terminus of a recombinant Cas9 protein.

[0015] In some embodiments, the disclosure provides recombinant Cas9 proteins comprising one or more amino acid modifications of a wild-type Cas9 protein, the one or more amino acid modifications introducing a chaperone-mediated autophagy (CMA) targeting motif or an endosomal microautophagy (eMI) targeting motif into the Cas9 protein, wherein the recombinant Cas9 protein degrades in vivo at least 20% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif. In some embodiments, the recombinant Cas9 protein degrades in vivo at least 50% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif. In some embodiments, the recombinant Cas9 protein degrades in vivo at least 80% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif.

[0016] In some embodiments, the disclosure provides a recombinant Cas9 protein comprising one or more amino acid modifications in a wild-type Cas9 protein, wherein the recombinant Cas9 protein comprises a CMA targeting motif or an eMI targeting motif.

[0017] In some embodiments, the CMA or eMI targeting motif is selected from KFERQ (SEQ ID NO:24), RKVEQ (SEQ ID NO:25), QDLKF (SEQ ID NO:26), QRFFE (SEQ ID NO:27), NRVVD (SEQ ID NO:28), QRDKV (SEQ ID NO:29), QKILD (SEQ ID NO:30), QKKEL (SEQ ID NO:31), QFREL (SEQ ID NO:32), IKLDQ (SEQ ID NO:33), DVVRQ (SEQ ID NO:34), QRIVE (SEQ ID NO:35), VKELQ (SEQ ID NO:36), QKVFD (SEQ ID NO:37), QELLR (SEQ ID NO:38), VDKLN (SEQ ID NO:39), RIKEN (SEQ ID NO:40), NKKFE (SEQ ID NO:41), and combinations thereof. In some embodiments, the CMA or eMI targeting motif is VDKLN (SEQ ID NO:39). In some embodiments, the one or more amino acid substitutions are in a surface-exposed region of the recombinant Cas9 protein.

[0018] In some embodiments, the disclosure provides a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9) comprising an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or combinations thereof, of SEQ ID NO:1.

[0019] In some embodiments, the amino acid modification comprises one or more of the following mutations: F185N; A547E / I548L; T560E / V561Q; D829L / I830R; L1087E / S1088Q; or P1199D / K1200Q. In some embodiments, the amino acid modification is a mutation at F185. In some embodiments, the mutation is F185N. In some embodiments, the amino acid modification results in a CMA targeting motif or an eMI targeting motif.

[0020] In some embodiments, a recombinant Cas9 protein of the present disclosure is at least 90% identical to SEQ ID NO:1.

[0021] In some embodiments, the present disclosure provides recombinant Cas9 proteins capable of binding to the heat shock cognate protein of 70 kD (HSC70).

[0022] In some embodiments, the disclosure provides a recombinant protein isolated from Streptococcus pyogenes (SpCas9) that includes a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO: 1. In some embodiments, the KFERQ-like motif is VDKLN (SEQ ID NO: 39).

[0023] In some embodiments, the recombinant Cas9 protein of the disclosure further comprises a mutation at position D10, H840, or a combination thereof of SEQ ID NO: 1. In some embodiments, the mutation is selected from D10A or D10N; H840A, H840N, or H840Y, and combinations thereof. In some embodiments, the recombinant Cas9 protein of the disclosure generates sticky ends.

[0024] In some embodiments, the recombinant Cas9 proteins of the present disclosure further comprise one or more nuclear localization signals.

[0025] In some embodiments, the disclosure provides a polynucleotide sequence encoding a recombinant Cas9 of the disclosure. In some embodiments, the polynucleotide sequence is codon-optimized for expression in eukaryotic cells.

[0026] In some embodiments, the disclosure provides a non-naturally occurring CRISPR-Cas system comprising a recombinant Cas9 protein of the disclosure and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and comprises a guide sequence.

[0027] In some embodiments, the disclosure provides a non-naturally occurring CRISPR-Cas system comprising a polynucleotide sequence encoding a recombinant Cas9 protein of the disclosure and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and comprises a guide sequence.

[0028] In some embodiments, the disclosure provides a non-naturally occurring CRISPR-Cas system comprising a regulatory element operably linked to a polynucleotide sequence encoding a recombinant Cas9 protein of the disclosure, and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and comprises a guide sequence.

[0029] In some embodiments of the CRISPR-Cas system, the guide sequence is linked to a direct repeat sequence.

[0030] In some embodiments of the CRISPR-Cas system, the guide polynucleotide comprises a tracrRNA sequence. In some embodiments, the CRISPR-Cas system comprises a separate polynucleotide comprising a tracrRNA sequence.

[0031] In some embodiments of the CRISPR-Cas system, the polynucleotide sequence encoding the recombinant Cas9 protein and the guide polynucleotide are on a single vector. In some embodiments of the CRISPR-Cas system, the polynucleotide sequence encoding the recombinant Cas9 protein, the guide polynucleotide and the tracrRNA sequence are on a single vector.

[0032] In some embodiments, the delivery particle comprises a CRISPR-Cas system of the present disclosure. In some embodiments, the vesicle comprises a CRISPR-Cas system of the present disclosure. In some embodiments, the vesicle is an exosome or a liposome.

[0033] In some embodiments, the viral vector comprises a CRISPR-Cas system of the present disclosure, hi some embodiments, the viral vector is an adenovirus, a lentivirus, or an adeno-associated virus.

[0034] In some embodiments, the disclosure provides a method of providing a site-specific modification at a target sequence in the genome of a cell, the method comprising introducing into the cell a CRISPR-Cas system of the disclosure.

[0035] In some embodiments of the method, the modification comprises a deletion of at least a portion of the target sequence. In some embodiments of the method, the modification comprises a mutation of the target sequence. In some embodiments of the method, the modification comprises an insertion of a sequence of interest (SoI) in the target sequence.

[0036] In some embodiments of the method, the off-target modifications in the genome of the cell are less than about 5% of the modifications in the genome made by recombinant Cas9. In some embodiments of the method, the off-target modifications in the genome of the cell are less than about 2% of the modifications in the genome made by recombinant Cas9. In some embodiments of the method, the off-target modifications in the genome of the cell are less than about 1% of the modifications in the genome made by recombinant Cas9. In some embodiments of the method, the off-target modifications in the genome of the cell are reduced by at least about 50% compared to wild-type CRISPR-Cas9 or Cas9 that does not include a KFERQ motif or a KFERQ-like motif.

[0037] In some embodiments of the method, the cell is a bacterial cell, a mammalian cell, or a plant cell. In some embodiments of the method, the cell is a human cell. In some embodiments of the method, the cell is a pluripotent stem cell. In some embodiments of the method, the cell is an induced pluripotent stem cell.

[0038] In some embodiments of the method, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in the genome of the cell. In some embodiments of the method, the CRISPR-Cas system is introduced into the cell via a delivery particle, vesicle, or viral vector. [Brief description of the drawings]

[0039] [Figure 1-2] This relates to the experiment described in Example 4. Figure 1A shows that after stable transfection of Cas9 into human urothelial cells (SVHUC-1), cell number is reduced. Figure 1B shows that inducing Cas9 expression reduces body weight in mice expressing Cas9. The left panel of Figure 2 is a microscopic image of induced pluripotent stem cells (iPSCs). The right panel of Figure 2 is a microscopic image of iPSCs expressing Cas9. [Diagram 3] A diagram of the Cas9 protein from Streptococcus pyogenes (SpCas9) is shown. [Figure 4] The crystal structure of SpCas9 bound to a guide RNA (Sg RNA) and DNA is shown. [Figure 5-12]The experiment is described in Example 1. Figure 5A shows a diagram of a plasmid containing wild-type Cas9 and Cas9 containing a KFERQ motif. Figure 5B shows a diagram of a plasmid containing wild-type Cas9 and FaDe-Cas9 labeled with a FLAG tag, respectively. Figures 6A and 6B show Western blots (immunoblots) detecting the presence of Cas9 or FaDe-Cas9. In Figure 6A, wild-type Cas9 is detectable by a Cas9-specific antibody, whereas KFERQ-Cas9 is not. In Figure 6B, wild-type Cas9 labeled with FLAG is detectable by an antibody specific for FLAG and Cas9, whereas KFERQ-Cas9 labeled with FLAG is not detectable by either antibody. Figures 7A and 7B show the expression of Cas9 or FaDe-Cas9 over time. Western blot in Figure 7A shows that wild-type Cas9 levels increase over time, but FaDe-Cas9 is not detected by Cas9-specific antibody. Low exp: low exposure; high exp: high exposure; ctr: control (no Cas9). Figure 7B shows that mRNA transcription levels of Cas9 and FaDe-Cas9 are comparable at the same time points. Figure 8 shows a diagram of a dual reporter vector containing one promoter for expressing GFP-fused Cas9 and a second promoter for expressing mCherry. Figures 9A and 9B are fluorescence microscopy images showing cells expressing Cas9-GFP and FaDe-Cas9-GFp, respectively. Figure 10A shows the transfection efficiency of Cas9 and FaDe-Cas9 measured by mCherry fluorescence. Figure 10B shows the expression levels of Cas9 and FaDe-Cas9 measured by GFP fluorescence. Figures 11A and 11B show fluorescence microscopy images of Cas9-GFP and mCherry, respectively. Figure 11C is a merger of Figures 11a and 11B and shows that the same cells expressing GFP also express mCherry. Figure 12 shows a Western blot displaying the expression levels of Cas9 and FaDe-Cas9 over time in different cell types, as detected by a Cas9-specific antibody. [Figure 13-16]For the experiment described in Example 2. Figure 13A shows a co-immunoprecipitation blot of Cas9 or FaDe-Cas9 with HSC70 detected by HSC70-specific antibody. Figure 13B shows an immunofluorescence image of Cas9 or FaDe-Cas9 with Lamp-2A. Figure 14 shows two plasmid diagrams. The first plasmid expresses dsRed-fused Lamp-2A, and the second plasmid expresses GFP-fused FaDe-Cas9. Figure 15 shows a fluorescence microscope image of Lamp-2A-dsRed, FaDe-Cas9-GFP, and a merged image showing the co-localization of Lamp-2A with FaDe-Cas9. Figure 16 shows a Western blot displaying the localization of Cas9 and FaDe-Cas9 in the cytosol or nucleus. [Figure 17-19] For the experiments described in Example 3. Figure 17A shows the results of Surveyor nuclease assay (Cel1 assay) testing the nuclease activity of Cas9 and FaDe-Cas9 in HEK cells. Figure 17B shows next generation sequencing displaying the nuclease efficiency of Cas9 and FaDe-Cas9. Figure 18 shows the results of an assay testing Cas9 and FaDe-Cas9 nuclease activity in hiPSc. RNP: ribonucleoprotein; pl: plasmid. Figure 19 shows the analysis of off-target modifications by Cas9 and FaDe-Cas9 at EMX and FANCF loci. The left, middle, and right panels compare the on-target efficiency, off-target efficiency, and normalized on-target efficiency between Cas9 and FaDe-Cas9, respectively. [Figure 20A] 1 depicts data showing that FaDe-Cas9 has comparable on-target efficiency and reduced off-target activity compared to Cas9. [Figure 20B] 1 shows that cells transfected with Cas9 have a reduced proliferation rate compared to FaDe-Cas9 and untransfected cells. [Figure 21] 1 shows that cells edited with FaDe-Cas9 result in reduced chromosomal translocations compared to Cas9. [Figure 22A]FIG. 1 shows a diagram of an experiment testing cellular tolerance of Cas9 and FaDe-Cas9. [Fig. 22B-22C] This shows that cells can tolerate more copies of FaDe-Cas9 compared to Cas9. [Figure 23A-23B] Western blot quantification of Cas9 from cells transfected with Cas9 or FaDe-Cas9 is shown at 0-100 hour time points (Figure 23A) and a close-up of 0-24 hour time points (Figure 23B). DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0040] Described herein are components of the CRISPR-Cas system that can be used for genome editing, genome engineering, and modifying the expression of genes and / or genetic elements. The CRISPR-Cas system can be useful in a variety of therapeutic applications, including the treatment of genetic diseases. Also described herein are fast-degrading mutants of Cas9 protein (sometimes referred to as "FaDe-Cas9") that facilitate reduced off-target activity of the CRISPR-Cas9 system. Further advantages of fast-degrading Cas9 protein are described herein, including, but not limited to, on-target efficiency comparable to that of wild-type Cas9 and / or reduced toxicity compared to wild-type Cas9.

[0041] definition As used herein, "a" or "an" may mean one or more. As used herein in the specification and claims, and when used in conjunction with the word "comprising," the words "a" or "an" may mean one or more. As used herein, "another" or "further" may mean at least a second or more.

[0042] Throughout this application, the term "about" is used to indicate that a value includes the inherent variation of error for the method / device being used to determine the value or the variation that exists between test subjects. Typically, the term is meant to encompass a variability of approximately or less than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, or 20%, depending on the context.

[0043] Use of the term "or" in the claims is used to mean "and / or" unless expressly stated to refer to alternatives only or the alternatives are not mutually exclusive, however, the present disclosure supports a definition that refers to alternatives only and "and / or."

[0044] As used in the specification and claims, the words "comprising" (and any form of comprising, e.g., "comprise" and "comprises"), "having" (and any form of having, e.g., "have" and "has"), "including" (and any form of including, e.g., "includes" and "include") or "containing" (and any form of containing, e.g., "contains" and "contain") are inclusive or open ended and do not exclude additional unrecited elements or method steps. It is contemplated that any embodiment discussed herein can be practiced with respect to any method, system, host cell, expression vector, and / or composition of the disclosure. Furthermore, the disclosed compositions, systems, host cells, and / or vectors can be used to achieve the disclosed methods and proteins.

[0045] Use of the term "for example" and its corresponding abbreviation "eg" (whether italicized or not) means that the particular term recited is representative of and an embodiment of the present disclosure that is not limited to the particular example referenced or recited, unless expressly stated otherwise.

[0046] "Nucleic acid", "nucleic acid molecule", "nucleotide", "nucleotide sequence", "oligonucleotide" or "polynucleotide" refers to a polymeric compound comprising covalently linked nucleotides. The term "nucleic acid" includes ribonucleic acid (RNA) and deoxyribonucleic acid (DNA), both of which may be single-stranded or double-stranded. DNA includes, but is not limited to, complementary DNA (cDNA), genomic DNA, plasmid or vector DNA, and synthetic DNA. In some embodiments, the present disclosure provides a polynucleotide encoding any one of the polypeptides disclosed herein, and is directed to, for example, a polynucleotide encoding a Cas protein or a variant thereof. "Gene" refers to a collection of nucleotides that encodes a polypeptide, and includes cDNA and genomic DNA nucleic acid molecules. "Gene" also refers to a nucleic acid fragment that can act as a regulatory sequence preceding (5' non-coding sequences) and following (3' non-coding sequences) the coding sequence.

[0047] A nucleic acid molecule is "hybridizable" or "hybridized" to another nucleic acid molecule, e.g., cDNA, genomic DNA, or RNA, if a single-stranded form of the nucleic acid molecule can anneal to the other nucleic acid molecule under appropriate conditions of temperature and solution ionic strength. Hybridization and washing conditions are known and are exemplified in Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor (1989), particularly Chapter 11 and Table 11.1 therein. The conditions of temperature and ionic strength determine the "stringency" of the hybridization. Stringency conditions can be adjusted to screen moderately similar fragments, e.g., homologous sequences from distantly related organisms, against highly similar fragments, e.g., genes that duplicate functional enzymes from closely related organisms. For preliminary screening of homologous nucleic acids, a T mLow stringency hybridization conditions corresponding to a higher T can be used, such as 5×SSC, 0.1% SDS, 0.25% milk and no formamide; or 30% formamide, 5×SSC, 0.5% SDS. m For example, 40% formamide and 5× or 6× SCC. High stringency hybridization conditions correspond to a maximum T m For example, 50% formamide corresponds to 5x or 6x SCC. Hybridization requires that two nucleic acids contain complementary sequences, although, depending on the stringency of the hybridization, mismatches between bases are possible.

[0048] The term "complementary" is used to describe the relationship between nucleotide bases that can hybridize to one another. For example, with respect to DNA, adenosine is complementary to thymine and cytosine is complementary to guanine. Thus, the present disclosure also includes isolated nucleic acid fragments that are complementary to the complete sequences disclosed or used herein and nucleic acid sequences that are substantially similar thereto.

[0049] A DNA "coding sequence" is a double-stranded DNA sequence that is transcribed and translated into a polypeptide in a cell in vitro or in vivo when placed under the control of appropriate regulatory sequences. A "suitable regulatory sequence" refers to a nucleotide sequence located upstream (5' non-coding sequences), within or downstream (3' non-coding sequences) of a coding sequence that influences the transcription, RNA processing or stability or translation of the associated coding sequence. Regulatory sequences can include promoters, translation leader sequences, introns, polyadenylation recognition sequences, RNA processing sites, effector binding sites and stem-loop structures. The boundaries of a coding sequence are determined by a start codon at the 5' (amino) terminus and a translation stop codon at the 3' (carboxyl) terminus. Coding sequences can include, but are not limited to, prokaryotic sequences, cDNA from mRNA, genomic DNA sequences and even synthetic DNA sequences. If the coding sequence is intended for expression in a eukaryotic cell, polyadenylation signals and transcription termination sequences are usually located 3' to the coding sequence.

[0050] "Open reading frame", abbreviated ORF, means a nucleic acid sequence, either DNA, cDNA or RNA, of a length that includes a translation initiation signal or start codon, e.g., ATG or AUG, and a stop codon, and that can potentially be translated into a polypeptide sequence.

[0051] The term "homologous recombination" refers to the insertion of a foreign DNA sequence into another DNA molecule, for example, the insertion of a vector into a chromosome. In some cases, the vector targets a specific chromosomal site for homologous recombination. For specific homologous recombination, the vector typically contains a sufficiently long region of homology with the sequence of the chromosome to allow complementary binding and integration of the vector into the chromosome. A longer region of complementarity and a greater degree of sequence similarity can increase the efficiency of homologous recombination.

[0052] Methods known in the art can be used to propagate polynucleotides according to the disclosure herein. Once a suitable host system and growth conditions are established, recombinant expression vectors can be propagated and prepared in large quantities. As described herein, expression vectors that can be used include, but are not limited to, the following vectors or derivatives thereof: human or animal viruses, such as vaccinia virus or adenovirus, insect viruses, such as baculovirus, yeast vectors, bacteriophage vectors (e.g., lambda), and plasmid and cosmid DNA vectors.

[0053] As used herein, "operably linked" means that a polynucleotide of interest, such as a polynucleotide encoding a Cas9 protein, is linked to a regulatory element to allow expression of the polynucleotide sequence. In some embodiments, the regulatory element is a promoter. In some embodiments, the polynucleotide of interest is operably linked to a promoter on an expression vector.

[0054] As used herein, "promoter", "promoter sequence" or "promoter region" refers to a DNA regulatory region / sequence that can bind RNA polymerase and is responsible for initiating transcription of downstream coding or non-coding sequences. In some examples of the present disclosure, the promoter sequence includes the transcription initiation site and extends upstream to include a minimum number of bases or elements used to initiate transcription at a level detectable above background. In some embodiments, the promoter sequence includes the transcription initiation site and a protein binding domain responsible for binding RNA polymerase. Eukaryotic promoters often, but not always, contain "TATA" and "CAT" boxes. Various promoters, including inducible promoters, can be used to drive the various vectors of the present disclosure.

[0055] A "vector" is any means of cloning and / or transferring a nucleic acid into a host cell. A vector can be a replicon to which another DNA segment can be attached resulting in replication of the attached segment. A "replicon" is any genetic element (e.g., plasmid, phage, cosmid, chromosome, virus) that functions as an autonomous unit of DNA replication in vivo, i.e., that can replicate under its own control. In some embodiments of the present disclosure, the vector is an episomal vector that is removed / disappeared from the population of cells after many cell generations, e.g., by asymmetric partitioning. The term "vector" includes both viral and non-viral means for introducing nucleic acid into cells in vitro, ex vivo, or in vivo. Many vectors known in the art can be used to manipulate nucleic acids, incorporate response elements and promoters into genes, etc. Possible vectors include, for example, bacteriophages such as lambda derivatives, or plasmids such as PBR322 or pUC plasmid derivatives, or plasmids or modified viruses, including bluescript vectors, etc. For example, insertion of a DNA fragment corresponding to a response element and promoter into a suitable vector can be accomplished by ligating the appropriate DNA fragment into a selection vector which has complementary cohesive termini. Alternatively, the ends of the DNA molecules can be enzymatically modified or any site can be produced by ligating nucleotide sequences (linkers) into the DNA termini. Such vectors can be modified to contain a selectable marker gene that provides for selection of cells which have integrated the marker into the cell genome. Such markers allow for the identification and / or selection of host cells which have integrated the marker and are expressing the protein encoded by the marker.

[0056] Viral vectors, particularly retroviral vectors, have been used in a wide range of gene delivery applications in cells and live animal subjects. Viral vectors that can be used include, but are not limited to, retrovirus, adeno-associated virus, pox, baculovirus, vaccinia, herpes simplex, Epstein-Barr, adenovirus, geminivirus and caulimovirus vectors. Non-viral vectors include, but are not limited to, plasmids, liposomes, charged lipids, DNA-protein complexes and biopolymers. In addition to the nucleic acid, the vector may also include one or more regulatory regions and / or selection markers that are useful in selecting, measuring and monitoring the results of nucleic acid transfer (tissues transferred, duration of expression, etc.).

[0057] The vector can be introduced into the desired host cell by known methods, including but not limited to transfection, transduction, cell fusion, and lipofection. The vector can include various regulatory elements, including promoters. In some embodiments, the vector design can be based on the constructs designed by Mali et al., "Cas9 as a versatile tool for engineering biology," Nature Methods 10:957-63 (2013). In some embodiments, the present disclosure provides an expression vector comprising any of the polynucleotides described herein, such as an expression vector comprising a polynucleotide encoding a Cas protein or variant thereof. In some embodiments, the present disclosure provides an expression vector comprising a polynucleotide encoding a Cas9 protein or variant thereof.

