Masked IL-12 cytokine and its cleavage products

Abstract

The present invention relates to a masked IL-12 cytokine comprising an IL-12 cytokine or a functional fragment thereof, a masking moiety and a proteolytically cleavable linker, wherein the masking moiety masks the IL-12 cytokine or a functional fragment thereof, thereby reducing or preventing binding of the IL-cytokine or a functional fragment thereof to its cognate receptor, whereas upon proteolytic cleavage of the cleavable linker at the target site, the IL-12 cytokine or a functional fragment thereof is activated and capable or more capable of binding to its cognate receptor.

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of priority to U.S. Provisional Application Nos. 63 / 003,842, filed April 1, 2020, 63 / 118,579, filed November 25, 2020, and 63 / 127,893, filed December 18, 2020, each of which is incorporated herein by reference in its entirety.

[0002] Submission of sequence listing as an ASCII text file The contents of the following submission on an ASCII text file are incorporated herein by reference in their entirety: Sequence Listing Computer Readable Form (CRF) (Filename: 737762002840SEQLIST.TXT, Date Recorded: March 26, 2021, Size: 1,000 KB).

[0003] The present invention relates to a masked IL-12 cytokine and related methods for its use and production.The present invention also relates to cleavage products of the masked IL-12 cytokine and related methods for its use. [Background technology]

[0004] Cancer is the second leading cause of death in the United States, accounting for more deaths than the next five leading causes (chronic respiratory disease, stroke, accidents, Alzheimer's disease, and diabetes). While great progress has been made, particularly in targeted therapies, much research remains in this field. Immunotherapy and its branch, immuno-oncology, are yielding viable and exciting therapeutic options for treating malignancies. In particular, it is now recognized that one hallmark of cancer is immune evasion, and significant efforts have been made to identify targets for reactivating the immune system to recognize and treat cancer and to develop therapies directed against these targets.

[0005] Cytokines can be classified in various ways, such as based on their three-dimensional structure. Some cytokines are classified as heterodimers. Examples of heterodimeric cytokines include IL-12 and IL-23. The IL-12 cytokine is a heterodimer containing p35 and p40 subunits.

[0006] Cytokine therapy is an effective strategy for stimulating the immune system to induce antitumor cytotoxicity. In particular, aldesleukin, a recombinant form of interleukin-2 (IL-2), has been approved by the FDA for the treatment of metastatic renal cell carcinoma and melanoma. Unfortunately, cytokines administered to patients generally have very short half-lives, thereby requiring frequent administration. For example, the product label for aldesleukin, marketed under the brand name Proleukin, states that the drug has been shown to have a half-life of 85 minutes in patients receiving a 5-minute intravenous (IV) infusion. In addition, administration of high doses of cytokines can cause adverse health outcomes, such as vascular leakage, through systemic immune activation. These findings illustrate the need to develop IL-2 cytokine therapeutics that effectively target tumors without the side effects associated with systemic immune activation.

[0007] Provided herein are masked IL-12 cytokines, cleavage products of the masked IL-12 cytokines, and compositions and methods of use thereof to address this need. Summary of the Invention

[0008] The disclosed invention relates to an IL-12 cytokine or a functional fragment thereof that is engineered to be masked by a masking moiety at one or more receptor-binding sites of the IL-12 cytokine or functional fragment thereof. The IL-12 cytokine is engineered to be activatable by a protease at a target site, such as within a tumor microenvironment, by including a proteolytically cleavable linker. In the masked cytokine construct, the masking moiety reduces or prevents binding of the IL-12 cytokine or functional fragment thereof to its cognate receptor. Upon proteolytic cleavage of the cleavable linker at the target site, the IL-12 cytokine or functional fragment thereof becomes activated and capable or more capable of binding to its cognate receptor.

[0009] Provided herein is a masked IL-12 cytokine comprising a heterodimer, a first polypeptide chain comprising: and a second polypeptide chain comprising: JPEG0007771076000002.jpg7170HL1 is a first half-life extending domain, L1 is a first linker, MM is a masking moiety, HL2 is a second half-life extending domain, L2 is a second linker, and C is an IL-12 cytokine or a functional fragment thereof; a first half-life prolonging domain associated with a second half-life prolonging domain; One of the first linker or the second linker is a masked IL-12 cytokine that comprises a proteolytically cleavable peptide.

[0010] In some embodiments, the IL-12 polypeptide or functional fragment thereof comprises an IL-12p40 polypeptide or functional fragment thereof covalently linked to an IL-12p35 polypeptide or functional fragment thereof.

[0011] In some embodiments, the IL-12p40-IL-12p35 linker is between 5 and 20 amino acids in length.

[0012] In some embodiments, the IL-12p40-IL-12p35 linker is rich in G and S amino acid residues.

[0013] In some embodiments, the IL-12p40-IL-12p35 linker comprises SEQ ID NO:3.

[0014] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO:1 or an amino acid sequence having at least one amino acid modification compared to the amino acid sequence of SEQ ID NO:1.

[0015] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO:1.

[0016] In some embodiments, the IL-12p40 polypeptide comprises at least one amino acid modification in the GAG-binding domain (KSKREKKDRV) compared to the amino acid sequence of SEQ ID NO:1.

[0017] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO:57.

[0018] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO:58.

[0019] In some embodiments, the IL-12p40 polypeptide comprises an amino acid sequence having one or more cytokine substitution mutations compared to the amino acid sequence of SEQ ID NO:1.

[0020] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO:59.

[0021] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO:60.

[0022] In some embodiments, the IL-12p35 polypeptide comprises SEQ ID NO:2 or an amino acid sequence having at least one amino acid modification compared to the amino acid sequence of SEQ ID NO:2.

[0023] In some embodiments, the IL-12p35 polypeptide comprises SEQ ID NO:2.

[0024] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises SEQ ID NO:4.

[0025] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises SEQ ID NO:61.

[0026] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises SEQ ID NO:62.

[0027] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises SEQ ID NO:63.

[0028] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises SEQ ID NO:64.

[0029] In some embodiments, the masking moiety comprises an IL-12 cytokine receptor, or a subunit or functional fragment thereof.

[0030] In some embodiments, the masking moiety comprises the extracellular domain of human IL-12Rβ1, or a fragment, portion, or variant thereof, that retains or otherwise demonstrates affinity for IL-12.

[0031] In some embodiments, the masking moiety comprises residues 24-237 of human IL-12Rβ1, ie, the sequence having SEQ ID NO:5.

[0032] In some embodiments, the masking moiety comprises residues 24 to 545 of human IL-12Rβ1, ie, the sequence having SEQ ID NO:6.

[0033] In some embodiments, the masking moiety comprises the extracellular domain of human IL-12Rβ2, or a fragment, portion, or variant thereof, that retains or otherwise demonstrates affinity for IL-12.

[0034] In some embodiments, the masking moiety comprises residues 24 to 212 of human IL-12Rβ2, ie, the sequence having SEQ ID NO:7.

[0035] In some embodiments, the masking moiety comprises residues 24-222 of human IL-12Rβ2, i.e., the sequence having SEQ ID NO:8, or the masking moiety comprises residues 24-227 of human IL-12Rβ2, i.e., the sequence having SEQ ID NO:11.

[0036] In some embodiments, the masking moiety comprises residues 24-319 of human IL-12Rβ2, ie, the sequence having SEQ ID NO:9.

[0037] In some embodiments, the masking moiety comprises at least one amino acid modification compared to the sequence of SEQ ID NO: 9, optionally, the modification is a cysteine ​​substitution mutation.

[0038] In some embodiments, the masking moiety comprises SEQ ID NO:65.

[0039] In some embodiments, the masking moiety comprises residues 24 to 622 of human IL-12Rβ2, ie, the sequence of SEQ ID NO:10.

[0040] In some embodiments, the cleavable peptide is 6 to 10 amino acids in length.

[0041] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO:15.

[0042] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO:41.

[0043] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO:42.

[0044] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO:43.

[0045] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO:44.

[0046] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO:45.

[0047] In some embodiments, the first polypeptide chain comprises: JPEG0007771076000003.jpg8170 The second polypeptide chain comprises: JPEG0007771076000004.jpg7170

[0048] In some embodiments, the non-cleavable linker is 3 to 18 amino acids in length.

[0049] In some embodiments, the non-cleavable linker is 3 to 15 amino acids in length.

[0050] In some embodiments, the non-cleavable linker is rich in G and S amino acid residues.

[0051] In some embodiments, the non-cleavable linker is [(G) n S], where n=4 or 5.

[0052] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO:12.

[0053] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO:13.

[0054] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO:14.

[0055] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 54 (GGSGGSGGSGGSGGSSGP).

[0056] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 55 (PGGSGP).

[0057] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 56 (GGSPG).

[0058] In some embodiments, the cleavable linker comprises a proteolytically cleavable peptide (CP) flanked by spacer domains (SDs), SD1-CP-SD2 SD1 and SD2 are polypeptides in which the first polypeptide chain comprises: JPEG0007771076000005.jpg7170 The second polypeptide chain is different such that it comprises: JPEG0007771076000006.jpg7170

[0059] In some embodiments, the first spacer domain (SD1) is between 3 and 10 amino acids in length.

[0060] In some embodiments, SD1 comprises SEQ ID NO:16.

[0061] In some embodiments, SD1 comprises SEQ ID NO:17.

[0062] In some embodiments, the second spacer domain (SD2) is 3 to 6 amino acids in length.

[0063] In some embodiments, SD2 comprises SEQ ID NO:18.

[0064] In some embodiments, the proteolytically cleavable linker comprises SD1-CP-SD2, where SD1 is a first spacer domain, CP is a cleavable peptide, SD2 is a second spacer domain, CP has the amino acid sequence set forth in SEQ ID NO:44, and SD2 has the amino acid sequence set forth in SEQ ID NO:18.

[0065] In some embodiments, the proteolytically cleavable linker comprises SD1-CP-SD2, where SD1 is a first spacer domain, CP is a cleavable peptide, SD2 is a second spacer domain, CP has the amino acid sequence set forth in SEQ ID NO:45, and SD2 has the amino acid sequence set forth in SEQ ID NO:18.

[0066] In some embodiments, the cleavable linker comprises SEQ ID NO:19.

[0067] In some embodiments, the cleavable linker comprises SEQ ID NO:20.

[0068] In some embodiments, the cleavable linker comprises SEQ ID NO: 46 (GGSGGSMPYDLYHPSGP).

[0069] In some embodiments, the cleavable linker comprises SEQ ID NO: 47 (GGSGGSGGSMPYDLYHPSGP).

[0070] In some embodiments, the cleavable linker comprises SEQ ID NO: 48 (GGSGGSDSGGFMLTSGP).

[0071] In some embodiments, the cleavable linker comprises SEQ ID NO: 49 (GGSGGSGGSDSGGFMLTSGP).

[0072] In some embodiments, the cleavable linker comprises SEQ ID NO: 50 (GGSGGSRAAAVKSPSGP).

[0073] In some embodiments, the cleavable linker comprises SEQ ID NO: 51 (GGSGGSGGSRAAAVKSPSGP).

[0074] In some embodiments, the cleavable linker comprises SEQ ID NO: 52 (GGSGGSISSGLLSGRSSGP).

[0075] In some embodiments, the cleavable linker comprises SEQ ID NO: 53 (GGSGGSGGSISSGLLSGRSSGP).

[0076] In some embodiments, the first half-life prolonging domain comprises a first IgG1 Fc domain or a fragment thereof, and the second half-life prolonging domain comprises a second IgG1 Fc domain or a fragment thereof.

[0077] In some embodiments, the first and / or second Fc domain each comprises one or more modifications that promote non-covalent association of the first and second half-life prolonging domains.

[0078] In some embodiments, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A) and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0079] In some embodiments, the first half-life prolonging domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life prolonging domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0080] In some embodiments, the first peptide chain comprises the amino acid sequence of SEQ ID NO:34 and the second peptide chain comprises the amino acid sequence of SEQ ID NO:40.

[0081] Provided herein are cleavage products capable of binding to IL-12R, comprising an IL-12 cytokine or a functional fragment thereof, which cleavage products are prepareable by proteolytic cleavage of a cleavable peptide in a masked IL-12 cytokine as defined in any one of the statements or embodiments described herein.

[0082] Provided herein are cleavage products of a masked IL-12 cytokine, wherein the cleavage product is capable of binding to IL-12R, and the cleavage product comprises a polypeptide comprising: PCP-SD2-C PCP is a portion of a proteolytically cleavable peptide, SD2 is a spacer domain, and C is the IL-12 cytokine or a functional fragment thereof.

[0083] In some embodiments, the PCP is a portion of a proteolytically cleavable peptide described herein.

[0084] In some embodiments, SD2 is a spacer domain described herein.

[0085] In some embodiments, C is an IL-12 cytokine or a functional fragment thereof described herein.

[0086] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:29.

[0087] In some embodiments, the cleavage product comprises the amino acid sequence of SEQ ID NO:29.

[0088] Provided herein is a nucleic acid encoding any one of the masked IL-12 cytokines described herein.

[0089] Provided herein is a nucleic acid encoding one of the chains of any one of the masked IL-12 cytokines described herein.

[0090] Provided herein are vectors that include the nucleic acids described herein.

[0091] Provided herein is a vector comprising a nucleic acid encoding a masked IL-12 cytokine described herein.

[0092] Provided herein is a vector comprising a nucleic acid encoding one of the chains of the masked IL-12 cytokine described herein.

[0093] Provided herein are host cells containing the nucleic acids described herein.

[0094] In one embodiment, the host cell is a HEK cell. In another embodiment, the host cell is a CHO cell.

[0095] Provided herein are compositions comprising any one of the masked IL-12 cytokines described herein.

[0096] Provided herein is a pharmaceutical composition comprising any one of the masked IL-12 cytokines described herein and a pharmaceutically acceptable carrier.

[0097] In some embodiments, the pharmaceutical composition is in a single unit dosage form.