[0058] The term "plasmid" refers to an extrachromosomal element that often carries genes that are not part of the central metabolism of the cell and is usually in the form of a circular double-stranded DNA molecule. Such elements can be autonomously replicating sequences, genomic integrating sequences, phage or nucleotide sequences from any source, linear, circular or supercoiled, single-stranded or double-stranded DNA or RNA, in which a number of nucleotide sequences are joined or recombined into a unique construct that can introduce promoter fragments and DNA sequences for selected gene products into cells, along with appropriate 3' untranslated sequences.

[0059] As used herein, "transfection" refers to the introduction of an exogenous nucleic acid molecule, e.g., a vector, into a cell. A "transfected" cell includes an exogenous nucleic acid molecule inside the cell, and a "transformed" cell is a cell in which the exogenous nucleic acid molecule inside the cell induces a phenotypic change in the cell. The transfected nucleic acid molecule can be integrated into the genomic DNA of the host cell and / or can be maintained by the cell extrachromosomally, either transiently or for a long period of time. A host cell or organism that expresses an exogenous nucleic acid molecule or fragment is referred to as a "recombinant," "transformed," or "transgenic" organism. In some embodiments, the disclosure provides a host cell that includes any of the expression vectors described herein, e.g., an expression vector that includes a polynucleotide encoding a Cas protein or variant thereof. In some embodiments, the disclosure provides a host cell that includes an expression vector that includes a polynucleotide encoding a Cas9 protein or variant thereof.

[0060] The term "host cell" refers to a cell into which a recombinant expression vector has been introduced. The term "host cell" refers not only to the cell into which the expression vector has been introduced (the "parent" cell), but also to the progeny of such a cell. Because certain modifications may occur in subsequent generations, e.g., due to mutation or environmental influences, such progeny may not be identical to the parent cell, but are still included within the scope of the term "host cell."

[0061] The terms "peptide," "polypeptide," and "protein" are used interchangeably herein to refer to polymeric forms of amino acids of any length, including coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.

[0062] The starting point of a protein or polypeptide is the "N-terminus" (or amino terminus, NH 2 terminal, N-terminal or amine-terminal), which refers to the free amine (-NH 2 The end of a protein or polypeptide is known as the "C-terminus" (or carboxy-terminus, carboxyl-terminus, C-terminal or COOH-terminus), which refers to the free carboxyl group (-COOH) of the last amino acid residue of the protein or polypeptide.

[0063] As used herein, an "amino acid" refers to a group consisting of a carboxyl (-COOH) and an amino (-NH 2 (Amino acid) refers to compounds that contain both cyclic and non-cyclic cyclic groups. "Amino acid" refers to both natural and non-natural (i.e., synthetic) amino acids. Natural amino acids with three-letter and one-letter abbreviations include alanine (Ala; A); arginine (Arg, R); asparagine (Asn; N); aspartic acid (Asp; D); cysteine ​​(Cys; C); glutamine (Gln; Q); glutamic acid (Glu; E); glycine (Gly; G); histidine (His; H); isoleucine (Ile; I); leucine (Leu; L); lysine (Lys; K); methionine (Met; M); phenylalanine (Phe; F); proline (Pro; P); serine (Ser; S); threonine (Thr; T); tryptophan (Trp; W); tyrosine (Tyr; Y); and valine (Val; V).

[0064] "Amino acid substitution" refers to a polypeptide or protein that contains one or more substitutions of a wild-type or naturally occurring amino acid at that amino acid residue with an amino acid that is different to that wild-type or naturally occurring amino acid. The substituted amino acid may be a synthetic or naturally occurring amino acid. In some embodiments, the substituted amino acid is a naturally occurring amino acid selected from the group consisting of A, R, N, D, C, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y, and V. Substitution mutations may be described using an abbreviation system. For example, a substitution mutation in which the fifth amino acid residue has been substituted may be abbreviated as "X5Y," where "X" is the wild-type or naturally occurring amino acid that is replaced, "5" is the amino acid residue position within the amino acid sequence of the protein or polypeptide, and "Y" is the substituted, or non-wild-type, or non-naturally occurring amino acid.

[0065] An "isolated" polypeptide, protein, peptide, or nucleic acid is a molecule that has been removed from its natural environment. It should also be understood that an "isolated" polypeptide, protein, peptide, or nucleic acid can be formulated with an excipient, such as a diluent or auxiliary, and still be considered isolated.

[0066] The term "recombinant" when used in reference to a nucleic acid molecule, peptide, polypeptide, or protein, means those that are or result from a new combination of genetic material not known to exist in nature. Recombinant molecules can be produced by any of the well-known techniques available in the field of recombinant technology, including, but not limited to, polymerase chain reaction (PCR), gene splicing (e.g., using restriction endonucleases), and solid phase synthesis of nucleic acid molecules, peptides, or proteins.

[0067] The term "domain" when used in reference to a polypeptide or protein refers to a distinct functional and / or structural unit in a protein. A domain may be responsible for a specific function or interaction that contributes to the overall role of the protein. Domains may exist in a variety of biological contexts. Similar domains can be found in proteins with different functions. Alternatively, domains with low sequence identity (i.e., less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 10%, less than about 5%, or less than about 1% sequence identity) may have the same function. In some embodiments, the Cas9 domain is a RuvC domain. In some embodiments, the Cas9 domain is a HNH domain. In some embodiments, the Cas9 domain is a Rec domain.

[0068] When used in reference to a polypeptide or protein, the term "motif" generally refers to conserved amino acid residues, typically less than 20 amino acids in length, that may be important for the function of the protein. Certain sequence motifs can mediate common functions in various proteins, such as binding or targeting of proteins to specific subcellular locations. Examples of motifs include, but are not limited to, nuclear localization signals, microbody targeting motifs, motifs that prevent or promote secretion, and motifs that promote protein recognition and binding. Motif databases and / or motif search tools are known to those of skill in the art, and include, for example, PROSITE (expasy.ch / sprot / prosite.html), Pfam (pfam.wustl.edu), PRINTS (biochem.ucl.ac.uk / bsm / dbbrowser / PRINTS / PRINTS.html), and Minimotif Miner (cse-mnm.engr.uconn.edu:8080 / MNM / SMSSearchServlet).

[0069] As used herein, a "modified" protein refers to a protein that contains one or more modifications to achieve a desired property in the protein. Exemplary modifications include, but are not limited to, insertions, deletions, substitutions, or fusions with another domain or protein. Modified proteins of the present disclosure include modified Cas9 proteins.

[0070] In some embodiments, the engineered protein is generated from a wild-type protein. As used herein, a "wild-type" protein or nucleic acid is a naturally occurring, unmodified protein or nucleic acid. For example, a wild-type Cas9 protein can be isolated from the organism Streptococcus pyogenes and can include the amino acid sequence of SEQ ID NO:1. Wild-type is contrasted with a "mutant," which includes one or more modifications in the amino acid and / or nucleotide sequence of the protein or nucleic acid. For example, a mutant of S. pyogenes Cas9 can include the amino acid sequence of SEQ ID NO:2, which has a single amino acid substitution compared to wild-type S. pyogenes Cas9 (SEQ ID NO:1).

[0071] The term "degrade" or "degradation", when used in reference to a polypeptide or protein, generally refers to the breakdown of a protein into smaller peptide fragments or individual amino acids, through a process commonly referred to as proteolysis. Intracellular degradation of proteins can be achieved in either lysosomes or proteasomes. Lysosomal degradation is typically a non-selective process, except for pathways such as the selective chaperone-mediated autophagy pathway described herein. During lysosomal degradation, cytosolic proteins are endocytosed into lysosomes for degradation. Proteasomal degradation is typically selective, with proteins targeted for degradation being tagged with ubiquitin. For an overview of the proteasome protein degradation pathway, see, e.g., Ciechanover, Cell 79(1):13-21 (1994); Hasselgren et al., Ann Surg 225(3):307-316 (1997); Collins et al., Cell 169(5):792-806 (2017). In general, the rate of degradation of a protein is related to its function in the cell and its biochemical characteristics. For example, proteins containing proline, glutamic acid, serine and threonine-rich segments (sometimes referred to as PEST proteins) have a short half-life (see, e.g., Voet & Voet, Biochemistry 2nd ed. John Wiley & Sons, pp. 1010-1014 (1995), which is incorporated by reference in its entirety). Other factors that influence the rate of protein degradation include the deamination rate of glutamine and asparagine, the oxidation rate of cysteine, histidine and methionine, the lack of stabilizing ligands, the presence of attached carbohydrate or phosphate groups, the presence of free alpha-amino groups, the charge of the protein, and the flexibility and stability of the protein (see, e.g., Creighton "Chapter 10-Degradation" in Proteins: Structures and Molecular Properties 2nd ed. WH Freeman and Company, pp. 463-473 (1993), which is incorporated by reference in its entirety).Methods for measuring protein degradation rates include, for example, pulse-chase of amino acid isotopes (e.g., stable isotope labeling with amino acids in cell culture or SILAC), post-synthetic radioisotope labeling, or reporter-dependent approaches such as global protein stability profiling (GPSP) using, for example, GFP as a reporter protein (see, for example, Yewdell et al., Cell Biol Int 35(5):457-462(2011)). Another method for measuring protein degradation rates is by quantifying the amount of protein in cells at different time points, for example, using densitometric analysis of immunoblots, plotting protein levels over time, and determining the degradation rate from the protein level vs. time plot. The method for determining protein degradation rates can be selected by one skilled in the art.

[0072] The term "sequence similarity" or "% similarity" as used herein refers to the degree of identity or correspondence between nucleic acid or amino acid sequences. As used herein, "sequence similarity" refers to nucleic acid sequences in which changes in one or more nucleotide bases result in the substitution of one or more amino acids, but do not affect the functional properties of the protein encoded by the DNA sequence. "Sequence similarity" also refers to modifications of nucleic acids that do not substantially affect the functional properties of the resulting transcript, such as the deletion or insertion of one or more nucleotide bases. Thus, it is understood that the present disclosure encompasses more than the specific exemplary sequences. Methods for making substitutions of nucleotide bases are known, as are methods for determining retention of biological activity of the encoded product.

[0073] Moreover, those skilled in the art will recognize that similar sequences encompassed by the present disclosure are also defined by their ability to hybridize under stringent conditions with the sequences exemplified herein. Similar nucleic acid sequences of the present disclosure are nucleic acids whose DNA sequences are at least 70%, at least 80%, at least 90%, at least 95% or at least 99% identical to the DNA sequences of the nucleic acids disclosed herein. Similar nucleic acid sequences of the present disclosure are nucleic acids whose DNA sequences are about 70%, at least about 70%, about 75%, at least about 75%, about 80%, at least about 80%, about 85%, at least about 85%, about 90%, at least about 90%, about 95%, at least about 95%, about 99%, at least about 99% or about 100% identical to the DNA sequences of the nucleic acids disclosed herein.

[0074] As used herein, "sequence similarity" refers to two or more amino acid sequences in which more than about 40% of the amino acids are identical or in which more than about 60% of the amino acids are functionally identical. Functionally identical or functionally similar amino acids have chemically similar side chains. For example, amino acids can be grouped according to functional similarity as follows: Positively charged side chains: Arg, His, Lys; Negatively charged side chains: Asp, Glu; Polar uncharged side chains: Ser, Thr, Asn, Gln; Hydrophobic side chains: Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp; Others: Cys, Gly, Pro.

[0075] In some embodiments, similar amino acid sequences of the present disclosure have amino acids that are at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 99% identical.

[0076] In some embodiments, similar amino acid sequences of the disclosure have amino acids that are at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% functionally identical. In some embodiments, similar amino acid sequences of the disclosure have amino acids that are about 40%, at least about 40%, at least about 45%, at least about 45%, about 50%, at least about 50%, at least about 55%, at least about 55%, about 60%, at least about 60%, about 65%, at least about 65%, about 70%, at least about 70%, about 75%, at least about 75%, about 80%, at least about 80%, about 85%, at least about 85%, about 90%, at least about 90%, about 95%, at least about 95%, about 97%, at least about 97%, about 98%, at least about 98%, about 99%, at least about 99%, or about 100% identical.

[0077] In some embodiments, a similar amino acid sequence of the disclosure has amino acids that are about 60%, at least about 60%, about 65%, at least about 65%, about 70%, at least about 70%, about 75%, at least about 75%, about 80%, at least about 80%, about 85%, at least about 85%, about 90%, at least about 90%, about 95%, at least about 95%, about 97%, at least about 97%, about 98%, at least about 98%, about 99%, at least about 99%, or about 100% functionally identical.

[0078] As used herein, the term "same protein" refers to a protein having a substantially similar structure or amino acid sequence to the reference protein, performing the same biochemical function as the reference protein, and may include a protein that differs from the reference protein by substitution or deletion of one or more amino acids at one or more sites in the amino acid sequence, i.e., deletion of at least about 60%, at least about 60%, at least about 65%, at least about 65%, about 70%, at least about 70%, at least about 75%, at least about 75%, about 80%, at least about 80%, about 85%, at least about 85%, about 90%, at least about 90%, about 95%, at least about 95%, about 97%, at least about 97%, about 98%, at least about 98%, about 99%, at least about 99% or about 100% identical amino acids. In one aspect, "same protein" refers to a protein with an amino acid sequence identical to the reference protein.

[0079] Sequence similarity can be determined by sequence alignment using routine methods in the art, such as BLAST, MUSCLE, Clustal (e.g., ClustalW and ClustalX), and T-Coffee (including variants such as M-Coffee, R-Coffee, and Expresso).

[0080] The term "sequence identity" or "% identity" with respect to nucleic acid or amino acid sequences refers to the percentage of residues in the compared sequences that are identical when the sequences are aligned over a defined comparison window. In some embodiments, only certain portions of two or more sequences are aligned to determine sequence identity. In some embodiments, only certain domains of two or more sequences are aligned to determine sequence similarity. The comparison window can be a segment of at least 10 to more than 1000 residues, at least 20 to about 1000 residues, or at least 50 to 500 residues over which sequences can be aligned and compared. Methods of alignment for determining sequence identity are well known and can be performed using publicly available databases, such as BLAST. "Percent identity" or "% identity" when referring to amino acid sequences can be determined by methods known in the art. For example, in some embodiments, the "percent identity" of two amino acid sequences is determined using the algorithm of Karlin and Altschul, Proc Nat Acad Sci USA 87:2264-2268 (1990), modified as in Karlin and Altschul, Proc Nat Acad Sci USA 90:5873-5877 (1993). Such algorithms are incorporated into BLAST programs, such as the BLAST+ or NBLAST and XBLAST programs described in Altschul et al., Journal of Molecular Biology, 215:403-410 (1990). BLAST protein searches can be performed using a program, such as the XBLAST program, score=50, wordlength=3, to obtain amino acid sequences that are homologous to the protein molecules of the present disclosure. When gaps exist between the two sequences, Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Research 25(17):3389-3402 (1997). When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.

[0081] In some embodiments, a polypeptide or nucleic acid molecule has 70%, at least 70%, 75%, at least 75%, 80%, at least 80%, 85%, at least 85%, 90%, at least 90%, 95%, at least 95%, 97%, at least 97%, 98%, at least 98%, 99% or at least 99% or 100% sequence identity to a reference polypeptide or nucleic acid molecule, respectively (or a fragment of a reference polypeptide or nucleic acid molecule). In some embodiments, a polypeptide or nucleic acid molecule has about 70%, at least about 70%, about 75%, at least about 75%, about 80%, at least about 80%, about 85%, at least about 85%, about 90%, at least about 90%, about 95%, at least about 95%, about 97%, at least about 97%, about 98%, at least about 98%, about 99%, at least about 99%, or about 100% sequence identity to a reference polypeptide or nucleic acid molecule, respectively (or a fragment of the reference polypeptide or nucleic acid molecule).

[0082] Overview of CRISPR-Cas systems CRISPR-associated protein 9 (Cas9) is an RNA-guided endonuclease of the type II CRISPR adaptive immune system found in bacteria, including but not limited to Streptococcus pyogenes, Streptococcus thermophilus, Staphylococcus aureus, and Neisseria meningitidis, among others. For an overview of the CRISPR-Cas9 system, see, e.g., Sander et al., Nature Biotechnology 32:347-355 (2014). In general, CRISPR or CRISPR-Cas systems are characterized by elements that facilitate the formation of a CRISPR complex at the site of a target sequence, such as a guide polynucleotide and a Cas9 endonuclease (interchangeably referred to herein as a "Cas9 protein" or "Cas9 nuclease"). In the naturally occurring CRISPR-Cas system, foreign DNA is integrated into the CRISPR array, which then produces a crRNA (CRISPR-RNA) that has a "protospacer" region that is complementary to the foreign DNA site. The crRNA hybridizes to the tracrRNA (also encoded by the CRISPR system), and this pair of RNAs associates with the Cas9 nuclease. The crRNA / tracrRNA / Cas9 complex recognizes and cleaves the foreign DNA that has the protospacer sequence.

[0083] In some embodiments, the present disclosure provides a modified CRISPR-Cas system. In some embodiments, the modified CRISPR-Cas system comprises a modified Cas9 protein, and the modified Cas9 protein comprises one or more modifications to wild-type Cas9. In some embodiments, the modified Cas9 protein comprises one or more motifs that are not present in wild-type Cas9. The one or more motifs that are introduced into wild-type Cas9 may be referred to as "modified" motifs. In some embodiments, the one or more modified motifs in the Cas9 protein are chaperone-mediated autophagy (CMA) motifs.

[0084] In some embodiments, the modified CRISPR-Cas system comprises a modified guide polynucleotide, which comprises one or more modifications to the wild-type crRNA and / or tracrRNA. In some embodiments, the modified CRISPR-Cas system uses a fusion between the crRNA and a portion of the tracrRNA sequence, i.e., a single guide polynucleotide. Thus, in this case, a complex is formed between Cas9 and a single guide polynucleotide. The single guide polynucleotide forms a complex with Cas9 to mediate cleavage of a target sequence that is complementary to the first (5') 20 nucleotides of the guide polynucleotide (i.e., the guide sequence portion of the guide polynucleotide) and adjacent to the protospacer adjacent motif (PAM) sequence. In other embodiments, the modified CRISPR-Cas system comprises a separate polynucleotide that comprises the tracrRNA sequence, i.e., the tracrRNA is not a portion of the guide polynucleotide that comprises the guide sequence. In this case, a complex is formed between Cas9, the guide polynucleotide, and the tracrRNA. In some embodiments, the tracrRNA component of the guide polynucleotide activates the Cas9 protein. In some embodiments, activation of the Cas9 protein activates or increases the nuclease activity of Cas9. In some embodiments, the Cas9 protein is not active until it forms a complex with crRNA and tracrRNA.

[0085] Cas9 endonuclease generates a double-stranded DNA break upstream of the protospacer adjacent motif (PAM) of the target sequence. Repair of the double-stranded break can result in an insertion or deletion at the double-stranded break site. In some embodiments, the sequence of interest is inserted into the target sequence using the cell's endogenous DNA repair pathway. Endogenous DNA repair pathways include the non-homologous end joining (NHEJ) pathway, the microhomology-mediated end joining (MMEJ) pathway, and the homology-directed repair (HDR) pathway. NHEJ, MMEJ, and HDR pathways repair double-stranded DNA breaks. In NHEJ, a homologous template is not required to repair the break in DNA. NHEJ repair can be error-prone, but errors are reduced when the DNA break contains a compatible overhang. NHEJ and MMEJ are DNA repair pathways that are mechanistically distinct due to the different subsets of DNA repair enzymes involved in each of them. Unlike NHEJ, which can be sometimes accurate and sometimes error-prone, MMEJ is always error-prone and results in both deletions and insertions at the site being repaired. MMEJ-associated deletions result from microhomology (2-10 base pairs) on both sides of the double-stranded break. In contrast, HDR requires a homologous template to direct the repair, but HDR repair is typically high fidelity and low error-prone. In some embodiments, the error-prone nature of NHEJ and MMEJ repair is exploited to introduce non-specific nucleotide substitutions in the target sequence.

[0086] As described herein, some CRISPR-Cas systems may have undesired off-target activity or off-target genome editing. "Off-target" as used in the context of genome editing refers to non-specific and unintended genetic modification, as opposed to "on-target", which refers to modification at a locus of interest. Off-target modifications may occur, for example, when the Cas9 nuclease does not bind at its intended target sequence (i.e., the genomic sequence complementary to the guide sequence on the guide polynucleotide), which may occur due to homologous sequences and / or mismatch tolerance. Off-target modifications include, but are not limited to, unintended point mutations, deletions, insertions, inversions, and translocations. In some embodiments, the modified Cas9 proteins of the present disclosure have reduced off-target activity compared to wild-type Cas9 proteins. In some embodiments, the modified Cas9 proteins of the present disclosure have at least about 50% reduced off-target activity compared to wild-type Cas9 proteins. In some embodiments, the modified Cas9 proteins of the present disclosure have at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 100% reduced off-target activity compared to wild-type Cas9. Off-target modifications can be detected using, for example, targeted sequencing, exome sequencing, whole genome sequencing, BLESS (direct in situ cleavage labeling, enrichment on streptavidin and next generation sequencing), GUIDE-seq (genome-wide unbiased identification of DSBs assessed by sequencing), LAM-HTGTS (linear amplification mediated high throughput genome-wide translocation sequencing), and Digenome-seq in vitro Cas9 digest whole genome sequencing). Methods for detecting and quantifying off-target modifications are described, for example, in Zhang et al., Mol Ther Nucleic Acids 4:e264(2014); and Zischewski et al., Biotechnol Adv 35:95-104(2017).