[0098] In some embodiments, the pharmaceutical composition is formulated for intravenous administration and is in a single unit dosage form.

[0099] In some embodiments, the pharmaceutical composition is formulated for injection and is in a single unit dosage form.

[0100] In some embodiments, the pharmaceutical composition is a liquid and is in a single unit dosage form.

[0101] Provided herein is a kit comprising a masked IL-12 cytokine described herein, or a composition described herein, or a pharmaceutical composition described herein.

[0102] Provided herein is a method of producing a masked IL-12 cytokine described herein, comprising culturing a host cell described herein under conditions that produce the masked IL-12 cytokine.

[0103] Provided herein are nucleic acids that encode the cleavage products described herein.

[0104] Provided herein are compositions comprising the cleavage products described herein.

[0105] Provided herein is a pharmaceutical composition comprising a cleavage product described herein and a pharmaceutically acceptable carrier.

[0106] Provided herein is a masked IL-12 cytokine as described herein for use in a medicament.

[0107] Provided herein are cleavage products described herein for use in medicaments.

[0108] Provided herein is a method of treating or preventing cancer in a subject, the method comprising administering to the subject an effective amount of a masked IL-12 cytokine described herein.

[0109] Provided herein is a method of treating or preventing cancer in a subject, comprising administering to the subject an effective amount of a composition described herein.

[0110] Provided herein is a method of treating or preventing cancer in a subject, comprising administering to the subject an effective amount of a pharmaceutical composition described herein.

[0111] Provided herein is a method of treating or preventing cancer in a subject, comprising administering to the subject an effective amount of a masked IL-12 cytokine described herein, whereby the masked cytokine is proteolytically cleaved in vivo to produce a cleavage product described herein.

[0112] Provided herein is a method of treating or preventing cancer in a subject, the method comprising generating in vivo a cleavage product capable of binding to a cognate receptor, wherein the cleavage product is described herein.

[0113] In some embodiments, the cancer is a solid tumor.

[0114] Provided herein is a masked IL-12 cytokine as described herein for use in treating or preventing cancer.

[0115] Provided herein is a masked IL-12 cytokine as described herein for use in a method for treating or preventing cancer, the method comprising administering an effective amount of the masked IL-12 cytokine to a subject, whereby the masked cytokine is proteolytically cleaved in vivo to produce a cleavage product as described herein.

[0116] In some embodiments, the cancer is a solid tumor.

[0117] Provided herein are cleavage products described herein for use in treating or preventing cancer.

[0118] Provided herein are cleavage products described herein for use in a method of treating or preventing cancer, the method comprising administering to a patient a masked cytokine described herein, thereby producing the cleavage product by proteolytic cleavage of the masked cytokine in vivo.

[0119] Provided herein is a cleavage product described herein for use in a method of treating or preventing cancer in a subject, the method comprising producing the cleavage product by in vivo proteolytic cleavage from a masked cytokine described herein administered to the subject.

[0120] In some embodiments, the cancer is a solid tumor.

[0121] Provided herein is a pharmaceutical composition described herein for use in treating or preventing cancer.

[0122] In some embodiments, the cancer is a solid tumor. [Brief explanation of the drawings]