[0087] Cas9 protein In some embodiments, the Cas9 protein is derived from the following species: Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus dysgalactiae, Streptococcus mutans, Listeria innocua, Staphylococcus aureus, or Klebisella pneumoniae. In some embodiments, the term Cas9 refers to a polypeptide that includes the amino acid sequence of the Streptococcus pyogenes Cas9 protein (SEQ ID NO: 1). In some embodiments, the term Cas9 refers to a polypeptide that includes the amino acid sequence of the Streptococcus thermophilus Cas9 protein (SEQ ID NO: 17). In some embodiments, the term Cas9 refers to a polypeptide that includes the amino acid sequence of the Streptococcus dysgalactiae Cas9 protein (SEQ ID NO: 18). In some embodiments, the term Cas9 refers to a polypeptide that includes the amino acid sequence of the Streptococcus mutans Cas9 protein (SEQ ID NO: 19). In some embodiments, the term Cas9 refers to a polypeptide that includes the amino acid sequence of the Listeria innocua Cas9 protein (SEQ ID NO: 20). In some embodiments, the term Cas9 refers to a polypeptide that includes the amino acid sequence of the Staphylococcus aureus Cas9 protein (SEQ ID NO: 21). In some embodiments, the term Cas9 refers to a polypeptide comprising the amino acid sequence of the Klebisella pneumoniae Cas9 protein (SEQ ID NO:22).

[0088] In some embodiments, the term Cas9 refers to a polypeptide comprising SEQ ID NO: 1. In some embodiments, the Cas9 protein is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identical to the amino acid sequence of SEQ ID NO: 1. In some embodiments, the Cas9 protein is a polypeptide encoded by a polynucleotide sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to SEQ ID NO:3.

[0089] In some embodiments, the term Cas9 refers to a Cas9 capable of generating sticky ends. As used herein, the terms "sticky end", "staggered end" or "sticky end" refer to a nucleic acid fragment with strands of unequal length. In contrast to "blunt ends", sticky ends are produced by staggered cuts on nucleic acids, typically DNA. A cohesive or sticky end has a protruding single-stranded strand with unpaired nucleotides or "overhangs", e.g., a 3' or 5' overhang. Each overhang can anneal to another complementary overhang to form base pairs. Two complementary sticky ends can anneal together through interactions, e.g., hydrogen bonds. The stability of the annealed sticky ends depends on the melting temperature of the paired overhangs. Two complementary sticky ends can be joined together by chemical or enzymatic ligation, e.g., by DNA ligase.

[0090] In some embodiments, the term Cas9 refers to a Cas9 mutant with altered function, such as, for example, a Cas9 hybrid protein. For example, a Cas9 protein with a binding domain or an inactive DNA cleavage domain of Cas9 can be used as a binding domain to specifically bind to a desired target sequence via a guide polynucleotide. The binding domain (i.e., inactive Cas9) can be fused or conjugated to a cleavage domain, such as the cleavage domain of the endonuclease FokI, to generate an engineered hybrid nuclease. Cas9-FokI hybrid proteins are further described, for example, in US Patent Publication No. 2015 / 0071899 and Guilinger et al., Nature Biotechnology 32:577-582 (2014). Other examples of engineered hybrid nucleases are described, for example, in Wah et al., Proc Nat Acad Sci 95:10564-10569 (1996); Li et al., Nucl Acids Res 39(1):359-372 (2011); and Kim et al., Proc Nat Acad Sci 93:1156-1160 (1996).

[0091] Cpf1 (centromere and promoter factor 1) is also an RNA-guided nuclease in type II CRISPR systems. Cpf1 generates sticky ends. The CRISPR / Cpf1 system is similar to the CRISPR / Cas9 system. However, there are some differences between Cas9 and Cpf1. Unlike Cas9, Cpf1 does not utilize tracrRNA. The Cpf1 protein recognizes a different PAM sequence than Cas9, and Cpf1 cleaves at a different site than Cas9. Cas9 cleaves at a sequence adjacent to the PAM, while Cpf1 cleaves at a sequence further away from the PAM. Cpf1 protein is further described in, for example, foreign patent publications GB 1506509.7, U.S. Patent No. 9,580,701, U.S. Patent Application Publication No. 2016 / 0208243, and Zetsche et al., Cell 163(3):759-771 (2015). Enzymes functionally similar to Cpf1 can be used according to the present disclosure. Thus, in some embodiments, the present disclosure provides recombinant Cpf1 proteins comprising the amino acid modifications described herein.

[0092] Some wild-type or naturally occurring Cas9 proteins, such as the Cas9 protein from S. pyogenes, have six domains: Rec1, Rec2, Bridge Helix (BH), PAM interaction (PI), HNH, and RuvC. The Rec1 domain is responsible for binding the guide polynucleotide. The BH domain is responsible for initiating cleavage activity upon binding of the target sequence. The PI domain confers PAM specificity and is responsible for initiating binding to the target sequence. The HNH and RuvC domains are nuclease domains that cleave DNA. Structural studies of the Cas9 protein revealed that the protein has a recognition lobe ("REC lobe") that contains the BH, Rec1, and Rec2 domains, and a nuclease lobe ("NUC lobe") that contains the RuvC (divided into RuvC I, RuvC II, and RuvC III subdomains), HNH, and PI domains. See Figures 3 and 4. Protein domains can be identified based on the amino acid sequence of a protein using domain structure prediction tools such as SMART (Letunic et al., Nucleic Acids Research (2017), doi:10.1093 / nar / gkx922), PANDA (Wang et al., Scientific Reports 8:3484 (2018)) or InterPro (Finn et al., Nucleic Acids Research (2017), doi:10.1093 / nar / gkw1107). Protein domains can also be identified based on protein structure, for example by visual inspection or using algorithms such as PUU (Holm et al., Proteins 19(3):256-268(1994)), RigidFinder (Abyzov et al., Proteins 78(2):309-324(2010)) or PiSQRD (Aleksiev et al., Bioinformatics 25(20):2743-2744(2009)).Identification of Cas9 domains based on structural characterization is described, for example, in Jinek et al., Science 337:816-821 (2012); Nishimasu et al., Cell 156(5):935-949 (2014); Anders et al., Nature 513:569-573 (2014); and Sternberg et al., Nature 507(7490):62-67 (2014).

[0093] In some embodiments, a Cas9 protein of the disclosure comprises a REC lobe having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 5. In some embodiments, a Cas9 protein of the disclosure comprises a NUC lobe having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 6-7.

[0094] In some embodiments, a Cas9 protein of the disclosure comprises a BH domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 8. In some embodiments, a Cas9 protein of the disclosure comprises a Rec1 domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 9-10. In some embodiments, a Cas9 protein of the disclosure comprises a Rec2 domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 11. In some embodiments, a Cas9 protein of the disclosure comprises a RuvC domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 12-14. In some embodiments, a Cas9 protein of the disclosure comprises an HNH domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 15. In some embodiments, a Cas9 protein of the disclosure comprises a PI domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 16.

[0095] Structural studies of the Cas9 protein, e.g., crystal structures, can reveal regions of the protein that are surface-exposed. As used herein, a "surface-exposed region" refers to a region of the protein that is accessible to the surrounding environment, i.e., a region on the outer "surface" of the protein. Similarly, a "surface-exposed residue" includes amino acid residues of the protein that are within a surface-exposed region. Surface-exposed residues are contrasted with "buried" residues that face inward toward the center of the protein and form "buried regions" that are inaccessible to the surrounding environment. Surface-exposed residues on a protein can play an important role in interactions with other molecules, e.g., other proteins or cellular tissues. Thus, in some embodiments, certain residues on a protein, e.g., a Cas9 protein, are surface-exposed in one conformational state but not surface-exposed in a different conformational state. For example, the Cas9 protein may undergo a conformational change upon binding to a guide RNA such that previously unexposed regions in the Cas9 protein become surface exposed upon guide RNA binding, or vice versa (see, e.g., Fagerlund et al., Proc Nat Acad Sci 114(26):E5211-E5128 (2017)).

[0096] Surface exposed residues can also be used to determine the physical properties of a protein and to force the folding of a protein. Surface exposed residues can be determined, for example, by viewing a protein crystal structure in a program such as PyMOL (pymol.org) or Swiss PDB Viewer (spdbv.vital-it.ch). Surface exposed residues can also be calculated computationally, for example, using a program such as NACCESS (bioinf.manchester.ac.uk / naccess). Surface exposed residues of a protein can also be determined by computational prediction, for example, when a crystal structure is not available. Computer prediction tools for surface-exposed residues in protein sequences include, for example, SARpred (Garg et al., Proteins 61:318-24(2005)), PSA / TEM from the JOY Package (Mizuguchi et al., Bioinformatics 14:617-623(1998)), and RSARF (caps.ncbs.res.in / download / pugal / RSARF).

[0097] Overview of chaperone-mediated autophagy "Chaperone-mediated autophagy" or CMA refers to a selective proteolytic process that involves chaperone-dependent selection of cytosolic proteins, followed by targeting of the proteins to lysosomes for degradation and translocation of them across the lysosomal membrane. An exemplary chaperone protein for CMA is heat shock cognate protein of 70 kD or HSC70. "Endosomal microautophagy" or eMI refers to a similar proteolytic process as CMA, except that eMI selectively targets proteins containing KFERQ or KFERQ-like motifs to late endosomes for degradation instead of lysosomes. Like CMA, HSC70 is also a chaperone protein for eMI. See, e.g., Kaushik et al., Trends Cell Biol 22(8):407-417(2012); Tekirdag et al., J Biol Chem 293:5414-5424(2018); and Pereira et al., Int J Cell Biol 2012(4):931956(2012).

[0098] A "KFERQ motif" as referred to herein is the pentapeptide sequence: Lys-Phe-Glu-Arg-Gln (SEQ ID NO: 24). A "KFERQ-like motif" as referred to herein is a motif that is biochemically similar or biochemically related to KFERQ. A biochemically similar or biochemically related motif may include functionally equivalent amino acid residues as discussed herein. Thus, a KFERQ motif may be any pentapeptide with the following parameters: one or two positively charged residues (e.g., Lys or Arg); one or two bulky hydrophobic residues (e.g., Phe, Ile, Leu, or Val); a negatively charged residue (e.g., Asp or Glu); and Gln or Asn flanking either side of the pentapeptide. See, e.g., Dice et al., Trends Biochem Sci 15(8):305-309 (1990); and Kaushik et al., Trends Cell Biol 22(8):407-417 (2012). Examples of KFERQ-like motifs include, but are not limited to, those listed in Table 1.

[0099] [Table 1]

[0100] Proteins that contain at least one KFERQ motif or KFERQ-like motif can be recognized by components of CMA or eMI. Thus, in some embodiments, the KFERQ motif or KFERQ-like motif is a chaperone-mediated autophagy (CMA) targeting motif. In some embodiments, the KFERQ motif or KFERQ-like motif is an endosomal microautophagy (eMI) targeting motif. Without being bound by any particular theory, CMA and eMI are described herein for purposes of illustrating the present disclosure, with the understanding that the KFERQ motif or KFERQ-like motif can function as a target for other protein degradation pathways, and that other consensus sequences or motifs (other than the KFERQ motif or KFERQ-like motif described herein) are CMA or eMI targeting motifs.

[0101] HSC70 recognizes and binds to CMA or eMI target motifs, such as KFERQ or KFERQ-like motifs, on proteins to form chaperone-protein complexes. The chaperone-protein complexes then bind to the lysosomal-associated membrane protein type 2A (LAMP-2A) receptor. The proteins unfold and trigger the multimerization of LAMP-2A. The unfolded proteins are then translocated across the lysosomal membrane via LAMP-2A, and finally the translocated proteins are degraded. See, e.g., Kaushik et al., Trends Cell Biol 22(8):407-417(2012).

[0102] Recombinant Cas9 protein The recombinant Cas9 protein of the present disclosure is a functional Cas9 nuclease and has reduced off-target modifications compared to wild-type Cas9. By "functional Cas9 nuclease" is meant that the recombinant Cas9 protein has at least about the same level of nuclease activity as the wild-type Cas9 protein, as measured by Cas9 activity assay. By "functional Cas9 nuclease" is also meant that the recombinant Cas9 has about the same level of on-target modifications (i.e. genome editing efficiency) as the wild-type Cas9 protein, as measured by Cas9 efficiency assay.

[0103] In some embodiments, a recombinant Cas9 protein of the disclosure has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% of the nuclease activity of a wild-type Cas9 protein, as measured by a Cas9 activity assay. In some embodiments, a recombinant Cas9 protein of the disclosure has a higher nuclease activity than a wild-type Cas9 protein, as measured by a Cas9 activity assay. Non-limiting examples of Cas9 activity assays include the T7 endonuclease I assay and the SURVEYOR assay (reviewed in Vouillot et al., G3(Bethesda)5(3):407-415 (2015)). In some embodiments, a recombinant Cas9 protein of the disclosure has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% of the on-target modifications of a wild-type Cas9 protein, as measured by a Cas9 efficiency assay. In some embodiments, a recombinant Cas9 protein of the disclosure has a higher on-target modification than a wild-type Cas9 protein, as measured by a Cas9 efficiency assay. Non-limiting examples of Cas9 efficiency assays include mismatch detection assays and sequencing-based assays (reviewed in Zischewski et al., Biotechnol Adv 35:95-104 (2017)).

[0104] In some embodiments, the disclosure provides recombinant Cas9 proteins comprising a modified KFERQ motif or a KFERQ-like motif.

[0105] As described herein, the KFERQ motif or KFERQ-like motif is recognized by a component of the CMA or eMI. Thus, in some embodiments, a Cas9 protein comprising a modified KFERQ motif or KFERQ-like motif is recognized by a component of the CMA or eMI. In some embodiments, the KFERQ motif or KFERQ-like motif is any one of SEQ ID NOs: 24-41. Thus, in some embodiments, the KFERQ motif or KFERQ-like motif is KFERQ (SEQ ID NO:24), RKVEQ (SEQ ID NO:25), QDLKF (SEQ ID NO:26), QRFFE (SEQ ID NO:27), NRVVD (SEQ ID NO:28), QRDKV (SEQ ID NO:29), QKILD (SEQ ID NO:30), QKKEL (SEQ ID NO:31), QFREL (SEQ ID NO:32), IKLDQ (SEQ ID NO:33), DVVRQ (SEQ ID NO:34), QRIVE (SEQ ID NO:35), VKELQ (SEQ ID NO:36), QKVFD (SEQ ID NO:37), QELLR (SEQ ID NO:38), VDKLN (SEQ ID NO:39), RIKEN (SEQ ID NO:40) or NKKFE (SEQ ID NO:41). In some embodiments, the modified KFERQ motif or KFERQ-like motif is VDKLN (SEQ ID NO:39).

[0106] In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence KFERQ (SEQ ID NO:24). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence RKVEQ (SEQ ID NO:25). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QDLKF (SEQ ID NO:26). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QRFFE (SEQ ID NO:27). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence NRVVD (SEQ ID NO:28). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QRDKV (SEQ ID NO:29).

[0107] In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QKILD (SEQ ID NO:30). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QKKEL (SEQ ID NO:31). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QFREL (SEQ ID NO:32). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence IKLDQ (SEQ ID NO:33). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence DVVRQ (SEQ ID NO:34). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QRIVE (SEQ ID NO:35). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence VKELQ (SEQ ID NO:36).

[0108] In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QKVFD (SEQ ID NO: 37). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence QELLR (SEQ ID NO: 38). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence VDKLN (SEQ ID NO: 39). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence RIKEN (SEQ ID NO: 40). In some embodiments, the recombinant Cas9 protein comprises a modified KFERQ motif or a KFERQ-like motif having the amino acid sequence NKKFE (SEQ ID NO: 41).

[0109] In some embodiments, the modified KFERQ motif or KFERQ-like motif is prior to the first amino acid residue of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at amino acid residues 1-100 of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at amino acid residues 100-300 of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at amino acid residues 300-700 of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at amino acid residues 700-900 of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at amino acid residues 900-1100 of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is at amino acid residues 1100-1300 of SEQ ID NO:1. In some embodiments, the modified KFERQ motif or KFERQ-like motif is after the last amino acid residue of SEQ ID NO:1.

[0110] In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the REC lobe of the Cas9 protein. In some embodiments, the REC lobe of the Cas9 protein comprises a BH domain, a Rec1 domain, and a Rec2 domain. In some embodiments, the REC lobe has the amino acid sequence of SEQ ID NO:5. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the Rec1 domain of the REC lobe. In some embodiments, the Rec1 domain has the amino acid sequence of SEQ ID NO:9-10. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the Rec2 domain of the REC lobe. In some embodiments, the Rec2 domain has the amino acid sequence of SEQ ID NO:11. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the BH domain of the REC lobe. In some embodiments, the BH domain has the amino acid sequence of SEQ ID NO:8.

[0111] In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the NUC lobe of the Cas9 protein. In some embodiments, the NUC lobe of the Cas9 protein comprises a RuvC domain, an HNH domain, and a PI domain. In some embodiments, the NUC lobe has an amino acid sequence of SEQ ID NO: 6-7. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the RuvC domain, the HNH domain, or the PI domain of the Cas9 protein. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the RuvC domain. In some embodiments, the RuvC domain has an amino acid sequence of SEQ ID NO: 12-14. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the HNH domain. In some embodiments, the HNH domain has an amino acid sequence of SEQ ID NO: 15. In some embodiments, the modified KFERQ motif or KFERQ-like motif is in the PI domain. In some embodiments, the PI domain has an amino acid sequence of SEQ ID NO: 16.

[0112] In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a lobe having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 5. In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a lobe having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 6-7.

[0113] In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a BH domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 8. In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a Rec1 domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 9-10. In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a Rec2 domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO:11.

[0114] In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a RuvC domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 12-14. In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises an HNH domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO: 15. In some embodiments, a Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif comprises a PI domain having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identity to the amino acid sequence of SEQ ID NO:16.

[0115] In some embodiments, the modified KFERQ motif or KFERQ-like motif is in a surface-exposed region of a recombinant Cas9 protein. As described herein, a surface-exposed region refers to a region of a Cas9 protein that is accessible to the surrounding environment, e.g., to components of a proteolytic pathway. In some embodiments, the surface-exposed region of a recombinant Cas9 protein is in the REC lobe of the Cas9 protein. In some embodiments, the surface-exposed region of a recombinant Cas9 protein is in the NUC lobe of the Cas9 protein. In some embodiments, the surface-exposed region of a recombinant Cas9 protein is in the Rec1 domain, Rec2 domain, BH domain, RuvC domain, HNH domain, or PI domain of the Cas9 protein. In some embodiments, the surface-exposed region of a recombinant Cas9 protein is between amino acid residues 150 and 250 of the Cas9 protein.

[0116] In some embodiments, the modified KFERQ motif or KFERQ-like motif is at the N-terminus or C-terminus of the recombinant Cas9 protein. As described herein, the N-terminus is the "start" of a protein or polypeptide, and the C-terminus is the "end" of a protein or polypeptide. Thus, in some embodiments, the KFERQ motif or KFERQ-like motif is at the N-terminus "start" of the Cas9 protein. In some embodiments, the KFERQ motif or KFERQ-like motif is at the C-terminus "end" of the Cas9 protein. In some embodiments, the addition of the modified motif to the N-terminus or C-terminus of a protein does not affect the folding, structure, or dynamics of the protein. In some embodiments, the N-terminus of Cas9 is surface exposed. In some embodiments, the C-terminus of Cas9 is surface exposed.

[0117] In some embodiments, the disclosure provides recombinant Cas9 proteins comprising one or more amino acid modifications of a wild-type Cas9 protein, the amino acid modifications introducing a chaperone-mediated autophagy (CMA) targeting motif or an endosomal microautophagy (eMI) targeting motif into the Cas9 protein, wherein the recombinant Cas9 protein degrades in vivo at least 20% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not comprise a CMA or eMI targeting motif. In some embodiments, the recombinant Cas9 protein degrades in vivo at least 50% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not comprise a CMA or eMI targeting motif. In some embodiments, the recombinant Cas9 protein degrades in vivo at least 80% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not comprise a CMA or eMI targeting motif.

[0118] In some embodiments, the disclosure provides a recombinant Cas9 protein comprising one or more amino acid modifications in a wild-type Cas9 protein, wherein the recombinant Cas9 protein comprises a CMA targeting motif or an eMI targeting motif.

[0119] As described herein, proteins containing a CMA or eMI motif are targets of the CMA or eMI proteolytic pathway. Thus, in some embodiments, recombinant Cas9 proteins of the present disclosure that include one or more amino acid modifications that introduce a CMA or eMI targeting motif are targeted for CMA- or eMI-mediated proteolysis. Similarly, in some embodiments, recombinant Cas9 proteins of the present disclosure that include a CMA or eMI targeting motif are targeted for CMA- or eMI-mediated proteolysis.

[0120] In some embodiments, a recombinant Cas9 protein comprising a CMA or eMI targeting motif is degraded in vivo at least 20% more rapidly, at least 30% more rapidly, at least 40% more rapidly, at least 50% more rapidly, at least 60% more rapidly, at least 70% more rapidly, at least 80% more rapidly, at least 90% more rapidly, at least 100% more rapidly, at least 150% more rapidly, at least 200% more rapidly, or at least 500% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not comprise a CMA or eMI targeting motif, as measured by immunoblotting or GFP reporter assay. In some embodiments, when the same cell expresses (a) a recombinant Cas9 comprising one or more amino acid modifications that introduce a CMA or eMI targeting motif, and (b) a wild-type Cas9, the recombinant Cas9 is completely degraded, while at least 50% of the wild-type Cas9 still remains within the cell. Similarly, in some embodiments, when the same cell expresses (a) a recombinant Cas9 comprising one or more amino acid modifications that introduce a CMA or eMI targeting motif, and (b) a Cas9 protein that does not include a CMA or eMI targeting motif, the recombinant Cas9 is completely degraded while at least 50% of the Cas9 protein that does not include a CMA or eMI targeting motif still remains in the cell. In some embodiments, the recombinant Cas9 is completely degraded while at least 60%, at least 70%, at least 80%, at least 90%, or at least 100% of the wild-type Cas9 or Cas9 protein that does not include a CMA or eMI targeting motif still remains in the cell. In some embodiments, the recombinant Cas9 is completely degraded within 12 hours, 24 hours, 36 hours, 48 ​​hours, or 72 hours after being introduced into the cell. As used in the embodiments herein, "completely degraded" refers to a protein that is below the level of detection by GFP reporter assay or immunoblotting.As described herein, methods for measuring protein degradation rates include, for example, pulse-chase of amino acid isotopes (e.g., stable isotope labeling with amino acids in cell culture or SILAC), post-synthetic radioisotope labeling, or reporter-dependent approaches such as global protein stability profiling (GPSP) using, for example, GFP as a reporter protein (see, for example, Yewdell et al., Cell Biol Int 35(5):457-462 (2011)). In some embodiments, the degradation rate of Cas9 protein is measured by quantifying the amount of protein in Cas9 cells at different time points, for example, using densitometric analysis of immunoblots, plotting protein levels over time, and determining the degradation rate from the Cas9 protein level versus time plot.

[0121] In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation at position F185 of SEQ ID NO:1. In some embodiments, the mutation is F185N. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation at positions A547 and I548 of SEQ ID NO:1. In some embodiments, the mutation is A547E and I548L. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation at positions T560 and V561 of SEQ ID NO:1. In some embodiments, the mutation is T560E and V561Q. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation at positions D829 and I830 of SEQ ID NO:1. In some embodiments, the mutation is D829L and I830R. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation at positions L1087 and S1088 of SEQ ID NO:1. In some embodiments, the mutation is L1087E and S1088Q. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations at positions P1199 and K1200 of SEQ ID NO: 1. In some embodiments, the mutations are P1199D and K1200Q.

[0122] In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include any combination of the mutations described herein. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation selected from F185N, A547E, I548L, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation selected from F185N, T560E, V561Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation selected from F185N, D829L, I830R, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation selected from F185N, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include a mutation selected from F185N, P1199D, K1200Q, and combinations thereof.

[0123] In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from A547E, I548L, T560E, V561Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from A547E, I548L, D829L, I830R, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from A547E, I548L, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from A547E, I548L, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from T560E, V561Q, D829L, I830R, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from T560E, V561Q, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from T560E, V561Q, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from D829L, I830R, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from D829L, I830R, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 include mutations selected from L1087E, S1088Q, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant Cas9 protein result in one or more CMA or eMI targeting motifs, as described herein.

[0124] In some embodiments, the recombinant Cas9 protein has an amino acid sequence that is at least 50% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant Cas9 protein has an amino acid sequence that is at least 60% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant Cas9 protein has an amino acid sequence that is at least 70% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant Cas9 protein has an amino acid sequence that is at least 80% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant Cas9 protein has an amino acid sequence that is at least 90% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant Cas9 protein has an amino acid sequence that is at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein.

[0125] In some embodiments, the disclosure provides a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9) comprising an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or combinations thereof, of SEQ ID NO:1.

[0126] In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation at position F185 of SEQ ID NO:1. In some embodiments, the mutation is F185N. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation at positions A547 and I548 of SEQ ID NO:1. In some embodiments, the mutation is A547E and I548L. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation at positions T560 and V561 of SEQ ID NO:1. In some embodiments, the mutation is T560E and V561Q. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation at positions D829 and I830 of SEQ ID NO:1. In some embodiments, the mutation is D829L and I830R. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation at positions L1087 and S1088 of SEQ ID NO:1. In some embodiments, the mutations are L1087E and S1088Q. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations at positions P1199 and K1200 of SEQ ID NO: 1. In some embodiments, the mutations are P1199D and K1200Q.

[0127] In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include any combination of the mutations described herein. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation selected from F185N, A547E, I548L, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation selected from F185N, T560E, V561Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation selected from F185N, D829L, I830R, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation selected from F185N, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation selected from F185N, P1199D, K1200Q, and combinations thereof.

[0128] In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from A547E, I548L, T560E, V561Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from A547E, I548L, D829L, I830R, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from A547E, I548L, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from A547E, I548L, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from T560E, V561Q, D829L, I830R, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from T560E, V561Q, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from T560E, V561Q, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from D829L, I830R, L1087E, S1088Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include mutations selected from D829L, I830R, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 include a mutation selected from L1087E, S1088Q, P1199D, K1200Q, and combinations thereof. In some embodiments, the one or more amino acid modifications in the recombinant SpCas9 protein result in one or more CMA or eMI targeting motifs.The CMA and eMI targeting motifs are described herein.

[0129] In some embodiments, the recombinant SpCas9 protein has an amino acid sequence that is at least 50% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant SpCas9 protein has an amino acid sequence that is at least 60% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant SpCas9 protein has an amino acid sequence that is at least 70% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant SpCas9 protein has an amino acid sequence that is at least 80% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant SpCas9 protein has an amino acid sequence that is at least 90% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein. In some embodiments, the recombinant SpCas9 protein has an amino acid sequence that is at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO:1 and includes one or more amino acid modifications described herein.

[0130] In some embodiments, the present disclosure provides recombinant Cas9 proteins capable of binding to the heat shock cognate protein of 70 kD (HSC70).

[0131] As described herein, HSC70 is a chaperone protein in both the CMA and eMI protein degradation pathways. HSC70 binds to proteins targeted for degradation and transports the proteins to lysosomes (in the case of CMA) or late endosomes (in the case of eMI) for degradation. Thus, in some embodiments, proteins with higher binding affinity to HSC70 are degraded more rapidly compared to proteins with lower binding affinity to HSC70. In some embodiments, the binding ability and / or affinity of a protein to HSC70 is determined by the presence of a CMA or eMI targeting motif, such as a KFERQ motif or a KFERQ-like motif, on the protein.

[0132] In some embodiments, the recombinant Cas9 proteins of the disclosure are capable of binding to HSC70. As described and exemplified herein, wild-type Cas9 or Cas9 proteins that do not include a KFERQ or KFERQ-like motif do not bind to HSC70. In some embodiments, the recombinant Cas9 proteins of the disclosure are capable of binding to HSC70 with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100% greater affinity than wild-type Cas9 proteins or Cas9 proteins that do not include a KFERQ or KFERQ-like motif. Methods for determining binding affinity between proteins are known in the art and include biochemical methods such as co-immunoprecipitation, fluorescent protein reconstitution, affinity electrophoresis, pull-down assays, phage display, in vivo cross-linking, tandem affinity purification, cross-linking followed by mass spectrometry and proximity ligation assays; biophysical methods such as biolayer interferometry, dynamic light scattering, surface plasmon resonance, fluorescence resonance energy transfer and isothermal titration calorimetry; and / or genetic methods such as yeast two-hybrid screening and bacterial two-hybrid screening. For a general overview of methods for measuring binding affinity and detecting protein interactions, see, for example, Meyerkord and Fu, Protein-Protein Interactions: Methods and Applications 2nd Ed. 2015, Humana Press. In some embodiments, a recombinant Cas9 of the disclosure can be detected by an HSC70 antibody after an incubation period with HSC70, while wild-type Cas9 or a Cas9 protein that does not contain a KFERQ motif or a KFERQ-like motif is not detected by the HSC70 antibody after the same incubation period.

[0133] In some embodiments, the binding affinity between HSC70 and the recombinant Cas9 is at least 2-fold higher, at least 3-fold higher, at least 4-fold higher, at least 5-fold higher, at least 6-fold higher, at least 7-fold higher, at least 8-fold higher, at least 9-fold higher, at least 10-fold higher, at least 20-fold higher, at least 30-fold higher, at least 40-fold higher, at least 50-fold higher, at least 60-fold higher, at least 70-fold higher, at least 80-fold higher, at least 90-fold higher, at least 100-fold higher, at least 500-fold higher, or at least 1000-fold higher than the binding affinity between HSC70 and a wild-type Cas9 or a Cas9 protein that does not contain a KFERQ motif or a KFERQ-like motif.

[0134] In some embodiments, the present disclosure provides a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9) comprising a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1.

[0135] As described herein, SEQ ID NO:1 comprises the amino acid sequence of a wild-type Cas9 protein (SpCas9) from S. pyogenes. Amino acid position 185 of SEQ ID NO:1 is in a region corresponding to the Rec2 domain of SpCas9. In some embodiments, the amino acid residue at position 185 of SEQ ID NO:1 is modified to generate a KFERQ motif or a KFERQ-like motif. In some embodiments, the KFERQ-like motif at position 185 of SEQ ID NO:1 is VDKLN. In some embodiments, the recombinant SpCas9 protein comprises a mutation at position 185 of SEQ ID NO:1. In some embodiments, the mutation is F185N.

[0136] In some embodiments, a recombinant Cas9 of the disclosure further comprises a mutation at position D10 and / or H840 of SEQ ID NO:1. Mutations at positions D10 and / or H840 of wild-type Cas9 generate a Cas9 with nickase activity, also referred to herein as a "Cas9 nickase." Cas9 nickases can cleave only one strand of double-stranded DNA (i.e., "nick" the DNA). Cas9 nickases are described, for example, in Cho et al., Genome Res 24:132-141 (2013). In some embodiments, a recombinant Cas9 protein of the disclosure further comprises a mutation at amino acid position D10 of SEQ ID NO:1. In some embodiments, a recombinant Cas9 protein of the disclosure further comprises a mutation at amino acid position H840 of SEQ ID NO:1. In some embodiments, a recombinant Cas9 protein of the disclosure further comprises a mutation at amino acid position D10 and a mutation at amino acid position H840 of SEQ ID NO:1. In some embodiments, the mutation at position D10 is D10A. In some embodiments, the mutation at position D10 is D10N. In some embodiments, the mutation at position H840 is H840A. In some embodiments, the mutation at position H840 is H840N. In some embodiments, the mutation at position H840 is H840Y. In some embodiments, the recombinant Cas9 protein has a F185N mutation and a D10A mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation and a D10N mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation and a H840A mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation and a H840N mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation and a H840Y mutation.

[0137] In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10A mutation, and a H840A mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10A mutation, and a H840N mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10A mutation, and a H840Y mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10N mutation, and a H840A mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10N mutation, and a H840N mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10N mutation, and a H840Y mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10A mutation, and a H840A mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10A mutation, and a H840N mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10A mutation, and a H840Y mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10N mutation, and a H840A mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10N mutation, and a H840N mutation. In some embodiments, the recombinant Cas9 protein has a F185N mutation, a D10N mutation, and a H840Y mutation.

[0138] In some embodiments, the recombinant Cas9 protein of the present disclosure generates sticky ends. As described herein, sticky ends refer to nucleic acid fragments having strands of unequal length. In some embodiments, the recombinant Cas9 protein that generates sticky ends is a recombinant Cas9-FokI hybrid protein. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation and a D10A mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation and a D10N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation and a H840A mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation and a H840N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein comprises an F185N mutation and an H840Y mutation in Cas9.

[0139] In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10A mutation, and a H840A mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10A mutation, and a H840N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10A mutation, and a H840Y mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10N mutation, and a H840A mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10N mutation, and a H840N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10N mutation, and a H840Y mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10A mutation, and a H840A mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10A mutation, and a H840N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10A mutation, and a H840Y mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10N mutation, and a H840A mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10N mutation, and a H840N mutation in Cas9. In some embodiments, the recombinant Cas9-FokI hybrid protein has a F185N mutation, a D10N mutation, and a H840Y mutation in Cas9.

[0140] In some embodiments, the recombinant Cas9 protein that generates sticky ends comprises a modified KFERQ motif or a KFERQ-like motif on the wild-type Cas9 protein that is capable of generating sticky ends. In some embodiments, the wild-type Cas9 protein that is capable of generating sticky ends is isolated from Francisella novicida (FnCas9) (SEQ ID NO:23). In some embodiments, the recombinant Cas9 protein has an amino acid sequence with at least about 90% sequence identity to SEQ ID NO:23 and comprises a modified KFERQ motif or a KFERQ-like motif as described herein. In some embodiments, the recombinant Cas9 protein has an amino acid sequence with at least about 90% sequence identity to SEQ ID NO:23 and comprises a CMA targeting motif or an eMI targeting motif. In some embodiments, the recombinant Cas9 has an amino acid sequence with at least about 90% sequence identity to SEQ ID NO:23 and is capable of binding to HSC70 with a higher affinity than wild-type Cas9. In some embodiments, the recombinant Cas9 has an amino acid sequence with at least about 90% sequence identity to SEQ ID NO:23 and is degraded more rapidly than wild-type Cas9.

[0141] In some embodiments, the recombinant Cas9 of the present disclosure comprises one or more nuclear localization signals. A "nuclear localization signal" or "nuclear localization sequence" (NLS) is an amino acid sequence that "tags" a protein for transport into the cell nucleus by nuclear transport, i.e., proteins with an NLS are transported into the cell nucleus. Typically, an NLS comprises a positively charged Lys or Arg residue exposed on the protein surface. Exemplary nuclear localization sequences include, but are not limited to, NLSs from SV40 large T-antigen, nucleoplasm, EGL-13, c-Myc, and TUS-proteins. In some embodiments, the NLS comprises the sequence PKKKRKV (SEQ ID NO: 42). In some embodiments, the NLS comprises the sequence AVKRPAATKKAGQAKKKKLD (SEQ ID NO: 43). In some embodiments, the NLS comprises the sequence PAAKRVKLD (SEQ ID NO: 44). In some embodiments, the NLS comprises the sequence MSRRRKANPTKLSENAKKLAKEVEN (SEQ ID NO: 45). In some embodiments, the NLS comprises the sequence KLKIKRPVK (SEQ ID NO: 46). Other nuclear localization sequences include, but are not limited to, the acidic M9 domain of hnRNP A1, the sequence KIPIK (SEQ ID NO: 47) in the yeast transcriptional repressor Matα2, and the PY-NLS.

[0142] nucleotide In some embodiments, the disclosure provides polynucleotide sequences encoding recombinant Cas9 proteins described herein. In some embodiments, the disclosure provides polynucleotide sequences encoding recombinant Cas9 comprising a modified KFERQ motif or a KFERQ-like motif. In some embodiments, the disclosure provides polynucleotide sequences encoding recombinant Cas9 proteins comprising one or more amino acid modifications of a wild-type Cas9 protein, the amino acid modifications introducing a CMA targeting motif or an eMI targeting motif into the Cas9 protein, and the recombinant Cas9 protein degrades in vivo at least 20% more rapidly than the wild-type Cas9 protein. In some embodiments, the disclosure provides polynucleotide sequences encoding recombinant Cas9 proteins comprising one or more amino acid modifications of a wild-type Cas9 protein, the recombinant Cas9 protein comprising a CMA targeting motif or an eMI targeting motif. In some embodiments, the disclosure provides a polynucleotide sequence encoding a recombinant Cas9 protein (SpCas9) isolated from Streptococcus pyogenes comprising an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or a combination thereof, of SEQ ID NO:1. In some embodiments, the disclosure provides a polynucleotide sequence encoding a recombinant Cas9 protein capable of binding to HSC70. In some embodiments, the disclosure provides a polynucleotide sequence encoding a recombinant Cas9 protein (SpCas9) isolated from Streptococcus pyogenes comprising a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1.

[0143] In some embodiments, the polynucleotide sequence has at least 50% sequence identity to SEQ ID NO:3. In some embodiments, the polynucleotide sequence has at least 60% sequence identity to SEQ ID NO:3. In some embodiments, the polynucleotide sequence has at least 70% sequence identity to SEQ ID NO:3. In some embodiments, the polynucleotide sequence has at least 80% sequence identity to SEQ ID NO:3. In some embodiments, the polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:3. In some embodiments, the polynucleotide sequence has at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO:3.

[0144] In some embodiments, the polynucleotide sequence encoding the recombinant Cas9 is codon-optimized for expression in eukaryotic cells. In some embodiments, the polynucleotide sequence encoding stiCas9 is codon-optimized for expression in animal cells. In some embodiments, the polynucleotide sequence encoding the recombinant Cas9 is codon-optimized for expression in human cells. In some embodiments, the polynucleotide sequence encoding the recombinant Cas9 is codon-optimized for expression in plant cells. Codon optimization is the adjustment of codons to match the host tRNA abundance in order to increase the yield and efficiency of recombinant or heterologous protein expression. Codon optimization is a routine procedure in the art and can be performed using software programs such as the Codon Optimization tool from Integrated DNA Technologies, the Codon Usage Table analysis tool from Entelechon, the Blue Heron software from GENEMAKER, the Gene Forge software from Aptagen, the DNA Builder software, the General Codon Usage Analysis software, the publicly available OPTIMIZER software, and the OptimumGene algorithm from Genscript.

[0145] CRISPR-Cas system In some embodiments, the disclosure provides a non-naturally occurring CRISPR-Cas system comprising a recombinant Cas9 protein provided herein and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and comprises a guide sequence.

[0146] In some embodiments, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system includes a modified KFERQ motif or a KFERQ-like motif. In some embodiments, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system includes one or more amino acid modifications of a wild-type Cas9 protein, the amino acid modifications introducing a CMA targeting motif or an eMI targeting motif into the Cas9 protein, and the recombinant Cas9 protein degrades in vivo at least 20% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif. In some embodiments, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system includes one or more amino acid modifications of a wild-type Cas9 protein, and the recombinant Cas9 protein includes a CMA targeting motif or an eMI targeting motif. In some embodiments, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system is isolated from S. pyogenes (SpCas9) and comprises an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or combinations thereof of SEQ ID NO:1. In some embodiments, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system is capable of binding to HSC70. In some embodiments, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system is isolated from S. pyogenes (SpCas9) and comprises a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1.

[0147] In some embodiments, the disclosure provides a non-naturally occurring CRISPR-Cas system comprising a polynucleotide sequence encoding a recombinant Cas9 protein provided herein and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and comprises a guide sequence.

[0148] In some embodiments, the disclosure provides a non-naturally occurring CRISPR-Cas system comprising a regulatory element operably linked to a polynucleotide sequence encoding a recombinant Cas9 protein provided herein, and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and comprises a guide sequence.

[0149] In some embodiments, the polynucleotide of the non-naturally occurring CRISPR-Cas system encodes a recombinant Cas9 protein that includes a modified KFERQ motif or a KFERQ-like motif. In some embodiments, the polynucleotide of the non-naturally occurring CRISPR-Cas system encodes a recombinant Cas9 protein that includes one or more amino acid modifications of a wild-type Cas9 protein, the amino acid modifications introducing a CMA targeting motif or an eMI targeting motif into the Cas9 protein, and the recombinant Cas9 protein is degraded in vivo at least 20% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif. In some embodiments, the polynucleotide of the non-naturally occurring CRISPR-Cas system encodes a recombinant Cas9 protein that includes one or more amino acid modifications in a wild-type Cas9 protein, the recombinant Cas9 protein includes a CMA targeting motif or an eMI targeting motif. In some embodiments, the polynucleotide of the non-naturally occurring CRISPR-Cas system encodes a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9) that includes an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or combinations thereof, of SEQ ID NO:1. In some embodiments, the polynucleotide of the non-naturally occurring CRISPR-Cas system encodes a recombinant Cas9 protein capable of binding to HSC70. In some embodiments, the polynucleotide of the non-naturally occurring CRISPR-Cas system encodes a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9) that includes a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1.

[0150] In some embodiments, the regulatory element associated with the polynucleotide sequence encoding the recombinant Cas9 protein is a promoter. In some embodiments, the regulatory element is a bacterial promoter. In some embodiments, the regulatory element is a viral promoter. In some embodiments, the regulatory element is a eukaryotic regulatory element, i.e., a eukaryotic promoter. In some embodiments, the eukaryotic regulatory element is a mammalian promoter.

[0151] In some embodiments, the guide polynucleotide of the non-naturally occurring CRISPR-Cas system is an RNA molecule. The RNA molecule that binds to the CRISPR-Cas components and targets them to a specific location in the target DNA is referred to herein as a "guide RNA," "gRNA," or "small molecule guide RNA," and may also be referred to herein as a "DNA-targeting RNA." A guide polynucleotide, such as a guide RNA, comprises at least two nucleotide segments, namely, at least one "DNA-binding segment" and at least one "polypeptide-binding segment." By "segment" is meant a portion, section, or region of a molecule, such as a contiguous stretch of nucleotides of a guide polynucleotide molecule. The definition of "segment" is not limited to a specific number of total base pairs, unless specifically defined otherwise.

[0152] In some embodiments, the DNA-binding segment of a guide polynucleotide (or "DNA targeting sequence") hybridizes to a target sequence in a cell. In some embodiments, the DNA-binding segment of a guide polynucleotide, e.g., a guide RNA, comprises a polynucleotide sequence that is complementary to a specific sequence in the target DNA.

[0153] In some embodiments, the guide polynucleotide of the present disclosure has a guide sequence that hybridizes to a target sequence in a bacterial cell. In some embodiments of the method, the target sequence is in a bacterial cell. In some embodiments, the bacterial cell is a laboratory strain. Examples of such cells include, but are not limited to, E. coli, S. aureus, V. cholerae, S. pneumoniae, B. subtilis, C. crescentus, M. genitalium, A. fischeri, Synechocystis, P. fluorescens, A. vinelandii, S. coelicolor. In some embodiments, the bacterial cell is a bacterium used in the preparation of food and / or beverages.Non-limiting exemplary genera of such cells include Acetobacter, Arthrobacter, Bacillus, Bifidobacterium, Brachybacterium, Brevibacterium, Carnobacterium, Corynebacterium, Enterococcus, Gluconacetobacter, Hafnia, Halomonas, Kocuria, Lactobacillus, (L. acetotolerans, L. acidipiscis, L. acidophilus, L. alimentarius, L. brevis, L. bucheri, L. casei, L. curvatus, L. fermentum, L. hilgardii, L. jensenii, L. kimchii, L. lactis, L. paracasei, L. Examples of suitable microbial bacteria include, but are not limited to, L. paracasei, L. plantarum and L. sakei), Leuconostoc, Microbacterium, Pediococcus, Propionibacterium, Weissella and Zymomonas.