[0123] [Figure 1] 1 shows the structure of exemplary embodiments of a masked cytokine comprising a masking moiety, a cytokine or functional fragment thereof ("cytokine"), a half-life extending domain, and a first linker comprising a first cleavable peptide ("1CP"), a first N-terminal spacer domain ("1NSD"), and a first C-terminal spacer domain ("1CSD"). These exemplary embodiments also comprise a second linker comprising a second cleavable peptide ("2CP"), a second N-terminal spacer domain ("2NSD"), and a second C-terminal spacer domain ("2CSD"). As indicated by the arrows, the exemplary embodiments show the masking moiety linked to the first linker, and the cytokine or functional fragment thereof linked to the first and second linkers, although the masking moiety and cytokine or functional fragment thereof can be interchanged, such that the cytokine or functional fragment thereof is linked to the first linker and the masking moiety is linked to the first and second linkers. FIG. 1 shows the structure of an exemplary embodiment of a masked cytokine as a monomer. [Figure 2]2 shows the structure of an exemplary embodiment of a masked cytokine comprising a masking moiety, a cytokine or functional fragment thereof ("cytokine"), a first half-life prolonging domain, and a second half-life prolonging domain. The exemplary embodiment shown in FIG. 2 also comprises a first linker comprising a first cleavable peptide ("1CP"), a first N-terminal spacer domain ("1NSD"), and a first C-terminal spacer domain ("1CSD"), and a second linker comprising a second cleavable peptide ("2CP"), a second N-terminal spacer domain ("2NSD"), and a second C-terminal spacer domain ("2CSD"). The exemplary first and second half-life prolonging domains comprise "knobs-into-holes" modifications that facilitate association of the first half-life prolonging domain with the second half-life prolonging domain, as indicated by the "hole" in the first half-life prolonging domain and the "knob" in the second half-life prolonging domain. The first half-life prolonging domain and the second half-life prolonging domain are also shown as being at least partially associated by the formation of a disulfide bond. The "hole" is depicted as part of the first half-life prolonging domain (linked to the masking moiety) and the "knob" is depicted as part of the second half-life prolonging domain (linked to the cytokine), and it should be understood that the "hole" and "knob" can alternatively be included in the second half-life prolonging domain and the first half-life prolonging domain, respectively, such that the "hole" is part of the second half-life prolonging domain (linked to the cytokine) and the "knob" is part of the first half-life prolonging domain (linked to the masking moiety). [Figure 3] 3A-3B show an exemplary embodiment of a masked cytokine before (left) and after (right) protease cleavage, such as in a tumor microenvironment. Figures 3A-3B show an exemplary embodiment of a masked IL-2 cytokine. Protease cleavage releases either the masking moiety (e.g., IL-2Rβ, as shown in Figure 3B) or releases IL-2 (Figure 3A). [Figure 4]1 shows SDS-PAGE analysis of flow-through (FT) samples (i.e., proteins that did not bind to the Protein A column) and elution (E) samples (i.e., proteins that bound to and eluted from the Protein A column) following production and purification of IL-2 constructs (AK304, AK305, AK307, AK308, AK309, AK310, AK311, AK312, AK313, AK314, and AK315). [Figure 5] Figure 5 shows results from SPR analyses examining the binding of an exemplary masked IL-2 polypeptide construct (AK168) or rhIL2 control to CD25-Fc. Figure 5A shows the interaction between AK168 and CD25-Fc, Figure 5B shows the interaction between MMP-activated AK168 and CD25-Fc, and Figure 5C shows the interaction between recombinant human IL-2 (rhIL-2) control and CD25-Fc. Figure 5D provides a table summarizing the data obtained for the association constant (k), dissociation constant (k), equilibrium dissociation constant (K), and Chi2 and U values ​​for each interaction. [Figure 6] Figure 6 shows results from SPR analyses examining the binding of an exemplary masked IL-2 polypeptide construct (AK111) or rhIL-2 control to CD122-Fc. Figure 6A shows the interaction between AK111 and CD122-Fc, Figure 6B shows the interaction between protease-activated AK111 and CD122-Fc, and Figure 6C shows the interaction between recombinant human IL-2 (rhIL-2) control and CD122-Fc. Figure 6D provides a table summarizing the data obtained for the association constant (ka), dissociation constant (kd), equilibrium dissociation constant (KD), and Chi2 and U values ​​for each interaction. [Figure 7A] 1 shows an exemplary embodiment of a masked cytokine before (left) and after (right) cleavage by a protease, such as in a tumor microenvironment. [Figure 7B] 1 shows an SDS-PAGE analysis of an exemplary masked IL-2 polypeptide construct incubated in the absence (left lane) or presence (right lane) of MMP10 protease, demonstrating the release of IL-2 from the Fc portion. [Figure 8A-B] STAT5 activation (%) in PBMCs treated with constructs AK032, AK035, AK041, or rhIL-2 as a control is shown. The level of STAT5 activation (%) is shown for NK cells, CD8+ T cells, effector T cells (Teff), and regulatory T cells (Treg) determined after incubation with rhIL-2 (FIG. 8A), AK032 (FIG. 8B), AK035 (FIG. 8C), or AK041 (FIG. 8D). [Figure 8C-D] STAT5 activation (%) in PBMCs treated with constructs AK032, AK035, AK041, or rhIL-2 as a control is shown. The level of STAT5 activation (%) is shown for NK cells, CD8+ T cells, effector T cells (Teff), and regulatory T cells (Treg) determined after incubation with rhIL-2 (FIG. 8A), AK032 (FIG. 8B), AK035 (FIG. 8C), or AK041 (FIG. 8D). [Figure 9] Figure 9 shows STAT5 activation (%) in PBMCs treated with constructs AK081 or AK032. AK081 constructs were tested with or without prior exposure to MMP10. An isotype control and a no IL-2 negative control were also tested. The level of STAT5 activation (%) is shown for NK cells (Figure 9A), CD8+ T cells (Figure 9C), and CD4+ T cells (Figure 9B). [Figure 10A-B] Figure 10 shows results from STAT5 activation studies in PBMCs using constructs AK081 and AK111, as well as controls including rhIL-2 and anti-RSV antibody. A no-treatment control was also tested. EC50 (pM) is also shown for rhIL-2, AK081, and AK111 treatment. STAT5 activation (%) is shown for CD4+FoxP3+CD25+ cells (Figure 10A), CD8+ cells (Figure 10B), and CD4+FoxP3-CD25- cells (Figure 10C). Figure 10D provides EC50 (pM) and fold-change data for the AK081 and AK111 constructs, as well as the rhIL-2 control. [Figure 10C-D]Figure 10 shows results from STAT5 activation studies in PBMCs using constructs AK081 and AK111, as well as controls including rhIL-2 and anti-RSV antibody. A no-treatment control was also tested. EC50 (pM) is also shown for rhIL-2, AK081, and AK111 treatment. STAT5 activation (%) is shown for CD4+FoxP3+CD25+ cells (Figure 10A), CD8+ cells (Figure 10B), and CD4+FoxP3-CD25- cells (Figure 10C). Figure 10D provides EC50 (pM) and fold-change data for the AK081 and AK111 constructs, as well as the rhIL-2 control. [Figure 11A-B] Figure 11 shows the results of STAT5 activation studies in PBMCs using constructs AK167 and AK168, as well as controls including rhIL-2 and anti-RSV antibody. A no-treatment control was also tested. EC50 (pM) is also shown for rhIL-2, AK167, and AK168 treatment. STAT5 activation (%) is shown for CD4+FoxP3+CD25+ cells (Figure 11A), CD8+ cells (Figure 11B), and CD4+FoxP3-CD25- cells (Figure 11C). Figure 11D provides EC50 (pM) and fold-change data for the AK167 and AK168 constructs and the rhIL-2 control. [Figure 11C-D] Figure 11 shows the results of STAT5 activation studies in PBMCs using constructs AK167 and AK168, as well as controls including rhIL-2 and anti-RSV antibody. A no-treatment control was also tested. EC50 (pM) is also shown for rhIL-2, AK167, and AK168 treatment. STAT5 activation (%) is shown for CD4+FoxP3+CD25+ cells (Figure 11A), CD8+ cells (Figure 11B), and CD4+FoxP3-CD25- cells (Figure 11C). Figure 11D provides EC50 (pM) and fold-change data for the AK167 and AK168 constructs and the rhIL-2 control. [Figure 12A-B]Figure 12 shows % STAT5 activation in PBMCs treated with constructs AK165 or AK166, or an isotype control or IL-2-Fc control, that were either (+MMP10) or not previously exposed to MMP10 protease. The legend as shown in Figure 12A also applies to Figure 12B, and the legend as shown in Figure 12C also applies to Figure 12D. % STAT5 activation is shown for CD4+FoxP3+ T regulatory cells (Figure 12A), CD4+FoxP3- T helper cells (Figure 12B), CD8+ cytotoxic T cells (Figure 12C), and CD56+ NK cells (Figure 12D). [Figure 12C-D] Figure 12 shows % STAT5 activation in PBMCs treated with constructs AK165 or AK166, or an isotype control or IL-2-Fc control, that were either (+MMP10) or not previously exposed to MMP10 protease. The legend as shown in Figure 12A also applies to Figure 12B, and the legend as shown in Figure 12C also applies to Figure 12D. % STAT5 activation is shown for CD4+FoxP3+ T regulatory cells (Figure 12A), CD4+FoxP3- T helper cells (Figure 12B), CD8+ cytotoxic T cells (Figure 12C), and CD56+ NK cells (Figure 12D). [Figure 13] Figure 13 shows % STAT5 activation in PBMCs treated with constructs AK109 or AK110, or an isotype control or IL-2-Fc control that were either (+MMP10) or not previously exposed to MMP10 protease. The legend as shown in Figure 12B also applies to Figure 13A. % STAT5 activation is shown for NK cells (Figure 13A), CD8 cells (Figure 13B), and CD4 cells (Figure 13C). [Figure 14A-B]Figure 14 shows results from STAT5 activation studies in PBMCs using constructs AK211, AK235, AK253, AK306, AK310, AK314, and AK316, as well as a rhIL-2 control. % STAT5 activation is shown for CD3+CD4+FoxP3+ cells (Figure 14A), CD3+CD4+FoxP3- cells (Figure 14B), and CD3+CD8+ cells (Figure 14C). Figure 14D provides EC50 data for each of the constructs tested, as well as the rhIL-2 control. [Figure 14C-D] Figure 14 shows results from STAT5 activation studies in PBMCs using constructs AK211, AK235, AK253, AK306, AK310, AK314, and AK316, as well as a rhIL-2 control. % STAT5 activation is shown for CD3+CD4+FoxP3+ cells (Figure 14A), CD3+CD4+FoxP3- cells (Figure 14B), and CD3+CD8+ cells (Figure 14C). Figure 14D provides EC50 data for each of the constructs tested, as well as the rhIL-2 control. [Figure 15A-B] Figure 15 shows results from STAT5 activation studies in PBMCs using protease-activated constructs AK081, AK167, AK216, AK218, AK219, AK220, and AK223, as well as rhIL-2 controls. % STAT5 activation is shown for CD4 FoxP3 CD25 regulatory T cells (Figure 15A), CD4 FoxP3 CD25 cells (Figure 15B), and CD8 cells (Figure 15C). Figure 15D provides EC50 data for each of the constructs tested, as well as the rhIL-2 control. [Figure 15C-D] Figure 15 shows results from STAT5 activation studies in PBMCs using protease-activated constructs AK081, AK167, AK216, AK218, AK219, AK220, and AK223, as well as rhIL-2 controls. % STAT5 activation is shown for CD4 FoxP3 CD25 regulatory T cells (Figure 15A), CD4 FoxP3 CD25 cells (Figure 15B), and CD8 cells (Figure 15C). Figure 15D provides EC50 data for each of the constructs tested, as well as the rhIL-2 control. [Figure 16] Figure 16 shows STAT5 activation (%) in PBMCs treated with constructs AK081, AK189, AK190, or AK210, or an anti-RSV control. The legend shown in Figure 16A also applies to Figures 16B and 16C. STAT5 activation (%) is shown for regulatory T cells (Figure 16A), CD4 helper T cells (Figure 16B), and CD8 cells (Figure 16C). [Figure 17] STAT5 activation (%) in PBMCs treated with constructs AK167, AK191, AK192, or AK193, or anti-RSV control, is shown. The legend shown in Figure 17A also applies to Figures 17B and 17C. STAT5 activation (%) is shown for regulatory T cells (Figure 17A), CD4 helper T cells (Figure 17B), and CD8 cells (Figure 17C). [Figure 18] Figure 18 shows results from a pharmacokinetic study performed in tumor-bearing mice using constructs AK032, AK081, AK111, AK167, or AK168, or an anti-RSV control. Figure 18A provides a simple depiction of the structure of each of the tested constructs. Figure 18B shows Fc levels (μg / mL) in plasma by detecting human IgG, Figure 18C shows Fc-CD122 levels (μg / mL) in plasma by detecting human CD122, and Figure 18D shows Fc-IL2 levels (μg / mL) in plasma by detecting human IL-2. Prior to the detection step, anti-human IG was used as a capture antibody. [Figure 19A-B] Figure 19 shows the results from a pharmacokinetic study performed in tumor-bearing mice using constructs AK167, AK191, AK197, AK203, AK209, or AK211, or an anti-RSV control. Figure 19A provides a simple depiction of the structure of each of the tested constructs. Figure 19B shows the Fc levels (μg / mL) in plasma by detecting human IgG, Figure 19C shows the Fc-IL2 levels (μg / mL) in plasma by detecting human IL-2, and Figure 19D shows the Fc-CD122 levels (μg / mL) in plasma by detecting human CD122. Prior to the detection step, anti-human IG was used as a capture antibody. [Figure 19C-D] Figure 19 shows the results from a pharmacokinetic study performed in tumor-bearing mice using constructs AK167, AK191, AK197, AK203, AK209, or AK211, or an anti-RSV control. Figure 19A provides a simple depiction of the structure of each of the tested constructs. Figure 19B shows the Fc levels (μg / mL) in plasma by detecting human IgG, Figure 19C shows the Fc-IL2 levels (μg / mL) in plasma by detecting human IL-2, and Figure 19D shows the Fc-CD122 levels (μg / mL) in plasma by detecting human CD122. Prior to the detection step, anti-human IG was used as a capture antibody. [Figure 20A-D] 2 shows results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK032, AK081, AK111, AK167, or AK168 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 20A), the CD4 cell % of CD3 cells (FIG. 20B), the NK cell % of CD3 cells (FIG. 20C), and the FoxP3 % of CD4 cells (FIG. 20D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 20E), the CD4 cell % of CD3 cells (FIG. 20F), the NK cell % of CD3 cells (FIG. 20G), and the FoxP3 % of CD4 cells (FIG. 20H) are shown. For tumor tissues, the % CD8 cells of CD3 cells (Figure 20I), % CD4 cells of CD3 cells (Figure 20J), % NK cells of CD3 cells (Figure 20K), and % FoxP3 cells of CD4 cells (Figure 20L) are shown. [Figure 20E-H]2 shows results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK032, AK081, AK111, AK167, or AK168 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 20A), the CD4 cell % of CD3 cells (FIG. 20B), the NK cell % of CD3 cells (FIG. 20C), and the FoxP3 % of CD4 cells (FIG. 20D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 20E), the CD4 cell % of CD3 cells (FIG. 20F), the NK cell % of CD3 cells (FIG. 20G), and the FoxP3 % of CD4 cells (FIG. 20H) are shown. For tumor tissues, the % CD8 cells of CD3 cells (Figure 20I), % CD4 cells of CD3 cells (Figure 20J), % NK cells of CD3 cells (Figure 20K), and % FoxP3 cells of CD4 cells (Figure 20L) are shown. [Figure 20I-L] 2 shows