[0154] In some embodiments, the guide polynucleotide of the present disclosure has a guide sequence that hybridizes to a target sequence in a eukaryotic cell. In some embodiments, the eukaryotic cell is an animal or human cell. In some embodiments, the eukaryotic cell is a human, rodent, or bovine cell line, or cell line. Examples of such cells, cell lines, or cell lines include, but are not limited to, mouse myeloma (NSO) cell lines, Chinese hamster ovary (CHO) cell lines, HT1080, H9, HepG2, MCF7, MDBK Jurkat, NIH3T3, PC12, BHK (baby hamster kidney cells), VERO, SP2 / 0, YB2 / 0, Y0, C127, L cells, COS, such as COS1 and COS7, QC1-3, HEK-293, VERO, PER.C6, HeLA, EB1, EB2, EB3, oncolytic, or hybridoma cell lines. In some embodiments, the eukaryotic cell is a CHO cell line. In some embodiments, the eukaryotic cell is a CHO cell. In some embodiments, the cell is a CHO-K1 cell, a CHO-K1 SV cell, a DG44 CHO cell, a DUXB11 CHO cell, a CHOS, a CHO GS knockout cell, a CHO FUT8 GS knockout cell, a CHOZN or a CHO derived cell. A CHO GS knockout cell (e.g., a GSKO cell) is, for example, a CHO-K1 SV GS knockout cell. A CHO FUT8 knockout cell is, for example, a POTELLIGENT CHOK1 SV (Lonza Biologics, Inc.). The eukaryotic cell can also be an avian cell, cell line or cell line, such as, for example, an EBX cell, EB14, EB24, EB26, EB66 or EBvl3.

[0155] In some embodiments, the eukaryotic cell is a human cell. In some embodiments, the human cell is a stem cell. The stem cell can be, for example, a pluripotent stem cell, such as an embryonic stem cell (ESC), an adult stem cell, an induced pluripotent stem cell (iPSC), a tissue-specific stem cell (e.g., a hematopoietic stem cell), and a mesenchymal stem cell (MSC). In some embodiments, the human cell is any differentiated form of the cells described herein. In some embodiments, the eukaryotic cell is a cell derived from any primary cell in culture.

[0156] In some embodiments, the eukaryotic cell is a hepatocyte, such as a human hepatocyte, an animal hepatocyte, or a non-parenchymal cell.For example, the eukaryotic cell can be an attached metabolic test human hepatocyte, an attached induction test human hepatocyte, an attached human hepatocyte, a suspension test human hepatocyte (for example, 10-donor and 20-donor pooled hepatocytes), a human hepatic Kupffer cell, a human hepatic stellate cell, a dog hepatocyte (for example, single and pooled beagle hepatocytes), a mouse hepatocyte (for example, CD-1 and C57BI / 6 hepatocytes), a rat hepatocyte (for example, Sprague-Dawley, Wistar Han and Wistar hepatocytes), a monkey hepatocyte (for example, Cynomolgus or Rhesus hepatocytes), a cat hepatocyte (for example, domestic shorthair hepatocytes) and a rabbit hepatocyte (for example, New Zealand White hepatocytes).

[0157] In some embodiments, the eukaryotic cell is a plant cell. For example, the plant cell may be from a crop plant, such as cassava, maize, sorghum, wheat, or rice. The plant cell may be from an algae, a tree, or a vegetable. The plant cell may be from a monocotyledonous or dicotyledonous plant, or from a crop or cereal plant, a productive plant, a fruit, or a vegetable. For example, the plant cell may be from a tree, such as a citrus tree, e.g., an orange, grapefruit or lemon tree; a peach or nectarine tree; an apple or pear tree; a nut tree, e.g., an almond or walnut or pistachio tree; a Solanum plant, e.g., a potato; a Brassica plant, a Lactuca plant, a Spinacia plant; a Capsicum plant; cotton, tobacco, asparagus, carrot, cabbage, broccoli, cauliflower, tomato, eggplant, pepper, lettuce, spinach, strawberry, blueberry, raspberry, blackberry, grape, coffee, cocoa, and the like.

[0158] In some embodiments, the guide sequence of the guide polynucleotide is about 5 to about 50 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 6 to about 45 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 7 to about 40 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 8 to about 35 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 9 to about 30 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 10 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 12 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 14 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 16 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 18 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 5 to about 10 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 6 to about 10 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 7 to about 10 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 8 to about 10 nucleotides. The length of the guide sequence can be determined by one of skill in the art using a guide sequence design tool such as, for example, CRISPR Design Tool (Hsu et al., Nat Biotechnol 31(9):827-832(2013)), ampliCan (Labun et al., bioRxiv 2018, doi:10.1101 / 249474), CasFinder (Alach et al., bioRxiv 2014, doi:10.1101 / 005074), CHOPCHOP (Labun et al., Nucleic Acids Res 2016, doi:10.1093 / nar / gkw398).

[0159] In some embodiments, a guide polynucleotide, e.g., a guide RNA, of the disclosure comprises a polypeptide binding sequence / segment. The polypeptide binding segment (or "protein binding sequence") of a guide polynucleotide, e.g., a guide RNA, interacts with a polynucleotide binding domain of a Cas protein of the disclosure. Such polypeptide binding segments or sequences are known to those of skill in the art, for example those disclosed in U.S. Patent Application Publication Nos. 2014 / 0068797, 2014 / 0273037, 2014 / 0273226, 2014 / 0295556, 2014 / 0295557, 2014 / 0349405, 2015 / 0045546, 2015 / 0071898, 2015 / 0071899, and 2015 / 0071906, the disclosures of which are incorporated herein in their entireties. In some embodiments, the polypeptide binding segment of the guide polynucleotide binds to Cas9. In some embodiments, the polypeptide binding segment of the guide polynucleotide binds to a recombinant Cas9 protein provided herein.

[0160] In some embodiments, the guide polynucleotide is at least about 10, 15, 20, 25, or 30 nucleotides and at most about 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, or 150 nucleotides. In some embodiments, the guide polynucleotide is about 10 to about 150 nucleotides. In some embodiments, the guide polynucleotide is about 20 to about 120 nucleotides. In some embodiments, the guide polynucleotide is about 30 to about 100 nucleotides. In some embodiments, the guide polynucleotide is about 40 to about 80 nucleotides. In some embodiments, the guide polynucleotide is about 50 to about 60 nucleotides. In some embodiments, the guide polynucleotide is about 10 to about 35 nucleotides. In some embodiments, the guide polynucleotide is about 15 to about 30 nucleotides. In some embodiments, the guide polynucleotide is about 20 to about 25 nucleotides.

[0161] The guide polynucleotide, e.g., guide RNA, can be introduced into the target cell as an isolated molecule, e.g., an RNA molecule, or is introduced into the cell using an expression vector containing DNA encoding the guide polynucleotide, e.g., the guide RNA.

[0162] In some embodiments, the guide polynucleotide of the CRISPR-Cas system is linked to a direct repeat sequence. A direct repeat or DR sequence is an array of repeat sequences in the CRISPR locus that are interleaved with short stretches of non-repetitive sequences (spacers). The spacer sequence targets a protospacer adjacent motif (PAM) on the target sequence. When the non-coding portion of the CRISPR locus (i.e., the guide polynucleotide and the tracrRNA) is transcribed, the transcript is cleaved into a short crRNA that contains individual spacer sequences in the DR sequence, which directs the Cas9 nuclease to the PAM. In some embodiments, the DR sequence is RNA. In some embodiments, the DR sequence is encoded by a nucleic acid. In some embodiments, the DR sequence is linked to the guide polynucleotide. In some embodiments, the DR sequence is linked to the guide sequence of the guide polynucleotide. In some embodiments, the DR sequence comprises a secondary structure. In some embodiments, the DR sequence comprises a stem-loop structure. In some embodiments, the DR sequence is 10-20 nucleotides. In some embodiments, the DR sequence is at least 16 nucleotides. In some embodiments, the DR sequence is at least 16 nucleotides and comprises a single stem loop. In some embodiments, the DR sequence comprises an RNA aptamer. In some embodiments, the secondary structure or stem loop of the DR is recognized by a nuclease for cleavage. In some embodiments, the nuclease is a ribonuclease. In some embodiments, the nuclease is RNase III.

[0163] In some embodiments, the CRISPR-Cas system of the present disclosure further comprises a tracrRNA. The "tracrRNA" or transactivating CRISPR-RNA forms an RNA duplex with the pre-crRNA or pre-CRISPR-RNA, which is then cleaved by the RNA-specific ribonuclease RNase III to form a crRNA / tracrRNA hybrid. In some embodiments, the guide RNA comprises a crRNA / tracrRNA hybrid. In some embodiments, the tracrRNA component of the guide RNA activates the Cas9 protein. In some embodiments, the guide polynucleotide of the CRISPR-Cas system comprises a tracrRNA sequence. In some embodiments, the CRISPR-Cas system comprises a separate polynucleotide comprising a tracrRNA sequence.

[0164] In some embodiments, the polynucleotide encoding the recombinant Cas9 and the guide polynucleotide are present on a single vector. In some embodiments, the polynucleotide encoding the recombinant Cas9, the guide polynucleotide (or a nucleotide that can be transcribed into a guide polynucleotide), and the tracrRNA are present on a single vector. In some embodiments, the polynucleotide encoding the recombinant Cas9, the guide polynucleotide (or a nucleotide that can be transcribed into a guide polynucleotide), the tracrRNA, and the direct repeat sequence are present on a single vector. In some embodiments, the vector is an expression vector. In some embodiments, the vector is a mammalian expression vector. In some embodiments, the vector is a human expression vector. In some embodiments, the vector is a plant expression vector.

[0165] In some embodiments, the polynucleotide encoding the recombinant Cas9 and the guide polynucleotide are a single nucleic acid molecule. In some embodiments, the polynucleotide encoding the recombinant Cas9, the guide polynucleotide, and the tracrRNA are a single nucleic acid molecule. In some embodiments, the polynucleotide encoding the recombinant Cas9, the guide polynucleotide, the tracrRNA, and the direct repeat sequence are a single nucleic acid molecule. In some embodiments, the single nucleic acid molecule is an expression vector. In some embodiments, the single nucleic acid molecule is a mammalian expression vector. In some embodiments, the single nucleic acid molecule is a human expression vector. In some embodiments, the single nucleic acid molecule is a plant expression vector.

[0166] In some embodiments, the recombinant Cas9 and the guide polynucleotide can form a complex. In some embodiments, the complex between the recombinant Cas9 and the guide polynucleotide does not occur in nature.

[0167] Various methods for delivery of the CRISPR-Cas system are known in the art. In some embodiments, the CRISPR-Cas system of the present disclosure is delivered by a delivery particle. The delivery particle is a biological delivery system or formulation that includes the particle. As defined herein, a "particle" is an entity that has a maximum diameter of about 100 microns (μm). In some embodiments, the particle has a maximum diameter of about 10 μm. In some embodiments, the particle has a maximum diameter of about 2000 nanometers (nm). In some embodiments, the particle has a maximum diameter of about 1000 nm. In some embodiments, the particle has a maximum diameter of about 900 nm, about 800 nm, about 700 nm, about 600 nm, about 500 nm, about 400 nm, about 300 nm, about 200 nm, or about 100 nm. In some embodiments, the particle has a diameter of about 25 nm to about 200 nm. In some embodiments, the particle has a diameter of about 50 nm to about 150 nm. In some embodiments, the particles have a diameter of about 75 nm to about 100 nm.

[0168] The delivery particle may be provided in any form, including, but not limited to, a solid, semi-solid, emulsion, or colloid particle. In some embodiments, the delivery particle is a lipid-based system, a liposome, a micelle, a microvesicle, an exosome, or a gene gun. In some embodiments, the delivery particle comprises a CRISPR-Cas system. In some embodiments, the delivery particle comprises a CRISPR-Cas system comprising a recombinant Cas9 and a guide polynucleotide. In some embodiments, the delivery particle comprises a CRISPR-Cas system comprising a recombinant Cas9 and a guide polynucleotide, wherein the recombinant Cas9 and the guide polynucleotide are in a complex. In some embodiments, the delivery particle comprises a CRISPR-Cas system comprising a recombinant Cas9, a guide polynucleotide, and a polynucleotide comprising a tracrRNA. In some embodiments, the delivery particle comprises a CRISPR-Cas system comprising a recombinant Cas9, a guide polynucleotide, and a tracrRNA.

[0169] In some embodiments, the delivery particle further comprises a lipid, a sugar, a metal, or a protein. In some embodiments, the delivery particle is a lipid envelope. Delivery of mRNA using delivery particles comprising a lipid envelope or lipids is described, for example, in Su et al., Molecular Pharmacology 8(3):774-784(2011). In some embodiments, the delivery particle is a sugar-based particle, such as GalNAc. Sugar-based particles are described in WO 2014 / 118272 and Nair et al., J Am Chem Soc 136(49):16958-16961(2014).

[0170] In some embodiments, the delivery particle is a nanoparticle. The nanoparticles encompassed in the present disclosure can be provided in various forms, such as solid nanoparticles (e.g., metals, such as silver, gold, iron, titanium), non-metallic, lipid-based solids, polymers, suspensions of nanoparticles, or combinations thereof. Metal, dielectric and semiconductor nanoparticles as well as hybrid structures (e.g., core-shell nanoparticles) can be prepared. Nanoparticles made of semiconductor materials can be labeled quantum dots if they are small enough (typically less than 10 nm) that quantization of electronic energy levels occurs. Such nanoscale particles are used as drug carriers or imaging agents in biomedical applications and can be adapted for similar purposes in the present disclosure.

[0171] The preparation of delivery particles is further described in U.S. Patent Application Publication Nos. 2011 / 0293703, 2012 / 0251560, and 2013 / 0302401, as well as U.S. Patent Nos. 5,543,158, 5,855,913, 5,895,309, 6,007,845, and 8,709,843.

[0172] In some embodiments, the vesicle comprises the CRISPR-Cas system of the present disclosure. A "vesicle" is a small structure within a cell that has fluid enclosed by a lipid bilayer. In some embodiments, the CRISPR-Cas system of the present disclosure is delivered by a vesicle. In some embodiments, the vesicle comprises a recombinant Cas9 and a guide polynucleotide. In some embodiments, the vesicle comprises a recombinant Cas9 and a guide polynucleotide, and the recombinant Cas9 and the guide polynucleotide are in a complex. In some embodiments, the vesicle comprises a CRISPR-Cas system comprising a recombinant Cas9, a guide polynucleotide, and a polynucleotide comprising a tracrRNA. In some embodiments, the vesicle comprises a CRISPR-Cas system comprising a recombinant Cas9, a guide polynucleotide, and a tracrRNA.

[0173] In some embodiments, the vesicle comprising the recombinant Cas9 and guide polynucleotide is an exosome or liposome. In some embodiments, the vesicle is an exosome. In some embodiments, exosomes are used to deliver the CRISPR-Cas system of the present disclosure. Exosomes are endogenous nanovesicles (i.e., having a diameter of about 30 to about 100 nm) that can transport RNA and proteins and deliver RNA to the brain and other target organs. Engineered exosomes for delivering exogenous biological materials to target organs are described, for example, by Alvarez-Erviti et al., Nature Biotechnology 29:341 (2011), El-Andaloussi et al., Nature Protocols 7:2112-2116 (2012), and Wahlgren et al., Nucleic Acids Research 40(17):e130 (2012).

[0174] In some embodiments, the vesicle containing stiCas9 and guide polynucleotide is a liposome. In some embodiments, liposomes are used to deliver the CRISPR-Cas system of the present disclosure. Liposomes are spherical vesicle structures with at least one lipid bilayer and can be used as vehicles for the administration of nutrients and pharmaceuticals. Liposomes are often composed of phospholipids, particularly phosphatidylcholine, but also other lipids, such as egg phosphatidylethanolamine. Types of liposomes include, but are not limited to, multilamellar vesicles, small unilamellar vesicles, large unilamellar vesicles, and spiral-wound vesicles. See, for example, Spuch and Navarro, Journal of Drug Delivery, Article ID469679 (2011). Liposomes for delivery of biological materials, such as CRISPR-Cas components, have been described, for example, by Morrissey et al., Nature Biotechnology 23(8):1002-1007 (2005), Zimmerman et al., Nature Letters 441:111-114 (2006), and Li et al., Gene Therapy 19:775-780 (2012).

[0175] In some embodiments, the viral vector comprises the CRISPR-Cas system of the present disclosure. In some embodiments, the CRISPR-Cas system of the present disclosure is delivered by a viral vector. In some embodiments, the viral vector comprises a recombinant Cas9 and a guide polynucleotide. In some embodiments, the viral vector comprises a recombinant Cas9 and a guide polynucleotide, and the recombinant Cas9 and the guide polynucleotide are in a complex. In some embodiments, the viral vector comprises a CRISPR-Cas system comprising a polynucleotide comprising a recombinant Cas9, a guide polynucleotide, and a tracrRNA. In some embodiments, the viral vector comprises a CRISPR-Cas system comprising a recombinant Cas9, a guide polynucleotide, and a tracrRNA. In some embodiments, the viral vector is an adenovirus, a lentivirus, or an adeno-associated virus. Examples of viral vectors are provided herein.

[0176] In some embodiments, adeno-associated viruses (AAV) and / or lentiviruses can be used as viral vectors that contain elements of the CRISPR-Cas system described herein. In some embodiments of the present disclosure, Cas proteins are expressed intracellularly by cells transduced with the viral vector.

[0177] In some embodiments, the disclosed Cas proteins and methods are used in ex vivo gene editing, e.g., CAR-T type therapy. These embodiments may include modification of cells from human donors. In these examples, viral vectors may be used, but there is also the additional option of directly transfecting the Cas9 protein (along with in vitro transcribed guide RNA and donor DNA) into cultured cells.

[0178] In some embodiments, the recombinant Cas9 protein of the present disclosure is part of a fusion protein that includes one or more heterologous protein domains (e.g., about or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more domains in addition to the recombinant Cas9 protein). The Cas9 fusion protein may include any additional protein sequences and optionally linker sequences between any two domains. Examples of protein domains that may be fused to the recombinant Cas9 protein include, but are not limited to, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase enzyme activity, demethylase activity, transcription activation activity, transcription repression activity, transcription termination factor activity, histone modification activity, RNA cleavage activity, and nucleic acid binding activity. Non-limiting examples of epitope tags include the following: histidine (His) tag, V5 tag, FLAG tag, influenza hemagglutinin (HA) tag, Myc tag, VSV-G tag, and thioredoxin (Trx) tag. Examples of reporter genes include, but are not limited to, glutathione-5-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT), beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), autofluorescent proteins, such as blue fluorescent protein (BFP) and mCherry. In some embodiments, the recombinant Cas9 protein is fused to a protein or protein fragment that binds to a DNA molecule or binds to another cellular molecule, including, but not limited to, maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD), GAL4 DNA binding domain, and herpes simplex virus (HSV) BP16 protein. Additional domains that may form part of fusion proteins comprising the Cas9 protein are described in US Patent Application Publication No. 2011 / 0059502.In some embodiments, a labeled recombinant Cas9 protein is used to identify the location of the target sequence.

[0179] In some embodiments, the recombinant Cas9 protein may form a component of an inducible system. The inducibility of the system allows for spatiotemporal control of gene editing or gene expression using forms of energy. The forms of energy may include, but are not limited to, electromagnetic radiation, acoustic energy, chemical energy, and thermal energy. Non-limiting examples of inducible systems include tetracycline-inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activation systems (FKBP, ABA, etc.), or light-inducible systems (phytochrome, LOV domain, or cryptochrome). In some embodiments, the Cas9 protein is part of a light-inducible transcriptional effector (LITE) to direct changes in transcriptional activity in a sequence-specific manner. The light components may include the Cas9 protein, a light-responsive cytochrome heterodimer (e.g., from Arabidopsis thaliana), and a transcription activation / repression domain. Further examples of inducible DNA binding proteins and their methods of use are provided in International Patent Application Publication Nos. WO 2014 / 018423 and WO 2014 / 093635; U.S. Pat. Nos. 8,889,418 and 8,895,308; and U.S. Patent Application Publication Nos. 2014 / 0186919, 2014 / 0242700, 2014 / 0273234, and 2014 / 0335620.

[0180] Methods for site-specific modification In some embodiments, the disclosure provides a method of providing a site-specific modification at a target sequence in the genome of a cell, the method comprising introducing into the cell a non-naturally occurring CRISPR-Cas system as described herein.

[0181] In some embodiments of the method, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system includes a modified KFERQ motif or a KFERQ-like motif. In some embodiments of the method, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system includes one or more amino acid modifications of a wild-type Cas9 protein, the amino acid modifications introducing a CMA targeting motif or an eMI targeting motif into the Cas9 protein, and the recombinant Cas9 protein degrades in vivo at least 20% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif. In some embodiments of the method, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system includes one or more amino acid modifications of a wild-type Cas9 protein, and the recombinant Cas9 protein includes a CMA targeting motif or an eMI targeting motif. In some embodiments of the method, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system is isolated from S. pyogenes (SpCas9) and comprises an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or combinations thereof of SEQ ID NO:1. In some embodiments of the method, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system is capable of binding to HSC70. In some embodiments of the method, the recombinant Cas9 protein of the non-naturally occurring CRISPR-Cas system is isolated from S. pyogenes (SpCas9) and comprises a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1.

[0182] "Modifications" of a target sequence include single nucleotide substitutions, multiple nucleotide substitutions, insertions (ie, knock-ins) and deletions (ie, knock-outs) of nucleic acids, frameshift mutations, and other nucleic acid modifications.

[0183] In some embodiments of the method, the modification is a deletion of at least a portion of the target sequence. The target sequence can be cleaved at two different sites to generate complementary sticky ends, and the complementary sticky ends can be religated, thereby removing the portion of the sequence between the two sites.

[0184] In some embodiments of the method, the modification is a mutation of the target sequence. Site-specific mutagenesis can be achieved by the use of site-specific nucleases that promote homologous recombination of an exogenous polynucleotide template (also called a "donor polynucleotide" or "donor vector") containing the mutation of interest. In some embodiments, the sequence of interest (SoI) comprises the mutation of interest.

[0185] In some embodiments of the method, the modification is an insertion of a sequence of interest (SoI) into the target sequence. The SoI can be introduced as an exogenous polynucleotide template. In some embodiments, the exogenous polynucleotide comprises a blunt end. In some embodiments, the exogenous polynucleotide template comprises a sticky end. In some embodiments, the exogenous polynucleotide template comprises a sticky end that is complementary to a sticky end in the target sequence.