results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK032, AK081, AK111, AK167, or AK168 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 20A), the CD4 cell % of CD3 cells (FIG. 20B), the NK cell % of CD3 cells (FIG. 20C), and the FoxP3 % of CD4 cells (FIG. 20D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 20E), the CD4 cell % of CD3 cells (FIG. 20F), the NK cell % of CD3 cells (FIG. 20G), and the FoxP3 % of CD4 cells (FIG. 20H) are shown. For tumor tissues, the % CD8 cells of CD3 cells (Figure 20I), % CD4 cells of CD3 cells (Figure 20J), % NK cells of CD3 cells (Figure 20K), and % FoxP3 cells of CD4 cells (Figure 20L) are shown. [Figure 21A-D]21A and 21B show results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK167, AK168, AK191, AK197, AK203, AK209, or AK211 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 21A), the CD4 cell % of CD3 cells (FIG. 21B), the NK cell % of CD3 cells (FIG. 21C), and the FoxP3 % of CD4 cells (FIG. 21D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 21E), the CD4 cell % of CD3 cells (FIG. 21F), the NK cell % of CD3 cells (FIG. 21G), and the FoxP3 % of CD4 cells (FIG. 21H) are shown. For tumor tissues, the % CD8 cells of CD3 cells (Figure 21I), % CD4 cells of CD3 cells (Figure 21J), % NK cells of CD3 cells (Figure 21K), and % FoxP3 cells of CD4 cells (Figure 21L) are shown. [Figure 21E-H] 21A and 21B show results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK167, AK168, AK191, AK197, AK203, AK209, or AK211 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 21A), the CD4 cell % of CD3 cells (FIG. 21B), the NK cell % of CD3 cells (FIG. 21C), and the FoxP3 % of CD4 cells (FIG. 21D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 21E), the CD4 cell % of CD3 cells (FIG. 21F), the NK cell % of CD3 cells (FIG. 21G), and the FoxP3 % of CD4 cells (FIG. 21H) are shown. For tumor tissues, the % CD8 cells of CD3 cells (Figure 21I), % CD4 cells of CD3 cells (Figure 21J), % NK cells of CD3 cells (Figure 21K), and % FoxP3 cells of CD4 cells (Figure 21L) are shown. [Figure 21I-L]21A and 21B show results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK167, AK168, AK191, AK197, AK203, AK209, or AK211 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 21A), the CD4 cell % of CD3 cells (FIG. 21B), the NK cell % of CD3 cells (FIG. 21C), and the FoxP3 % of CD4 cells (FIG. 21D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 21E), the CD4 cell % of CD3 cells (FIG. 21F), the NK cell % of CD3 cells (FIG. 21G), and the FoxP3 % of CD4 cells (FIG. 21H) are shown. For tumor tissues, the % CD8 cells of CD3 cells (Figure 21I), % CD4 cells of CD3 cells (Figure 21J), % NK cells of CD3 cells (Figure 21K), and % FoxP3 cells of CD4 cells (Figure 21L) are shown. [Figure 22A-D] 22A and 22B show results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK235, AK191, AK192, AK193, AK210, AK189, AK190, or AK211 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 22A), the CD4 cell % of CD3 cells (FIG. 22B), the NK cell % of CD3 cells (FIG. 22C), and the FoxP3 % of CD4 cells (FIG. 22D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 22E), the CD4 cell % of CD3 cells (FIG. 22F), the NK cell % of CD3 cells (FIG. 22G), and the FoxP3 % of CD4 cells (FIG. 22H) are shown. For spleen tissue, the % CD8 cells of CD3 cells (Figure 22I), % CD4 cells of CD3 cells (Figure 22J), % NK cells of CD3 cells (Figure 22K), and % FoxP3 cells of CD4 cells (Figure 22L) are shown. [Figure 22E-H]22A and 22B show results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK235, AK191, AK192, AK193, AK210, AK189, AK190, or AK211 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 22A), the CD4 cell % of CD3 cells (FIG. 22B), the NK cell % of CD3 cells (FIG. 22C), and the FoxP3 % of CD4 cells (FIG. 22D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 22E), the CD4 cell % of CD3 cells (FIG. 22F), the NK cell % of CD3 cells (FIG. 22G), and the FoxP3 % of CD4 cells (FIG. 22H) are shown. For spleen tissue, the % CD8 cells of CD3 cells (Figure 22I), % CD4 cells of CD3 cells (Figure 22J), % NK cells of CD3 cells (Figure 22K), and % FoxP3 cells of CD4 cells (Figure 22L) are shown. [Figure 22I-L] 22A and 22B show results from a study examining the in vivo response rates of CD4, CD8, NK, and Treg in spleen, blood, and tumors using AK235, AK191, AK192, AK193, AK210, AK189, AK190, or AK211 constructs, or an anti-RSV IgG control. For spleen tissue, the CD8 cell % of CD3 cells (FIG. 22A), the CD4 cell % of CD3 cells (FIG. 22B), the NK cell % of CD3 cells (FIG. 22C), and the FoxP3 % of CD4 cells (FIG. 22D) are shown. For blood, the CD8 cell % of CD3 cells (FIG. 22E), the CD4 cell % of CD3 cells (FIG. 22F), the NK cell % of CD3 cells (FIG. 22G), and the FoxP3 % of CD4 cells (FIG. 22H) are shown. For spleen tissue, the % CD8 cells of CD3 cells (Figure 22I), % CD4 cells of CD3 cells (Figure 22J), % NK cells of CD3 cells (Figure 22K), and % FoxP3 cells of CD4 cells (Figure 22L) are shown. [Figure 23A-C]Figure 23 shows results from in vivo T cell activation in spleen, blood, and tumors using the AK235, AK191, AK192, AK193, AK210, AK189, AK190, or AK211 constructs. T cell activation was measured as the mean fluorescence intensity (MFI) of CD25 in CD8+ T cells (Figures 23A, 23D, and 23G), CD4+ T cells (Figures 23B, 23E, and 23H), or Foxp3+ cells (Figures 23C, 23F, and 23I) in spleen, blood, and tumors. Statistical analysis was performed using one-way ANOVA in comparison with the non-cleavable AK211 construct. [Figure 23D-F] Figure 23 shows results from in vivo T cell activation in spleen, blood, and tumors using the AK235, AK191, AK192, AK193, AK210, AK189, AK190, or AK211 constructs. T cell activation was measured as the mean fluorescence intensity (MFI) of CD25 in CD8+ T cells (Figures 23A, 23D, and 23G), CD4+ T cells (Figures 23B, 23E, and 23H), or Foxp3+ cells (Figures 23C, 23F, and 23I) in spleen, blood, and tumors. Statistical analysis was performed using one-way ANOVA in comparison with the non-cleavable AK211 construct. [Figure 23G-I] Figure 23 shows results from in vivo T cell activation in spleen, blood, and tumors using the AK235, AK191, AK192, AK193, AK210, AK189, AK190, or AK211 constructs. T cell activation was measured as the mean fluorescence intensity (MFI) of CD25 in CD8+ T cells (Figures 23A, 23D, and 23G), CD4+ T cells (Figures 23B, 23E, and 23H), or Foxp3+ cells (Figures 23C, 23F, and 23I) in spleen, blood, and tumors. Statistical analysis was performed using one-way ANOVA in comparison with the non-cleavable AK211 construct. [Figure 24A-D]Figure 24E shows results from a study examining in vivo cleavage of exemplary masked IL-2 polypeptide constructs AK168 (cleavable peptide sequence: MPYDLYHP) and AK209 (cleavable peptide sequence: VPLSLY, SEQ ID NO: 15). Figure 24F shows results from a pharmacokinetic study of total plasma IgG concentration (μg / mL) for combined levels of the AK167, AK168, and AK209 constructs, as well as levels of the uncleaved form of each construct. [Figure 24E] Figure 24E shows results from a study examining in vivo cleavage of exemplary masked IL-2 polypeptide constructs AK168 (cleavable peptide sequence: MPYDLYHP) and AK209 (cleavable peptide sequence: VPLSLY, SEQ ID NO: 15). Figure 24F shows results from a pharmacokinetic study of total plasma IgG concentration (μg / mL) for combined levels of the AK167, AK168, and AK209 constructs, as well as levels of the uncleaved form of each construct. [Figure 25A-D] Figure 25 shows the results from an in vivo study evaluating vascular leakage using exemplary masked IL-2 polypeptide constructs AK111 or AK168, or unmasked IL-2 polypeptide constructs AK081 or AK167, or an anti-RSV control. Figure 25A shows the percentage of body weight loss, and Figures 25B, 25C, and 25D show the weights of the liver, lungs, and spleen in grams, respectively. [Figure 26A-B] 26A and 26B show results from an in vivo study evaluating vascular leakage by measuring the degree of dye leakage into liver and lung tissue after administration of the AK081, AK111, AK167, or AK168 constructs, or an anti-RSV control. The degree of dye leakage into the liver (FIG. 26A) and lung (FIG. 26B) was measured based on absorbance at 650 nm. [Figure 27A-B] 27A and 27B show results from an in vivo study evaluating vascular leakage, as indicated by measuring the degree of perivascular infiltration of mononuclear cells into liver and lung tissue after administration of AK081, AK111, AK167, or AK168 constructs, or an anti-RSV control. The average number of mononuclear cells in the liver (FIG. 27A) and the average number of mononuclear cells in the lung (FIG. 27B) are depicted for each. [Figure 28A] Figure 28 shows results from a syngeneic tumor model study in which tumor volume and body weight were assessed over the course of treatment with AK032, AK081, AK111, AK167, or AK168 constructs, or an anti-RSV control. Figure 28A shows data on tumor volume over the course of treatment, and Figure 28B shows data on the percent change in body weight over the course of treatment. [Figure 28B] Figure 28 shows results from a syngeneic tumor model study in which tumor volume and body weight were assessed over the course of treatment with AK032, AK081, AK111, AK167, or AK168 constructs, or an anti-RSV control. Figure 28A shows data on tumor volume over the course of treatment, and Figure 28B shows data on the percent change in body weight over the course of treatment. [Figure 29A-B] We show that AK471 with the I253A FcRn mutation induced robust CD8 T cell expansion in the TME while remaining inactive in the periphery. [Figure 30A-C] AK471 has a slightly shorter half-life compared to aglyco-hIgG1. [Figure 31A-C] AK471 in plasma shows no evidence of cleavage or excision. [Figure 32] 1 shows an exemplary IL-12 construct format. [Figure 33A-B] Exemplary cleavage processes are shown for exemplary molecules AK380, AK381, and AK384 (Figure 34A), and AK383, AK386, AK434, AK447, AK448, AK446, AK528, and AK529 (Figure 34B). [Fig. 34A-D]Figure 34 depicts the masking of IL-12 toward IL-12RB1 using SPR analysis, which examined the binding of exemplary masked IL-12 polypeptide constructs (AK384 and AK386) to rhIL-12RB1-Fc. Figure 34A depicts the interaction between AK384 and IL-12RB1-Fc, Figure 34B depicts the interaction between AK386 and IL-12RB1-Fc, and Figure 34C depicts the interaction between a recombinant human IL-12 (rhIL-12) control and 12RB1-Fc. Figure 34D provides a table summarizing the data obtained for the association constant (k), dissociation constant (kd), equilibrium dissociation constant (KD), and Chi2 and U values ​​for each interaction. Due to the shape of the curves, exact rates cannot be determined; therefore, KD is estimated based on on-rate. These results demonstrate that these exemplary masked IL-12 polypeptide constructs (AK384 and AK386) did not demonstrate detectable binding to IL-12RB1-Fc, while the wild-type rhIL-12 control demonstrated detectable binding. [Fig. 35A-D] Figure 35 depicts the masking of IL-12 toward IL-12RB2 using SPR analysis, which examined the binding of exemplary masked IL-12 polypeptide constructs (AK384 and AK386) to rhIL-12RB2-Fc. Figure 35A depicts the interaction between AK384 and IL-12RB2-Fc, Figure 35B depicts the interaction between AK386 and IL-12RB2-Fc, and Figure 35C depicts the interaction between a recombinant human IL-12 (rhIL-12) control and IL-12RB2-Fc. Figure 35D provides a table summarizing the data obtained for the association constant (k), dissociation constant (kd), equilibrium dissociation constant (KD), and Chi2 and U values ​​for each interaction. Due to the shape of the curves, exact rates cannot be determined; therefore, KD is estimated based on on-rate. These results demonstrate that the exemplary masked IL-12 polypeptide construct (AK386) demonstrated weak but detectable binding to IL-12RB1-Fc, while the wild-type rhIL-12 control and the exemplary IL-12 polypeptide construct (AK384) demonstrated detectable binding. [Figure 36] Results from Example 6 are shown. [Figure 37] Results from Example 6 are shown. [Figure 38] Results from Example 6 are shown. [Figure 39] Results from Example 6 are shown. [Figure 40] Results from Example 6 are shown. [Figure 41] Results from Example 7 are shown. [Figure 42] Results from Example 7 are shown. [Figure 43] Results from Example 7 are shown. [Figure 44] Results from Example 8 are shown. [Figure 45] Results from Example 8 are shown. [Figure 46A] Results from Example 8 are shown. [Figure 46B] Results from Example 8 are shown. [Figure 47A-B] Results from Example 8 are shown. [Figure 48A-B] Results from Example 8 are shown. [Fig. 48C-D] Results from Example 8 are shown. [Figure 48E-F] Results from Example 8 are shown. [Figure 48G-H] Results from Example 8 are shown. [Figure 48I-J] Results from Example 8 are shown. [Figure 48K] Results from Example 8 are shown. [Figure 49A-B] Results from Example 8 are shown. [Figure 50A-B] Results from Example 8 are shown. [Fig. 50C-D] Results from Example 8 are shown. [Figure 50E-F] Results from Example 8 are shown. [Figure 50G] Results from Example 8 are shown. [Figure 51] Results from Example 8 are shown. [Figure 52A] Results from Example 8 are shown. [Fig. 52B-C] Results from Example 8 are shown. [Fig. 52D-E] Results from Example 8 are shown. [Fig. 53A-53D-54A-54F] 1 shows the results of SDS-PAGE and HEK-Blue IL-2 bioassays using exemplary IL-15 constructs AK904 and AK910 that do not contain a peptide substrate, and constructs AK932, AK938, AK930, and AK936 that do contain a peptide substrate. [Figure 53A-B] The results of the SDS-PAGE gel are shown. [Fig. 53C-D] The results of the SDS-PAGE gel are shown. [Figure 54A-C] 1 shows the results of a HEK-Blue IL-2 bioassay. [Fig. 54D-F] 1 shows the results of a HEK-Blue IL-2 bioassay. [Figure 55] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 56] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 57] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 58] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 59]Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 60] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 61A] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 61B] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 62] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 63A] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 63B] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 64A] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 64B]Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 65A] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 65B] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 65C] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 66] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 67A] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 67B] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 67C] Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 68]Results from Example 11 are shown. The PK / PD of exemplary murine molecules AK944, AK945, AK947, and the control AK948 were analyzed in vivo in two tumor models, MB49 and B16F10. [Figure 69]