[0186] The exogenous polynucleotide template can be of any suitable length, for example, about or at least about 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 500, or 1000 or more nucleotides in length. In some embodiments, the exogenous polynucleotide template is complementary to a portion of the polynucleotide that comprises the target sequence. The exogenous polynucleotide template, when optimally aligned, overlaps with one or more nucleotides (e.g., about or at least about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, or 100 or more nucleotides) of the target sequence. In some embodiments, when the exogenous polynucleotide template and a polynucleotide comprising a target sequence are optimally aligned, the nearest neighbor nucleotide of the exogenous polynucleotide template is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 100, 1500, 2000, 2500, 5000, 10000 or more nucleotides of the target sequence.

[0187] In some embodiments, the exogenous polynucleotide is DNA, such as a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear single-stranded or double-stranded piece of DNA, an oligonucleotide, a PCR fragment, a naked nucleic acid or a nucleic acid complexed with a delivery vehicle, such as a liposome.

[0188] In some embodiments, the exogenous polynucleotide is inserted into the target sequence using the cell's endogenous DNA repair pathway. Endogenous DNA repair pathways include NHEJ, MMEJ, and HDR, each of which is described herein. During the repair process, an exogenous polynucleotide template comprising an SoI can be introduced into the target sequence. In some embodiments, an exogenous polynucleotide template comprising an SoI flanked by upstream and downstream sequences is introduced into the cell, the upstream and downstream sequences sharing sequence similarity with either side of the site of integration in the target sequence. In some embodiments, the exogenous polynucleotide comprising an SoI comprises, for example, a mutant gene. In some embodiments, the exogenous polynucleotide comprises a sequence that is endogenous or exogenous to the cell. In some embodiments, the SoI comprises a polynucleotide that codes for a protein or a non-coding sequence, such as a microRNA. In some embodiments, the SoI is operably linked to a regulatory element. In some embodiments, the SoI is a regulatory element. In some embodiments, the SoI comprises a resistance cassette, for example, a gene that confers resistance to an antibiotic. In some embodiments, the SoI comprises a mutation of the wild-type target sequence. In some embodiments, the SoI disrupts or corrects the target sequence by creating a frameshift mutation or a nucleotide substitution. In some embodiments, the SoI comprises a marker. Introduction of a marker into the target sequence can facilitate screening of targeted integration. In some embodiments, the marker is a restriction site, a fluorescent protein, or a selection marker. In some embodiments, the SoI is introduced as a vector comprising the SoI.

[0189] The upstream and downstream sequences in the exogenous polynucleotide template are selected to promote homologous recombination between the target sequence and the exogenous polynucleotide. The upstream sequence is a nucleic acid sequence that shares sequence similarity with the sequence upstream of the target site for integration (i.e., the target sequence). Similarly, the downstream sequence is a nucleic acid sequence that shares sequence similarity with the sequence downstream of the target site for integration. Thus, in some embodiments, the exogenous polynucleotide template containing the SoI inserts into the target sequence by homologous recombination at the upstream and downstream sequences. In some embodiments, the upstream and downstream sequences in the exogenous polynucleotide template have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% sequence identity with the upstream and downstream sequences of the targeted genome sequence, respectively. In some embodiments, the upstream or downstream sequence has at least about 20, 50, 100, 150, 200, 250, 300, 350, 400, or 500 base pairs, and up to about 600, 750, 1000, 1250, 1500, 1750, or 2000 base pairs. In some embodiments, the upstream or downstream sequence has about 20-2000 base pairs, or about 50-1750 base pairs, or about 100-1500 base pairs, or about 200-1250 base pairs, or about 300-1000 base pairs, or about 400 to about 750 base pairs, or about 500-600 base pairs. In some embodiments, the upstream or downstream sequence has about 50, about 100, about 250, about 500, about 100, about 1250, about 1500, about 1750, about 2000, about 2250 or about 2500 base pairs.

[0190] In some embodiments of the method, the modification in the target sequence is the inactivation of the expression of the target sequence in a cell.For example, when the CRISPR-Cas complex binds to the target sequence, the target sequence is inactivated, so that the sequence is not transcribed, the encoded protein is not produced, and / or the sequence does not function as the wild-type sequence functions.For example, a protein or microRNA coding sequence can be inactivated, so that the protein is not produced.

[0191] In some embodiments, a regulatory sequence can be inactivated so that it no longer functions as a regulatory sequence. Examples of regulatory sequences include promoters, transcription terminators, enhancers and other regulatory elements as described herein. Inactivated target sequences can include deletion mutations (i.e., deletion of one or more nucleotides), insertion mutations (i.e., insertion of one or more nucleotides) or nonsense mutations (i.e., replacement of a single nucleotide with another nucleotide such that a stop codon is introduced). In some embodiments, inactivation of a target sequence results in a "knockout" of the target sequence.

[0192] In some embodiments of the methods comprising recombinant Cas9 provided herein, off-target modifications in the genome of a cell are reduced by at least about 50% compared to wild-type Cas9 or Cas9 that does not include a KFERQ motif or a KFERQ-like motif. As described herein, off-target modifications are non-specific and unintended genetic modifications, such as, for example, unintended point mutations, deletions, insertions, inversions, and translocations. In some embodiments, the recombinant Cas9 proteins of the present disclosure reduce off-targeting in cells due to faster degradation rates. In some embodiments, the recombinant Cas9 proteins of the present disclosure reduce off-targeting in cells due to lower cellular availability of Cas9. In some embodiments, the recombinant Cas9 proteins of the present disclosure reduce off-targeting in cells due to shorter exposure times of cells to Cas9.

[0193] In some embodiments of the methods comprising recombinant Cas9 provided herein, compared to wild-type Cas9, off-target modifications are reduced and on-target modifications are at least about the same level. In some embodiments, the on-target modifications of the recombinant Cas9 are within at least about 20%, at least about 15%, at least about 10%, at least about 5%, at least about 4%, at least about 3%, at least about 2%, at least about 1%, at least about 0.5% of the on-target modifications of wild-type Cas9. In some embodiments comprising recombinant Cas9 provided herein, compared to wild-type Cas9, off-target modifications are reduced and on-target modifications are increased. In some embodiments, the on-target modification of the recombinant Cas9 is at least about 5% higher, at least about 10% higher, at least about 11% higher, at least about 12% higher, at least about 13% higher, at least about 14% higher, at least about 15% higher, at least about 16% higher, at least about 17% higher, at least about 18% higher, at least about 19% higher, or at least about 20% higher than wild-type Cas9.

[0194] In some embodiments, off-target modifications in the genome of a cell are reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, or at least about 200% compared to wild-type Cas9 or a Cas9 that does not contain a KFERQ motif or a KFERQ-like motif.

[0195] In some embodiments of the methods comprising a recombinant Cas9 provided herein, off-target modifications in the genome of a cell are reduced by at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80-fold, at least about 90-fold, at least about 100-fold, at least about 500-fold, or at least about 1000-fold, compared to a wild-type Cas9 or a Cas9 that does not contain a KFERQ motif or a KFERQ-like motif.

[0196] In some embodiments of the method, the off-target modification in the genome of the cell is less than about 5% of the total modifications in the genome made by recombinant Cas9 having a KFERQ motif or a KFERQ-like motif. In some embodiments of the method, the off-target modification in the genome of the cell is less than about 2% of the total modifications in the genome made by recombinant Cas9 having a KFERQ motif or a KFERQ-like motif. In some embodiments of the method, the off-target modification in the genome of the cell is less than about 1% of the total modifications in the genome made by recombinant Cas9 having a KFERQ motif or a KFERQ-like motif. As described herein, the off-target modification by wild-type Cas9 can be at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 6%, at least about 7%, at least about 8%, at least about 9%, or at least about 10% of the total modifications in the genome made by wild-type Cas9. In some embodiments, the off-target modification by recombinant Cas9 with KFERQ motif or KFERQ-like motif is less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, less than about 0.5%, or less than about 0.1% of the total modifications in the genome made by recombinant Cas9 with KFERQ motif or KFERQ-like motif. The amount of off-target modification may vary depending on the sequence of the guide polynucleotide and the target genome locus. In general, when using the same guide polynucleotide, recombinant Cas9 protein with KFERQ motif or KFERQ-like motif has reduced off-target modification compared to wild-type Cas9.

[0197] In some embodiments of the method, the target sequence is in a bacterial cell. In some embodiments, the bacterial cell is a laboratory strain. Examples of such cells include, but are not limited to, E. coli, S. aureus, V. cholerae, S. pneumoniae, B. subtilis, C. crescentus, M. genitalium, A. fischeri, Synechocystis, P. fluorescens, A. vinelandii, S. coelicolor. In some embodiments, the bacterial cell is comprised of a bacterium used in the preparation of food and / or beverages.Non-limiting exemplary genera of such cells include Acetobacter, Arthrobacter, Bacillus, Bifidobacterium, Brachybacterium, Brevibacterium, Carnobacterium, Corynebacterium, Enterococcus, Gluconacetobacter, Hafnia, Halomonas, Kocuria, Lactobacillus, (L. acetotolerans, L. acidipiscis, L. acidophilus, L. alimentarius, L. brevis, L. bucheri, L. casei, L. curvatus, L. fermentum, L. hilgardii, L. jensenii, L. kimchii, L. lactis, L. paracasei, L. Examples of suitable microbial bacteria include, but are not limited to, L. paracasei, L. plantarum and L. sakei), Leuconostoc, Microbacterium, Pediococcus, Propionibacterium, Weissella and Zymomonas.

[0198] In some embodiments of the method, the target cell is a eukaryotic cell. In some embodiments, the eukaryotic cell is an animal or human cell. In some embodiments, the eukaryotic cell is a human, rodent, or bovine cell line or cell line. Examples of such cells, cell lines or cell lines include, but are not limited to, mouse myeloma (NSO) cell lines, Chinese hamster ovary (CHO) cell lines, HT1080, H9, HepG2, MCF7, MDBK Jurkat, NIH3T3, PC12, BHK (baby hamster kidney cells), VERO, SP2 / 0, YB2 / 0, Y0, C127, L cells, COS, e.g., COS1 and COS7, QC1-3, HEK-293, VERO, PER.C6, HeLA, EB1, EB2, EB3, oncolytic or hybridoma cell lines. In some embodiments, the eukaryotic cell is a CHO cell line. In some embodiments, the eukaryotic cell is a CHO cell. In some embodiments, the cell is a CHO-K1 cell, a CHO-K1 SV cell, a DG44 CHO cell, a DUXB11 CHO cell, a CHOS, a CHO GS knockout cell, a CHO FUT8 GS knockout cell, a CHOZN, or a CHO-derived cell. A CHO GS knockout cell (e.g., a GSKO cell) is, for example, a CHO-K1 SV GS knockout cell. A CHO FUT8 knockout cell is, for example, a POTELLIGENT CHOK1 SV (Lonza Biologics, Inc.). The eukaryotic cell can also be an avian cell, cell line, or cell line, such as an EBX cell, EB14, EB24, EB26, EB66, or EBvl3.

[0199] In some embodiments, the eukaryotic cell is a human cell. In some embodiments, the human cell is a stem cell. The stem cell can be, for example, a pluripotent stem cell, such as an embryonic stem cell (ESC), an adult stem cell, an induced pluripotent stem cell (iPSC), a tissue-specific stem cell (e.g., a hematopoietic stem cell), and a mesenchymal stem cell (MSC). In some embodiments, the cell is a pluripotent stem cell. In some embodiments, the cell is an induced pluripotent stem cell. In some embodiments, the human cell is any differentiated form of a cell described herein. In some embodiments, the eukaryotic cell is a cell derived from any primary cell in culture.

[0200] In some embodiments, the eukaryotic cell is a hepatocyte, such as a human hepatocyte, an animal hepatocyte, or a non-parenchymal cell.For example, the eukaryotic cell can be an attached metabolic test human hepatocyte, an attached induction test human hepatocyte, an attached human hepatocyte, a suspension test human hepatocyte (for example, 10-donor and 20-donor pooled hepatocytes), a human hepatic Kupffer cell, a human hepatic stellate cell, a dog hepatocyte (for example, single and pooled beagle hepatocytes), a mouse hepatocyte (for example, CD-1 and C57BI / 6 hepatocytes), a rat hepatocyte (for example, Sprague-Dawley, Wistar Han and Wistar hepatocytes), a monkey hepatocyte (for example, Cynomolgus or Rhesus hepatocytes), a cat hepatocyte (for example, domestic shorthair hepatocytes) and a rabbit hepatocyte (for example, New Zealand White hepatocytes).

[0201] In some embodiments, the eukaryotic cell is a plant cell. For example, the plant cell may be from a crop plant, such as cassava, maize, sorghum, wheat, or rice. The plant cell may be from an algae, a tree, or a vegetable. The plant cell may be from a monocotyledonous or dicotyledonous plant, or from a crop or cereal plant, a productive plant, a fruit, or a vegetable. For example, the plant cell may be from a tree, such as a citrus tree, e.g., an orange, grapefruit or lemon tree; a peach or nectarine tree; an apple or pear tree; a nut tree, e.g., an almond or walnut or pistachio tree; a Solanum plant, e.g., a potato; a Brassica plant, a Lactuca plant, a Spinacia plant; a Capsicum plant; cotton, tobacco, asparagus, carrot, cabbage, broccoli, cauliflower, tomato, eggplant, pepper, lettuce, spinach, strawberry, blueberry, raspberry, blackberry, grape, coffee, cocoa, and the like.

[0202] In some embodiments of the method, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a cell. In some embodiments, the DNA binding segment of the guide polynucleotide is capable of hybridizing to a target sequence in a cell. In some embodiments, the DNA binding segment of the guide polynucleotide, e.g., the guide RNA, comprises a polynucleotide sequence that is complementary to a specific sequence in the target DNA. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a bacterial cell. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a eukaryotic cell. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a mammalian cell. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a human cell. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a pluripotent stem cell. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in an induced pluripotent stem cell. In some embodiments, the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in a plant cell.

[0203] In some embodiments, the guide sequence of the guide polynucleotide is at least about 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, or 20 nucleotides and up to about 20, 25, 30, 35, 40, 45, or 50 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 5 to about 50 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 6 to about 45 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 7 to about 40 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 8 to about 35 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 9 to about 30 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 10 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 12 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 14 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 16 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 18 to about 20 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 5 to about 10 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 6 to about 10 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 7 to about 10 nucleotides. In some embodiments, the guide sequence of the guide polynucleotide is about 8 to about 10 nucleotides. The length of the guide sequence can be determined by one of skill in the art using the guide sequence design tools described herein.

[0204] In some embodiments of the method, the CRISPR-Cas system is introduced into the cell via a delivery particle, vesicle, or viral vector. In some embodiments of the method, the CRISPR-Cas system comprising recombinant Cas9 and a guide polynucleotide is introduced into the cell via a delivery particle. In some embodiments of the method, the CRISPR-Cas system comprising recombinant Cas9 and a guide polynucleotide is introduced into the cell via a vesicle. In some embodiments of the method, the CRISPR-Cas system comprising recombinant Cas9 and a guide polynucleotide is introduced into the cell via a vector. In some embodiments of the method, the CRISPR-Cas system comprising recombinant Cas9 and a guide polynucleotide is introduced into the cell via a viral vector. In some embodiments of the method, polynucleotides encoding components of a complex comprising recombinant Cas9 are introduced on one or more vectors. Examples of delivery particles, vesicles, vectors, viral vectors, and methods of delivery to cells (e.g., transfection of vectors) are provided herein.

[0205] All references cited herein, e.g., patents, patent applications, articles, textbooks, etc., and the references cited therein, are incorporated herein by reference in their entirety, unless they are already cited herein.

[0206] Additional Exemplary Embodiments Embodiment 1 is a recombinant Cas9 protein comprising a modified KFERQ motif or a KFERQ-like motif.

[0207]

[0023] Embodiment 2 comprises a recombinant Cas9 protein of embodiment 1, wherein the modified KFERQ motif or KFERQ-like motif is selected from KFERQ (SEQ ID NO:24), RKVEQ (SEQ ID NO:25), QDLKF (SEQ ID NO:26), QRFFE (SEQ ID NO:27), NRVVD (SEQ ID NO:28), QRDKV (SEQ ID NO:29), QKILD (SEQ ID NO:30), QKKEL (SEQ ID NO:31), QFREL (SEQ ID NO:32), IKLDQ (SEQ ID NO:33), DVVRQ (SEQ ID NO:34), QRIVE (SEQ ID NO:35), VKELQ (SEQ ID NO:36), QKVFD (SEQ ID NO:37), QELLR (SEQ ID NO:38), VDKLN (SEQ ID NO:39), RIKEN (SEQ ID NO:40), NKKFE (SEQ ID NO:41), and combinations thereof.

[0208] Embodiment 3 comprises the recombinant Cas9 protein of embodiment 1 or 2, wherein the modified KFERQ-like motif is VDKLN (SEQ ID NO: 39).

[0209] Embodiment 4 comprises a recombinant Cas9 protein of embodiment 1, wherein the modified KFERQ motif or KFERQ-like motif is in the REC lobe of the Cas9 protein.

[0210] Embodiment 5 comprises a recombinant Cas9 protein of embodiment 2, wherein the modified KFERQ motif or KFERQ-like motif is in the Rec2 domain of the REC lobe.

[0211]

[0023] Embodiment 6 comprises a recombinant Cas9 protein of embodiment 1, wherein the modified KFERQ motif or KFERQ-like motif is in the HNH domain, the RuvC domain, or the PI domain of the recombinant Cas9 protein.

[0212]

[0023] Embodiment 7 comprises the recombinant Cas9 protein of any one of embodiments 1 to 4, wherein the modified KFERQ motif or KFERQ-like motif is in a surface-exposed region of the recombinant Cas9 protein.

[0213]

[0023] Embodiment 8 comprises the recombinant Cas9 protein of any one of embodiments 1 to 6, wherein the modified KFERQ motif or KFERQ-like motif is at the N-terminus or C-terminus of the recombinant Cas9 protein.

[0214]

[0023] Embodiment 9 is a recombinant Cas9 protein comprising one or more amino acid modifications of a wild-type Cas9 protein, wherein the amino acid modifications introduce a chaperone-mediated autophagy (CMA) targeting motif or an endosomal microautophagy (eMI) targeting motif into the Cas9 protein, and wherein the recombinant Cas9 protein is degraded in vivo at least 20% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not comprise the CMA or eMI targeting motif.

[0215]

[0023] Embodiment 10 comprises a recombinant Cas9 protein of embodiment 9, wherein the recombinant Cas9 protein is degraded in vivo at least 50% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not include a CMA or eMI targeting motif.

[0216]

[0023] Embodiment 11 comprises a recombinant Cas9 protein of embodiment 9 or 10, wherein the recombinant Cas9 protein is degraded in vivo at least 80% more rapidly than a wild-type Cas9 protein or a Cas9 protein that does not comprise a CMA or eMI targeting motif.

[0217]

[0033] Embodiment 12 is a recombinant Cas9 protein comprising one or more amino acid modifications in a wild-type Cas9 protein, wherein the recombinant Cas9 protein comprises a CMA targeting motif or an eMI targeting motif.

[0218]

[0046] Embodiment 13 includes a recombinant Cas9 protein of any one of embodiments 9 to 12, wherein the CMA targeting motif or eMI targeting motif is selected from KFERQ (SEQ ID NO:24), RKVEQ (SEQ ID NO:25), QDLKF (SEQ ID NO:26), QRFFE (SEQ ID NO:27), NRVVD (SEQ ID NO:28), QRDKV (SEQ ID NO:29), QKILD (SEQ ID NO:30), QKKEL (SEQ ID NO:31), QFREL (SEQ ID NO:32), IKLDQ (SEQ ID NO:33), DVVRQ (SEQ ID NO:34), QRIVE (SEQ ID NO:35), VKELQ (SEQ ID NO:36), QKVFD (SEQ ID NO:37), QELLR (SEQ ID NO:38), VDKLN (SEQ ID NO:39), RIKEN (SEQ ID NO:40), NKKFE (SEQ ID NO:41), and combinations thereof.

[0219] Embodiment 14 comprises the recombinant Cas9 protein of embodiment 13, wherein the CMA targeting motif or eMI targeting motif is VDKLN (SEQ ID NO: 39).

[0220]

[0031] Embodiment 15 comprises the recombinant Cas9 protein of any one of embodiments 9 to 14, wherein the one or more amino acid substitutions are in a surface-exposed region of the recombinant Cas9 protein.

[0221] Embodiment 16 includes a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9) comprising an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or combinations thereof, of SEQ ID NO:1.

[0222]

[0036] Embodiment 17 comprises the recombinant Cas9 protein of any one of embodiments 9 to 16, wherein the amino acid modifications comprise one or more of the following mutations: F185N; A547E / I548L; T560E / V561Q; D829L / I830R; L1087E / S1088Q; or P1199D / K1200Q.

[0223]

[0033] Embodiment 18 comprises the recombinant Cas9 protein of any one of embodiments 9 to 17, wherein the amino acid modification is a mutation at F185.

[0224] Embodiment 19 comprises the recombinant Cas9 protein of embodiment 18, wherein the mutation is F185N.

[0225] Embodiment 20 comprises the recombinant Cas9 protein of any one of embodiments 16 to 19, wherein the amino acid modification results in a CMA targeting motif or an eMI targeting motif.

[0226] Embodiment 21 comprises a recombinant Cas9 protein of any one of embodiments 9 to 20, wherein the recombinant Cas9 protein is at least 90% identical to SEQ ID NO:1.

[0227] Embodiment 22 is a recombinant Cas9 protein capable of binding to the heat shock cognate protein of 70 kD (HSC70).

[0228] Embodiment 23 is a recombinant Cas9 protein isolated from Streptococcus pyogenes (SpCas9), comprising a modified KFERQ motif or a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1.

[0229] Embodiment 24 comprises the recombinant Cas9 protein of embodiment 23, wherein the KFERQ-like motif is VDKLN (SEQ ID NO: 39).

[0230] Embodiment 25 comprises the recombinant Cas9 protein of any one of embodiments 1 to 24, further comprising a mutation at position D10, H840, or a combination thereof, of SEQ ID NO:1.

[0231] Embodiment 26 comprises the recombinant Cas9 protein of embodiment 25, wherein the mutations are selected from D10A or D10N; H840A, H840N or H840Y, and combinations thereof.

[0232] Embodiment 27 comprises a recombinant Cas9 protein according to any one of embodiments 1 to 26, wherein the recombinant Cas9 protein generates sticky ends.

[0233] Embodiment 28 comprises the recombinant Cas9 protein of any one of embodiments 1 to 27, further comprising one or more nuclear localization signals.

[0234] Embodiment 29 is a polynucleotide sequence encoding a recombinant Cas9 protein of any one of embodiments 1 to 28.

[0235] Embodiment 30 includes the polynucleotide sequence of embodiment 29, wherein the polynucleotide sequence is codon-optimized for expression in a eukaryotic cell.

[0236] Embodiment 31 is a non-naturally occurring CRISPR-Cas system comprising a recombinant Cas9 protein of any one of embodiments 1 to 28 and a guide polynucleotide that forms a complex with the recombinant Cas9 protein and includes a guide sequence.

[0237] Embodiment 32 is a non-naturally occurring CRISPR-Cas system comprising the polynucleotide sequence of embodiment 29 or 30 and a nucleotide sequence encoding a guide polynucleotide that forms a complex with a recombinant Cas9 protein and comprises a guide sequence.

[0238] Embodiment 33 is a non-naturally occurring CRISPR-Cas system comprising a regulatory element operably linked to the polynucleotide sequence of embodiment 29 or 30, and a guide polynucleotide that forms a complex with a recombinant Cas9 protein and comprises a guide sequence.

[0239] Embodiment 34 includes the system of any one of embodiments 31 to 33, wherein the guide sequence is linked to the direct repeat sequence.

[0240] Embodiment 35 includes the system of any one of embodiments 31 to 34, wherein the guide polynucleotide comprises a tracrRNA sequence.

[0241] Embodiment 36 includes the system of any one of embodiments 31 to 34, further comprising a separate polynucleotide comprising a tracrRNA sequence.

[0242] Embodiment 37 includes the system of any one of embodiments 31 to 35, wherein the polynucleotide sequence encoding the recombinant Cas9 protein and the guide polynucleotide are on a single vector.

[0243] Example 38 includes the system of embodiment 36, wherein the polynucleotide sequence encoding the recombinant Cas9 protein, the guide polynucleotide and the tracrRNA sequence are on a single vector.

[0244] Embodiment 39 is a delivery particle comprising the system of any one of embodiments 31-38.

[0245] Embodiment 40 is a vesicle comprising the system of any one of embodiments 31 to 38.

[0246] Embodiment 41 includes the vesicle of embodiment 40, wherein the vesicle is an exosome or a liposome.

[0247] Embodiment 42 is a viral vector comprising the system of any one of embodiments 31 to 38.

[0248] Embodiment 43 includes the viral vector of embodiment 42, wherein the viral vector is an adenovirus, a lentivirus, or an adeno-associated virus.

[0249] Embodiment 44 is a method for providing a site-specific modification in a target sequence in the genome of a cell, comprising introducing into the cell a CRISPR-Cas system according to any one of embodiments 31 to 38.

[0250] Embodiment 45 includes the method of embodiment 44, wherein the modification includes a deletion of at least a portion of the target sequence.

[0251] Embodiment 46 includes the method of embodiment 44, wherein the modification comprises a mutation in the target sequence.

[0252] Example 47 includes the method of embodiment 44, wherein the modification includes inserting a sequence of interest (SoI) in the target sequence.

[0253]

[0046] Embodiment 48 includes the method of any one of embodiments 44 to 47, wherein the off-target modifications in the genome of the cell are less than about 5% of the modifications in the genome made by the recombinant Cas9.

[0254]

[0046] Embodiment 49 includes the method of any one of embodiments 44 to 48, wherein the off-target modifications in the genome of the cell are less than about 2% of the modifications in the genome made by the recombinant Cas9.

[0255]

[0036] Embodiment 50 includes the method of any one of embodiments 44 to 49, wherein the off-target modifications in the genome of the cell are less than about 1% of the modifications in the genome made by the recombinant Cas9.

[0256]

[0023] Embodiment 51 includes the method of any one of embodiments 44 to 50, wherein off-target modifications in the genome of the cell are reduced by at least about 50% compared to wild-type CRISPR-Cas9 or a Cas9 that does not contain a KFERQ motif or a KFERQ-like motif.

[0257] Embodiment 52 includes the method of any one of embodiments 44 to 51, wherein the cell is a bacterial cell, a mammalian cell, or a plant cell.

[0258] Embodiment 53 includes the method of embodiment 52, wherein the cell is a human cell.

[0259] Embodiment 54 includes the method of embodiment 53, wherein the cells are pluripotent stem cells.

[0260] Embodiment 55 includes the method of embodiment 54, wherein the cells are induced pluripotent stem cells.

[0261] Embodiment 56 includes the method of any one of embodiments 44 to 55, wherein the guide sequence of the guide polynucleotide is capable of hybridizing to a target sequence in the genome of the cell.

[0262] Embodiment 57 includes the method of any one of embodiments 44 to 56, wherein the CRISPR-Cas system is introduced into the cell via a delivery particle, vesicle, or viral vector.

[0263] array Table 4 below lists the sequences provided herein.

[0264] [Table 2]

[0265] SpCas9 - Cas9 from Streptococcus pyogenes (SEQ ID NO: 1) [ka]

[0266] FaDe-SpCas9-SpCas9 with F185N mutation (SEQ ID NO: 2) [ka]

[0267] SpCas9 nucleotide sequence (SEQ ID NO:3) [ka] [ka] [ka]

[0268] FaDe-SpCas9 nucleotide sequence (SEQ ID NO:4) [ka] [ka]

[0269] SpCas9REC lobe: Amino acids 61 to 718 of SpCas9 (SEQ ID NO:5) [ka]

[0270] SpCas9 NUC lobe 1: Amino acids 1 to 60 of SpCas9 (SEQ ID NO: 6) MDKKYSIGLDIGTNSVGWAVITDDYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE

[0271] SpCas9 NUC lobe 2: Amino acids 719 to 1368 of SpCas9 (SEQ ID NO: 7) [ka]

[0272] SpCas9BH domain: amino acids 61 to 94 of SpCas9 (SEQ ID NO: 8) ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVD

[0273] SpCas9 Rec1 domain 1: Amino acids 95 to 180 of SpCas9 (SEQ ID NO: 9) [ka]

[0274] SpCas9 Rec1 domain 2: Amino acids 309 to 718 of SpCas9 (SEQ ID NO: 10) [ka]

[0275] SpCas9 Rec2 domain: amino acids 181 to 308 of SpCas9 (SEQ ID NO: 11) [ka]

[0276] SpCas9 RuvC I domain: Amino acids 1 to 59 of SpCas9 (SEQ ID NO: 12) MDKKYSIGLDIGTNSVGWAVITDDYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETA

[0277] SpCas9 RuvC II domain: amino acids 718 to 774 of SpCas9 (SEQ ID NO: 13) DSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQ

[0278] SpCas9 RuvC III domain: Amino acids 909 to 1098 of SpCas9 (SEQ ID NO: 14) [ka]

[0279] SpCas9 HNH domain: Amino acids 775 to 908 of SpCas9 (SEQ ID NO: 15) [ka]

[0280] SpCas9 PI domain: amino acids 1099 to 1368 of SpCas9 (SEQ ID NO: 16) [ka]

[0281] Cas9 from Streptococcus thermophilus (SEQ ID NO: 17) [ka]

[0282] Cas9 from Streptococcus dysgalactiae (SEQ ID NO: 18) [ka]

[0283] Cas9 from Streptococcus mutans (SEQ ID NO: 19) [ka]

[0284] Cas9 from Listeria innocua (SEQ ID NO: 20) [ka]

[0285] Cas9 from Staphylococcus aureus (SEQ ID NO: 21) [ka]

[0286] Cas9 from Klebsiella pneumoniae (SEQ ID NO: 22) [ka]

[0287] FnCas9 - Cas9 from Francisella novicida (SEQ ID NO: 23) [ka]

[0288] [Table 3]

[0289] [Table 4]

[0290] [Table 5]

[0291] [Table 6] EXAMPLES

[0292] Materials and Methods The following materials and methods were used in the experiments described in the Examples: Oligonucleotide and guide RNA synthesis were provided by Sigma and Synthego. Reagents and kits were obtained from ThermoFisher unless otherwise stated.

[0293] List of Reagents and Kits Subcellular fractionation kit; EDTA-free protease inhibitor cocktail (Sigma); NOVEX NUPAGE protein gel, Bis-Tris 4-12%, 1.5 mm thick, 10 wells; 4× Laemmli buffer (BioRad); NUPAGE MOPS 20x SDS running buffer; NUPAGE 20× transfer buffer; NOVEX Sharp prestained protein standard molecular weight markers; Nitrocellulose precut blotting membrane, pore size 0.45 μm; Primary antibody: Cas9 mouse monoclonal (Abcam); monoclonal ANTI-FLAG M2 antibody (Sigma); monoclonal anti-α-tubulin (Sigma); Secondary antibody: IRDYE 680RD Donkey anti-mouse IgG (H+L), 0.1mg (Li-COR); HSC70 mouse monoclonal (Santa Cruz); Protein A Sepharose (Abcam); REVERTAID RT Kit; DNase I, RNase free; Phusion Flash High-Fidelity PCR Master Mix; Q5 Hot Start High-Fidelity 2× Master Mix; Gentra Puregene kit (Qiagen); Lipofectamine LTX Plus (Invitrogen); FUGENE HD (Promega) Cas9 (CRISPR-associated protein 9) ELISA kit (Cell Biolabs) Cycloheximide CHX (Sigma) Leupeptin (SIGMA) Anti-CRISPR-Cas9 antibody [EPR19799](ab203933) Anti-Ki67 antibody (ab15580) Anti-cleaved caspase-3 antibody (ab2302) Anti-γH2A.X (phospho S139) antibody [9F3] (ab26350) Anti-CD8α antibody [144B] (ab17147) Anti-CD4 antibody [EPR19514] - low endotoxin, azide-free (ab221775)

[0294] The primers used in the experiments described herein are listed in Table 2.

[0295] [Table 7]

[0296] The guide RNAs used in the experiments described herein are listed in Table 3.

[0297] [Table 8]

[0298] Experimental procedure Cell culture. SV-HUC-1 cells were cultured in F-12K medium (Kaighn's Modification of Ham's) supplemented with 10% (v / v) fetal bovine serum (Gibco) and 1% antibiotics (100 U / mL penicillin and 100 mg / L streptomycin sulfate).

[0299] HEK293 cells were cultured in Dulbecco's modified Eagle's medium (Invitrogen) supplemented with 10% (v / v) fetal bovine serum (Gibco) and 1% antibiotics (100 U / mL penicillin and 100 mg / L streptomycin sulfate). All cells were incubated at 37 °C for 24 h at 37 °C in a 5% CO 2 The plants were grown in a humid environment containing 0.1% CO 2 at 37°C.

[0300] Neuro-2a cells were cultured in Eagle's minimum essential medium (EMEM) supplemented with 10% (v / v) fetal bovine serum (Gibco) and 1% antibiotics (100 U / mL penicillin and 100 mg / L streptomycin sulfate).

[0301] HCT cells were cultured in RPMI-1640 medium (ATCC 30-2001) supplemented with 10% (v / v) fetal bovine serum (Gibco) and 1% antibiotics (100 U / mL penicillin and 100 mg / L streptomycin sulfate).

[0302] Human iPSCs were cultured in CELLARTIS DEF-CS basal medium supplemented with GF-1 supplement (diluted 1:333), GF-2 supplement (diluted 1:1000) and GF-3 supplement (diluted 1:1000).

[0303] Plasmid Mutations. Mutations were performed using gene fragments and synthesis of G-Blocks.

[0304] Example 1. Cas9 vs. FaDe-Cas9: Analysis of Protein Turnover Plasmid transfection. Immortalized human or mouse cell lines were transfected with plasmids encoding Cas9 or FaDe-Cas9 (FaDe-Cas9: wild-type Cas9 with F185N mutation; shown as KFERQ-Cas9 in FIG. 5A) by reverse transfection. 3 μg of plasmid (Cas9 or FaDe-Cas9) was mixed with transfection agent (Lipofectamine LTX) in OPTIMEM medium and incubated for 25 min in a 6-well plate. After incubation, cells were detached and counted (50×10 4 ), resuspended in 2 mL of complete medium and added to the wells containing the transfection reagent mix. Cells were analyzed for GFP expression 24 hours post-transfection to assess transfection efficiency and harvested at various time points for Western blotting.

[0305] Cell lysis and protein extraction for Western blot. Transfected cells were harvested with trypsin and centrifuged at 2000 rpm for 5 min. After washing with cold PBS 1X, the cell pellet was lysed in cold "two-step lysis buffer" supplemented with protease inhibitors (two-step lysis buffer: 10 mM KCl, 20 mM Tris HCl pH 7.4, 10 mM MgCl 2The cells were suspended in 100 mM NaCl (pH 7.0, 20 mM EDTA, 10% glycerol, 0.8% TRITON), vortexed, sonicated and incubated on ice for 20 min. The sonication program included two treatments: maximum power 20.0 - duty cycle 40.0 - cycle burst 50 - duration 15 sec. The cell lysate was then incubated with 420 nM NaCl for 5 min to separate proteins from nucleic acids and clarified by centrifugation at 15,000 rpm for 30 min at 4°C. After centrifugation, the pellet containing DNA and membranes was discarded and the protein concentration of the supernatant was measured by NANODROP.

[0306] Immunoblotting. Clarified lysates from cells transfected as described above were mixed with loading buffer (10% β-mercaptoethanol) and boiled for 8 min. Samples were loaded onto a NUPAGE Bis-Tris SDS protein gel and separated by running at 200V (MOPS 1X) for 40 min. Protein gels were subsequently transferred to nitrocellulose membranes at 35V using NUPAGE transfer buffer supplemented with 20% methanol (tank transfer). Membranes were blocked for 1 h in 1% BSA and incubated with primary antibodies at 4°C. After washing three times with PBS TWEEN 0.2%, membranes were incubated with secondary antibodies (1:10000 in 1% BSA) for 1 h at room temperature and then washed three times with PBS TWEEN 0.2%. Detection was performed using an ODYSSEY imaging system.

[0307] The results are shown in Figures 6A, 6B and 7. Analysis of Cas9 vs. FaDe-Cas9 showed that the expression of FaDe-Cas9 was below the detection level of Western blot (Figure 6A). As shown in Figure 6B, the mutations in Cas9 to generate FaDe-Cas9 do not impair Cas9 antibody specificity. As shown in Figure 7A, FaDe-Cas9 showed very low expression within a short time window compared to Cas9. Cas9 was detectable by anti-Cas9 at increasing levels from 8 to 72 hours post-transfection, whereas FaDe-Cas9 was not detected by anti-Cas9 even 8 hours post-transfection.

[0308] Analysis of protein turnover by expression of GFP fusion proteins. 7 × 10 cells in a 96-well plate 3 HEK293 cells seeded at 100 ng of dual promoter-driven reporter vectors encoding Cas9-GFP fusions or FaDe-Cas9-GFp fusions and mCherry expressed under their own promoters were transfected with FUGENE HD transfection reagent. The plates were then placed in an INCUCYTE to monitor the in vivo levels of Cas9 and FaDe-Cas9 proteins by measuring the GFP fluorescence signal over time. Transfection efficiency was assessed by analyzing mCherry fluorescence. See Figure 8 for a diagram of the dual reporter vectors transfected into cells for transfection efficiency assessment.

[0309] The results are shown in Figures 9-11. Transfection efficiencies were comparable (as measured by mCherry fluorescence, Figure 10A), but the FaDe-Cas9-GFp fusion showed lower expression levels compared to the Cas9-GFP fusion (as measured by GFP fluorescence, Figure 10B). Figure 12 shows the results of similar Cas9 and FaDe-Cas9 protein turnover experiments in HEK, HCT, hIPSc and Neuro-2a cells, indicating that the high turnover of FaDe-Cas9 is independent of cell type.

[0310] Assessment of mRNA stability by semi-quantitative RT-PCR. RNA was isolated from SVHUC1 cells transfected with plasmids encoding Cas9 or FaDe-Cas9. Cell pellets harvested at various time points were suspended in 1 mL of TRIZOL. After 5 min at RT, 200 μL of chloroform was added, followed by 3 min of incubation at room temperature. Samples were centrifuged at 15,000 rpm for 15 min at 4°C, and the aqueous phase (containing RNA) was collected in a separate tube. RNA was then precipitated by adding 500 μL of isopropanol to the aqueous phase, incubating at room temperature for 10 min, and centrifuging at 15,000 rpm. RNA was collected as a gel-like pellet at the bottom, washed with 70% ethanol, and dissolved in RNase-free water. RNA samples were treated with DNase in a 10 μL reaction containing 1 μg of RNA, 1× DNase buffer, as well as 1 μL of DNase with ultrapure water. The mixture was incubated at 37°C for 30 min, and the RNA concentration was measured by NANODROP.

[0311] cDNA synthesis. Reactions were carried out in 20 μL reactions containing 500 ng RNA, 1 μL random hexamer primer, 4 μL 5× reaction buffer, 1 μL RIBOLOCK RNase inhibitor (20 U / μL), 2 μL 10 mM dNTP mix, 1 μL REVERTAID RT (200 U / μL) and nuclease-free water. Reactions were incubated at 42° C. for 60 min and terminated by heating at 70° C. for 5 min.

[0312] PCR. PCR was performed with 1 μL of Q5 Hot Start High-Fidelity 2× Master Mix in a reaction volume of 20 μL (0.5 μL of forward and reverse primers (10 μM), 1 μL of cDNA and water). Each reaction was performed in triplicate. PCR was performed as follows: heat denaturation at 95° C. for 1 min, followed by 24 cycles of heat denaturation at 95° C. for 30 s, annealing at 58° C. for 30 s, extension at 72° C. for 30 s and a final extension for 2 min.

[0313] The results are shown in Figure 7B, which shows similar mRNA transcription levels from Cas9 and FaDe-Cas9. These data demonstrate that the transfection efficiency of Cas9 and FaDe-Cas9 was comparable.

[0314] Example 2. Assessment of the role of CMA on protein turnover and subcellular location of FaDe-Cas9. Co-immunoprecipitation of Cas9-HSC70. SV-HUC-1 cells seeded at 70% confluency were transfected with plasmids encoding Cas9 or FaDe-Cas9. Cells were harvested 48 h post-transfection and lysed in CO-IP lysis buffer (140 mM KCl, 3 mM MgCl 2 , 0.5% NONIDET P-40, 20 mM HEPES pH 7.4, 1 mM EDTA, 1.5 mM EGTA, protease inhibitors (EDTA-free protease inhibitor cocktail). The cell pellet was suspended in cold freshly prepared lysis buffer and passed 5-6 times through a 25-gauge needle with a 1 mL syringe. The lysate was incubated on ice for 30 min and centrifuged at 15,000 rpm for 20 min at 4 °C. The clarified lysate was collected in a new tube and analyzed by NANODROP to measure protein concentration. Immunoprecipitation of Cas9 was performed on 800 μg of clarified lysate diluted in lysis buffer and incubated overnight at 4 °C with Cas9 primary antibody (1:100). The next day, immune complexes were immobilized on 50 μL of protein G-Sepharose beads on a tumbling wheel for 4 h at 4 °C. The beads were then washed with CO-IP lysis buffer (3x), resuspended in 30 μL of SDS sample buffer, boiled for 5 min, and subjected to Western blotting with HSC70 primary antibody (1:1000).

[0315] The results are shown in Figure 13A. Co-immunoprecipitation showed that the CMA chaperone HSC70 interacted with FaDe-Cas9 but not with Cas9. As shown by anti-HSC70 blot, FaDe-Cas9, but not Cas9, was detected using anti-HSC70 antibody.

[0316] Colocalization of FaDe-Lamp2A. 7 × 10 3 HEK293 cells seeded at a cell density of 100 ng were co-transfected with 50 ng of Cas9-GFP fusion or FaDe-Cas9-GFp fusion and 30 ng of Lamp2A-dsRed fusion. 24 hours after transfection, cells were analyzed by INCUCYTE zoom. For an overview of the plasmids transfected into cells, see Figure 14.

[0317] The results are shown in Figures 13B and 15. GFP-tagged Cas9 or FaDe-Cas9 exhibited green fluorescence, while mCherry-tagged Lamp2A showed red fluorescence. Visualization of immunofluorescence signals showed FaDe-Cas9 colocalizing with lysosomal proteins and the CMA regulator Lamp2A in the cytosol. Colocalization with Lamp2A suggests active degradation.

[0318] Intracellular protein fractionation. Cells were harvested with trypsin-EDTA followed by centrifugation at 500 × g for 5 min. Cell pellets were washed with ice-cold PBS, dried and the supernatant was removed and discarded. For cytoplasmic extracts, ice-cold cell extraction buffer (CEB) containing protease inhibitors was added to the cell pellet and incubated at 4 °C for 10 min. The lysate was centrifuged at 500 × g for 5 min. The supernatant (cytoplasmic extract) was then transferred to a clean tube pre-chilled on ice. Membranes were extracted by adding ice-cold membrane extraction buffer (MEB) containing protease inhibitors to the pellet and incubated at 4 °C for 10 min followed by centrifugation at 3000 × g for 5 min. For nuclear extraction, 5 μL of 100 mM CaCl per 100 μL was added. 2Ice-cold nuclear extraction buffer (NEB) containing protease inhibitors plus 3 μL of micrococcal nuclease (300 units) was added to the pellet and incubated for 10 min at 4° C. followed by 5 min at room temperature. The lysate was then clarified by centrifugation at 15,000 rpm for 10 min at 4° C. Protein concentrations were quantified by measuring protein extracted from each cellular compartment and resolved on a NUPAGE Bis-Tris SDS protein gel.

[0319] The results of subcellular localization of Cas9 and FaDe-Cas9 48 hours after transfection are shown in Figure 16. Cas9 and FaDe-Cas9 were found in the same subcellular location, indicating that the F185N mutation in FaDe-Cas9 did not affect compartmentalization.

[0320] Example 3. Analysis of enzyme activity, on-target and off-target indels Genomic DNA extraction. Genomic DNA extraction was performed using the Gentra Puregene kit. The cell pellet was suspended in 300 μL of lysis buffer and incubated on ice for 5 min after addition of protein precipitation buffer (100 μL). The lysate was then centrifuged at 14,000 rpm for 10 min and the supernatant was mixed with 300 μL of isopropanol for DNA precipitation followed by centrifugation at 14,000 rpm for 10 min. The DNA pellet was washed with 100 μL of 70% ethanol and suspended in 30 μL of water. The DNA concentration was measured with NANODROP.

[0321] Surveyor Nuclease Assay. PCR: PCR was performed in a total volume of 20 μL containing 100 ng of gDNA and 1 μL of 2× Master Mix (PHUSION Flash High-Fidelity PCR) plus 1 μL of forward and reverse primers (10 μM). PCR was performed as follows: heat denaturation at 95° C. for 3 min, followed by 35 cycles of heat denaturation at 95° C. for 5 s, annealing at 58° C. for 30 s, and extension at 72° C. (1 min / 1,000 bps) and a final extension for 5 min.

[0322] Digestion: PCR products were heat denatured by heating to 99° C. for 5 min and subsequently reannealed for heteroduplex formation by cooling to 65° C. for 30 min and 23° C. for 30 min.

[0323] Hybridized heteroduplexes or homoduplexes were treated with Surveyor nuclease (also known as CEL nuclease), which recognizes mismatches present in heteroduplex DNA and cleaves both strands on the 3' side of the mismatch distortion. Thus, 20 μL of unpurified PCR product (approximately 250 ng) in a 50 μL reaction volume was digested with 1 μL of surveyor enzyme + 1 μL of enhancer for 20 min at 42° C. 10 μL of treated DNA was then separated by electrophoresis on a 10% acrylamide gel for 40 min.

[0324] The results of an assay to determine the nuclease efficiency of Cas9 and FaDe-Cas9 in HEK cells are shown in Figure 17A. Cas9 and FaDe-Cas9 nuclease activity were comparable, as shown by the gel bands indicating "cut" DNA. Next-generation sequencing analysis shown in Figure 17B demonstrated comparable nuclease efficiency for Cas9 (12.8%) and FaDe-Cas9 (16.5%). Figure 18 showed that FaDe-Cas9 had a similar level of nuclease activity as Cas9 in hiPSCs.

[0325] EMX1 / FANCF1 off-target analysis. HEK293 cells were cultured at 60 × 10 4Cells were seeded at a density of 1000 ng / ml into 12-well plates and co-transfected with 800 ng of plasmid encoding Cas9 or FaDe-Cas9 and 200 ng of plasmid encoding gRNA (EMX1 or FANCF1). Transfection was performed using FUGENE HD transfection reagent. Cells were harvested 72 hours post-transfection and lysed for genomic DNA extraction. PCR amplification of on-target and off-target regions was performed with 100 ng of gDNA, 1 μl of PHUSION FLASH High-Fidelity PCR Master Mix and adapter-fused forward and reverse primers designed based on the manufacturer's recommendations from Illumina. PCR was performed as follows: heat denaturation at 95°C for 1 min, followed by 30 cycles of heat denaturation at 95°C for 30 s, annealing at 58°C for 30 s, extension at 72°C for 30 s and a final extension for 2 min. PCR products were purified and analyzed by next-generation sequencing.

[0326] The results are shown in Figure 19. FaDe-Cas9 had slightly lower on-target modification compared to Cas9, but the off-target modification of FaDe-Cas9 was significantly reduced compared to Cas9. Thus, FaDe-Cas9 showed an increased efficiency of normalized on-target modification compared to Cas9.

[0327] Ribonucleoprotein (RNP) electroporation. Cas9 / RNP precomplexing: In a 1.5 mL tube, 100 pmol of Cas9 or FaDe-Cas9 was mixed with 120 pmol of synthetic dual gRNA in 10 μL of 1× Cas9 buffer and incubated at room temperature for 20 min. 4HEK293 cells at a density of 1000 were suspended in 20 μL of electroporation buffer SF and incubated with the RNP complex for 2 min. The cells were electroporated using a 4D NUCLEOFECTOR (Lonza). After nucleofection, the cells were seeded in 12-well plates with 1 mL of complete medium (DMEM) and harvested at various time points (3 h, 6 h, 10 h, 24 h).

[0328] RNP transfection. Human iPSCs were transfected at 20 × 10 4 Cells were seeded at a density of 1000 x gRNAs and transfected with increasing concentrations of Cas9 or FaDe-Cas9 and 3 μM dual gRNA. Transfections were performed with Lipofectamine CRISPRMAX transfection reagent. 48 hours post-infection, cells were lysed for genomic DNA extraction and deletions were verified by PCR.

[0329] Example 4. Effect of Cas9 expression on cells Example 4.1 Human urothelial cells (SVHUC-1) were transfected with wild-type Cas9. Cell clones containing Cas9 were verified by ddPCR (Figure 1A, top panel). Four weeks after generation of Cas9 stable cell lines, cells were expanded and counted at 24, 48 and 72 hours. Cell counts from wild-type cells (no Cas9), clone 1 (heterotypic Cas9 integration) and clone 3 (homotypic Cas9 integration) showed a decreasing trend (Figure 1A, bottom panel).

[0330] Example 4.2 Mice were transfected with wild-type Cas9 on a doxycycline-inducible promoter. After induction, mice ("iCas dox") were weighed and compared to wild-type mice ("WT water"), wild-type mice with doxycycline ("WT dox"), and mice transfected with Cas9 but not expressing Cas9 ("iCas water"). The results in FIG. 1B show that mice transfected with and expressing wild-type Cas9 exhibit reduced body weight compared to mice not expressing Cas9.

[0331] Example 4.3 Human induced pluripotent stem cells (hiPSCs) were transiently transfected with wild-type Cas9. Microscopic images of the cells were obtained 5 weeks after transient expression of Cas9. As shown in Figure 2, hiPSCs lose their undifferentiated phenotype when transiently expressing Cas9.

[0332] Example 5. Cas9 vs. FaDe-Cas9 analysis of protein turnover Example 5.1 Intracellular protein levels of Cas9 and FaDe-Cas9 measured by ELISA assay 20×10 4HEK293 cells at a density of 1000 μl were suspended in 20 μl of electroporation buffer SF and incubated with the RNP complex for 2 min. The cells were electroporated using a 4D nucleofector (4D-Nucleofector Core Unit: Lonza, AAF-1002B; 4D-Nucleofector X Unit: AAF-1002X; Lonza). After nucleofection, the cells were seeded in 12-well plates containing 1 mL of complete medium (DMEM) and harvested at 24 h. Cells were lysed and protein levels were analyzed by ELISA assay of a commercial kit (Cell Biolabs) according to the manufacturer's instructions: cell or tissue lysates were sonicated or homogenized in a lysis buffer such as RIPA buffer (25 mM Tris·HCl pH 7.6, 150 mM NaCl, 1% NP-40, 1% sodium deoxycholate, 0.1% SDS) and centrifuged at 10,000 × g for 10 min at 4°C before assay.

[0333] The results are shown in Figure 24A. RNP electroporation at 7.5 μg / 10^5 cells restored approximately 5% intracellular Cas9 at 24 hours (compared to <0.1% for FaDe-Cas9). FaDe-Cas9 was >97% less abundant in cells 24 hours after electroporation.

[0334] Example 5.2 Measurement of Protein Turnover and Degradation HEK293 cells were transfected with GFP-fused Cas9 or FaDe-Cas9 at 30 × 10 4 The cells were transfected at a density of 1000 x g / ml and GFP expression was analyzed over time in incucyte cells.

[0335] Twelve hours after transfection, cells were treated with CHX (10 μg / ml) to inhibit protein synthesis and the degraded protein of Cas9 versus FaDe-Cas9 was measured according to the GFP signal, compared to untreated cells.

[0336] GFP expression reduced the abundance of FaDe-Cas9 and never reached the intracellular protein levels observed with Cas9 (Figure 24B). Cells exposed to the protein translation inhibitor cycloheximide (CHX) showed a time-dependent decrease in FaDe-Cas9 levels, in contrast to Cas9 protein levels that remained constant over time (Figure 24C).

[0337] Example 6. Role of CMA in high protein turnover of FaDe-Cas9 and subcellular localization of the protein Example 6.1 Lamp2A knockdown HEK293 cells were transfected at 7 × 10 ng / ml with GFP-fusion expression vectors Cas9 or FaDe-Cas9, plus Ds-Red lamp2a vector (2:1), plus gRNA (3:1) and increasing doses of siRNA (10–20–40–60–90–100 ng) using RNAiMAX transfection reagent and OPTIMEM. 3 As a control, HEK293 cells were co-transfected with scrambled siRNA. Transfected cells were monitored over time with incucyte zoom, and the KD lamp2a efficiency and protein accumulation were analyzed by GFP signal.

[0338] To inhibit CMA, the expression of the lysosomal receptor Lampa2a was reduced by siRNA. Transfection of siRNA resulted in a dose-dependent reduction of Lamp2A receptor (Fig. 25A / B), whereas the protein level of Cas9 was unchanged (Fig. 25A), whereas FaDe-Cas9 showed a dose-dependent accumulation, suggesting that its degradation was CMA-dependent (Fig. 25B).

[0339] Example 6.2 Co-immunoprecipitation of Cas9-HSC70. HEK293s cells (50 million) were electroporated with 20 μg of FLAG-tagged Cas9 or FaDe-Cas9 using MaxCyte. 24 hours after electroporation, cells were treated with 100 μM leupeptin (a cathepsin B inhibitor) to temporarily block lysosomal degradation. Cells were harvested 48 hours after electroporation and lysed in CO-IP lysis buffer (140 mM KCl, 3 mM MgCl2, 0.5% Nonidet P-40, 20 mM Hepes pH 7.4, 1 mM EDTA, 1.5 mM EGTA, protease inhibitors (EDTA-free protease inhibitor cocktail - Sigma). Cell pellets were suspended in cold freshly prepared lysis buffer and passed 5-6 times through a 25 Ga needle using a 1 mL syringe. Lysates were incubated on ice for 30 min and centrifuged at 15,000 for 20 min at 4°C. Clarified lysates were collected in a new tube and analyzed by Nanodrop to measure protein concentration. Immunoprecipitation of Cas9 was performed using FLAG primary antibody (anti-FLAG F7425 SIGMA) diluted in lysis buffer and incubated overnight at 4°C. 1:500). The next day, immune complexes were immobilized on protein G-Sepharose beads (50 μL) on a tumbling wheel for 4 hours at 4°C. Beads were washed (3x) with CO-IP lysis buffer, resuspended in SDS sample buffer (30 μL), boiled for 5 minutes, and subjected to Western blotting with Cas9 and HSC70 primary antibodies (1:1000). 30 μg of lysate was used as INPUT to establish the total amount of protein.

[0340] Immunoprecipitation demonstrated that FaDe-Cas9 has high affinity binding to the master regulator of chaperone-mediated autophagy HSC70. The results are shown in Figure 26.

[0341] Example 7. Cas9 vs. FaDe-Cas9 in vivo mouse model Example 7.1 Adenovirus Constructs Adenoviruses expressing Cas9 or FaDe-Cas9 and gRNA (Ad-Cas9-gMH and Ad-Cas9-gP and Ad-FaDe-Cas9-gMH and Ad-FaDe-Cas9-gP) were generated by Vector Biolabs (Malvern). Adv Cas9 / FaDe and gRNA were expressed from chicken β-actin hybrid (CBh) and U6 promoters, respectively, in a replication-deficient adenovirus-serotype 5 (dE1 / E3) backbone. Negative control adenoviruses expressing Cas9 and GFP from the CBh and CMV promoters, respectively, but no gRNA (Ad-Cas9-GFP and Ad-FaDe-Cas9-GFP) were also generated.

[0342] Example 7.2 In vivo On / Off Target Analysis For in vivo off-target editing analysis, a broad-host-range guide RNA (gP) targeting the mouse PCSK9 locus was selected for its high potential to induce multiple off-target mutations in the mouse genome (Figure 27A).

[0343] Male mice aged 9–11 weeks were inoculated with 1 × 10 IgG in 200 μL of phosphate-buffered saline. 9 They received tail vein injections of infectious unit (IFU) doses of adenovirus (Ad-Cas9-gp or Ad-FaDe-Cas9-gp or Ad-Cas9-GFP or Ad-FaDe-Cas9-GFP). Peripheral blood was sampled before virus administration (baseline), 1 week after virus administration, and at termination (4 days or 3 weeks after virus administration).

[0344] On the 7th day after treatment, genomic DNA from the liver tissue of mice injected with adenovirus was extracted for indel analysis.For targeted deep sequencing, off-targets were identified by selecting sites with read counts of more than 50% of on-target and various lower ranking sites (including up to 6 mismatches compared to on-target) by CIRCLE-seq.Evaluation of gene editing frequency at gP on-target + 9 off-target sites in mouse model showed that 4 out of 9 different off-target sites showed significantly reduced gene editing by FaDe-Cas9 compared to Cas9 (Figure 27B).

[0345] Example 7.3 Next Generation Sequencing (NGS) PCR products were purified using magnetic beads, quantified using the QuantiFlor dsDNA System kit (Promega), normalized to 10 ng / μL per amplicon, and pooled. The pooled samples were end-repaired and A-tailed using End Prep Enzyme Mix and reaction buffer from the NEBNext Ultra II DNA Library Prep kit for Illumina, and ligated to Illumina TruSeq adapters using the Ligation Master Mix and Ligation Enhancer from the same kit. Library samples were then purified with magnetic beads, size-selected using PEG / NaCl SPRI solution (KAPA Biosystems), quantified using droplet digital PCR (BioRad), and loaded onto an Illumina MiSeq for deep sequencing.

[0346] Example 7.4 In vivo genome editing and viability assessment For in vivo Pcsk9 gene editing, 9-11 week old humanized PCSK9 mice (PCSK9KIKO) harboring a single allele of mouse or human PSCK9 received tail vein injection with adenovirus (Ad-Cas9-gMH or Ad-FaDe-Cas9-gMH and Ad-Cas9-GFP or Ad-FaDe-Cas9-GFP) at a dose of 1 × 109 infectious units (IFU) in 200 μL diluted in phosphate buffered saline. Seven days after treatment, genomic DNA from liver tissue of mice injected with adenovirus was extracted for indel analysis by NGS on the human and mouse PCSK9 locus, respectively. Liver lobes were mounted in paraffin blocks and stained for hematoxylin & eosin (H&E), mitotic markers Ki6, Cas9, cleaved caspase 3, p-H2AX and CD4 / CD8.

[0347] Mice liver exposed to FaDe-Cas9 showed higher gene editing as a result of its rapid degradation in the liver tissue, which therefore leads to higher survival rate of edited cells as shown in Figure 28A. The rapid turnover of FaDe-Cas9 in vivo resulted in lower hepatotoxicity compared to Cas9, as confirmed by unchanged liver glycogen, nearly undetectable mitotic marker Ki67, less infiltrates and minimal cell necrosis (Figure 28B / C).

[0348] Furthermore, viral-mediated expression of FaDe-Cas9 in vivo resulted in a lower cytotoxic T-lymphocyte immune response (Figure 29). One week after AdV delivery, Cas9 was still highly expressed in hepatocytes, but FaDe-Cas9 was undetectable (A, E). The shorter latency of FaDe-Cas9 resulted in lower levels of apoptosis (cleaved caspase 3 IHC; B, F) and DNA double-strand breaks (phospho-H2AX IHC; C, G) in hepatocytes. The immune response to Cas9 delivery in mouse liver was characterized by a moderate number of CD4 + (Memory) lymphocytes and large numbers of CD8 +(cytotoxic) lymphocytes, the latter of which were significantly reduced in livers infected with FaDe-Cas9 AdV (CD4-CD8 IHC; D, H).

Claims

1. A recombinant Cas9 protein that functions as Cas9, comprising a KFERQ motif or a KFERQ-like motif, wherein the KFERQ motif or the KFERQ-like motif is selected from the group consisting of KFERQ (SEQ ID NO: 24), RKVEQ (SEQ ID NO: 25), QDLKF (SEQ ID NO: 26), QRFFE (SEQ ID NO: 27), NRVVD (SEQ ID NO: 28), QRDKV (SEQ ID NO: 29), QKILD (SEQ ID NO: 30), QKKEL (SEQ ID NO: 31), QFREL (SEQ ID NO: 32), IKLDQ (SEQ ID NO: 33), and the like. ), DVVRQ (SEQ ID NO:34), QRIVE (SEQ ID NO:35), VKELQ (SEQ ID NO:36), QKVFD (SEQ ID NO:37), QELLR (SEQ ID NO:38), VDKLN (SEQ ID NO:39), RIKEN (SEQ ID NO:40), NKKFE (SEQ ID NO:41) and combinations thereof, wherein said KFERQ (SEQ ID NO:24) does not constitute an S tag, and said recombinant Cas9 protein has a more rapid degradation rate than wild-type Cas9.

2. 2. The recombinant Cas9 protein of claim 1, wherein the KFERQ-like motif is VDKLN (SEQ ID NO:39).

3. 2. The recombinant Cas9 protein of claim 1, wherein the KFERQ motif or KFERQ-like motif is in the REC lobe of the Cas9 protein.

4. 4. The recombinant Cas9 protein of claim 3, wherein the KFERQ motif or KFERQ-like motif is in the Rec2 domain of the REC lobe.

5. 2. The recombinant Cas9 protein of claim 1, wherein the KFERQ motif or KFERQ-like motif is in the HNH domain, the RuvC domain, or the PI domain of the recombinant Cas9 protein.

6. The recombinant Cas9 protein of any one of claims 1 to 3, wherein the KFERQ motif or KFERQ-like motif is in a surface-exposed region of the recombinant Cas9 protein.

7. The recombinant Cas9 protein of any one of claims 1 to 5, wherein the KFERQ motif or KFERQ-like motif is at the N-terminus or C-terminus of the recombinant Cas9 protein.

8. 1. A recombinant Cas9 protein (SpCas9) isolated from Streptococcus pyogenes, which functions as Cas9, comprising an amino acid modification at one or more of positions F185, A547, I548, T560, V561, D829, I830, L1087, S1088, P1199, K1200, or a combination thereof, of SEQ ID NO:1, wherein the amino acid modification is selected from the group consisting of the following mutations: (a) F185N; (b) A547E / I548L; (c) T560E / V561Q; (d) D829L / I830R; (e) L1087E / S1088Q; or (f) P1199D / K1200Q wherein the recombinant Cas9 protein has a more rapid degradation rate than wild-type Cas9.

9. 9. The recombinant Cas9 protein of claim 8, wherein the mutation is F185N.

10. 10. The recombinant Cas9 protein of claim 8 or 9, which is at least 90% identical to SEQ ID NO:

1.

11. 1. A recombinant Cas9 protein (SpCas9) isolated from Streptococcus pyogenes that functions as Cas9, comprising a KFERQ-like motif at amino acid position 185 of SEQ ID NO:1, wherein the KFERQ-like motif is VDKLN (SEQ ID NO:39), and wherein the recombinant Cas9 protein has a more rapid degradation rate than wild-type Cas9.

12. (a) a recombinant Cas9 protein according to any one of claims 1 to 11; (b) a guide polynucleotide that forms a complex with the recombinant Cas9 protein and includes a guide sequence; A non-naturally occurring CRISPR-Cas system comprising:

13. The system of claim 12, wherein the guide sequence is linked to a direct repeat sequence.

14. The system of claim 12 or 13, wherein the guide polynucleotide comprises a tracrRNA sequence.

15. The system of claim 12 or 13, further comprising (c) a separate polynucleotide comprising a tracrRNA sequence.

16. The system of any one of claims 12 to 14, wherein the polynucleotide sequence encoding the recombinant Cas9 protein and the guide polynucleotide are on a single vector.

17. 16. The system of claim 15, wherein the polynucleotide sequence encoding the recombinant Cas9 protein, the guide polynucleotide and the tracrRNA sequence are on a single vector.

18. A delivery particle comprising a system according to any one of claims 12 to 17.

19. A vesicle comprising a system according to any one of claims 12 to 17.

20. 20. The vesicle of claim 19 which is an exosome or a liposome.

21. A viral vector comprising a system according to any one of claims 12 to 17.

22. 22. The viral vector of claim 21 which is an adenovirus, a lentivirus or an adeno-associated virus.

23. 21. A composition for providing a site-specific modification in a target sequence in the genome of a cell, comprising a CRISPR-Cas system according to any one of claims 12 to 17, a delivery particle according to claim 18, a vesicle according to claim 19 or 20, or a viral vector according to claim 21 or 22, introduced into said cell.

24. 24. The composition of claim 23, wherein the modification comprises a deletion of at least a portion of the target sequence.

25. The composition of claim 23 , wherein the modification comprises a mutation of the target sequence.

26. 24. The composition of claim 23, wherein the modification comprises inserting a sequence of interest (SoI) in the target sequence.

27. 27. The composition of any one of claims 23 to 26, wherein off-target modifications in the genome of the cell are less than 5% of the modifications in the genome made by the recombinant Cas9.

28. 28. The composition of any one of claims 23-27, wherein off-target modifications in the genome of the cell are less than 2% of the modifications in the genome made by the recombinant Cas9.

29. 29. The composition of any one of claims 23-28, wherein off-target modifications in the genome of the cell are less than 1% of the modifications in the genome made by the recombinant Cas9.

30. 30. The composition of any one of claims 23 to 29, wherein off-target modifications in the genome of the cell are reduced by at least 50% compared to a wild-type CRISPR-Cas9 or a Cas9 that does not include a KFERQ motif or a KFERQ-like motif.

31. The composition according to any one of claims 23 to 30, wherein the cell is a bacterial cell, a mammalian cell or a plant cell.

32. 32. The composition of claim 31 , wherein the cell is a human cell.

33. The composition of claim 32 , wherein the cells are pluripotent stem cells.

34. 34. The composition of claim 33, wherein the cells are induced pluripotent stem cells.

35. The composition of any one of claims 23 to 34, wherein the guide sequence of the guide polynucleotide is capable of hybridizing to the target sequence in the genome of the cell.

Images