[0033] Figure 1 shows the results of Example 12. The PK, PD, hematology, and serum chemistry of exemplary molecules AK667, AK921, AK923, and control AK671 were analyzed in cynomolgus monkeys. [Figure 70]

[0033] Figure 1 shows the results of Example 12. The PK, PD, hematology, and serum chemistry of exemplary molecules AK667, AK921, AK923, and control AK671 were analyzed in cynomolgus monkeys. [Figure 71A]

[0033] Figure 1 shows the results of Example 12. The PK, PD, hematology, and serum chemistry of exemplary molecules AK667, AK921, AK923, and control AK671 were analyzed in cynomolgus monkeys. [Figure 71B]

[0033] Figure 1 shows the results of Example 12. The PK, PD, hematology, and serum chemistry of exemplary molecules AK667, AK921, AK923, and control AK671 were analyzed in cynomolgus monkeys. DETAILED DESCRIPTION OF THE INVENTION

[0124] By using a masking moiety, the systemic side effects of the administered IL-12 cytokine or functional fragment thereof can be reduced by interfering with the ability of the IL-12 cytokine or functional fragment thereof to bind to its cognate receptor.

[0125] The interleukin-12 receptor is a type I cytokine receptor that binds interleukin-12. It consists of beta1 and beta2 subunits.

[0126] By masking the IL-12 cytokine or its functional fragment using a linker containing a proteolytically cleavable peptide, the binding ability that is disrupted by the use of the masking moiety can be restored by cleavage of the cleavable peptide in the tumor microenvironment. Thus, the masked IL-12 cytokine provided herein is engineered to precisely target pharmacological activity to the tumor microenvironment by exploiting the high local concentration of active proteases, one of the hallmarks of cancer. This characteristic of the tumor microenvironment is used to transform a systemically inactive molecule into a locally active IL-12 cytokine or its functional fragment in the form of an IL-12 cleavage product. Activation of the IL-12 cytokine or its functional fragment in the tumor microenvironment significantly reduces the systemic toxicity that can be associated with drugs administered to a subject in their active form. Therefore, the masked IL-12 cytokine of the present invention can be considered a prodrug.

[0127] The masked IL-12 cytokines described herein have been found to exhibit various advantageous properties. The masked IL-12 cytokines described elsewhere herein have been found to be capable of activating immune cells (proliferation and expansion) upon proteolytic cleavage, preferentially within the tumor microenvironment and at lower levels in the periphery. The masked IL-12 cytokines described elsewhere herein have been found to be capable of promoting tumor eradication (i.e., exhibiting anti-tumor activity) and inhibiting metastasis upon proteolytic cleavage. The masked IL-12 cytokines described elsewhere herein have been found to demonstrate advantageous prolonged drug exposure. The masked IL-12 cytokines described herein have been found to demonstrate advantageous stability. The masked IL-12 cytokines described herein have been found to demonstrate advantageous tolerability. Furthermore, the masked IL-12 cytokines described herein have been found to demonstrate advantageous efficacy.

[0128] 1. "Heterodimeric" Masked Cytokines In some embodiments, provided herein is a masked cytokine comprising a masking moiety in a first polypeptide chain and an IL-12 cytokine or a functional fragment thereof in a second polypeptide chain. Such a masked cytokine may be referred to as a "heterodimeric" masked cytokine.

[0129] In some embodiments, the masked cytokine is a) a first polypeptide chain comprising a masking moiety linked to a first half-life extending domain via a first linker; b) a second polypeptide chain comprising an IL-12 cytokine or a functional fragment thereof linked to a second half-life extending domain via a second linker; the first half-life prolonging domain is associated with a second half-life prolonging domain; One of the first linker or the second linker comprises a proteolytically cleavable peptide.

[0130] The type of association between the masking moiety, the half-life prolonging domain, the IL-12 cytokine or a functional fragment thereof, the linker, and the first half-life prolonging domain and the second half-life prolonging domain can be any one of those described herein, and any combination of those described herein.

[0131] In some embodiments, in the first polypeptide chain, the first half-life prolonging domain is linked to the amino terminus of a first linker, and the carboxy terminus of the first linker is linked to the amino terminus of the masking moiety, and in the second polypeptide chain, the second half-life prolonging domain is linked to the amino terminus of a second linker, and the carboxy terminus of the second linker is linked to the amino terminus of the IL-12 cytokine or functional fragment thereof, as shown schematically below: the first polypeptide chain comprises: JPEG0007771076000007.jpg7170The second polypeptide chain comprises: JPEG0007771076000008.jpg7170HL1 is a first half-life extending domain, L1 is a first linker, MM is a masking moiety, HL2 is a second half-life extending domain, L2 is a second linker, and C is an IL-12 cytokine or a functional fragment thereof.

[0132] 1.1 IL-12 cytokine Provided herein is an IL-12 cytokine or functional fragment thereof for use in masking cytokines or their cleavage products. Cytokines play a role in cell signaling, particularly within cells of the immune system. IL-12 is an interleukin, a type of cytokine signaling molecule within the immune system that regulates the activity of white blood cells.

[0133] Endogenous IL-12 exists as two distinct molecules, IL-12 p40 and IL-12 p35, which dimerize intracellularly during biosynthesis.

[0134] The full sequences of IL-12 p40 and IL-12 p35 are as follows (the propeptide cleaved during biosynthesis is shown in bold): JPEG0007771076000009.jpg79170JPEG0007771076000010.jpg54170

[0135] The mature form is as follows: IL-12 p40 subunit: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATL SAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS IL-12 p35 subunit: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

[0136] They are expressed as two chains that covalently dimerize during biosynthesis through a disulfide bond between the two subunits: cysteine ​​C199 of the p40 subunit associates with cysteine ​​C96 of the p35 subunit.

[0137] A "functional fragment" of an IL-12 cytokine includes a portion of a full-length cytokine protein that retains or modifies cytokine receptor binding ability (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% activity compared to the full-length cytokine protein). Cytokine receptor binding ability can be demonstrated, for example, by the ability of the cytokine to bind to its cognate receptor or a component thereof.

[0138] In some embodiments, the IL-12 cytokine or functional fragment thereof is any naturally occurring interleukin-2 (IL-12) protein or modified variant thereof capable of binding to the interleukin-12 receptor.

[0139] In some embodiments, the IL-12 polypeptide or functional fragment thereof comprises an IL-12p40 polypeptide or functional fragment thereof covalently linked to an IL-12p35 polypeptide or functional fragment thereof.

[0140] The IL-12p40 polypeptide or functional fragment thereof may be attached to a first half-life prolonging domain, such that the first polypeptide chain comprises: JPEG0007771076000011.jpg7170 The second polypeptide chain comprises: JPEG0007771076000012.jpg7170 "IL-12p40" is an IL-12p40 polypeptide or a functional fragment thereof, and "IL-12p35" is an IL-12p35 polypeptide or a functional fragment thereof.

[0141] In some embodiments, the IL-12p40 polypeptide comprises SEQ ID NO: 1. In some embodiments, the IL-12p40 polypeptide or functional fragment thereof comprises an amino acid sequence having at least one amino acid modification compared to the amino acid sequence of SEQ ID NO: 1. Each of the at least one amino acid modification can be any amino acid modification, such as a substitution, insertion, or deletion. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid substitutions compared to the amino acid sequence of SEQ ID NO: 1. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least five amino acid substitutions compared to the amino acid sequence of SEQ ID NO: 1.

[0142] The IL-12p40 polypeptide contains a glycosaminoglycan (GAG)-binding domain. GAGs, such as heparin and heparan sulfate, have been shown to bind to numerous growth factors and cytokines, including IL-12. The physiological significance of this binding is two-fold. First, GAGs can serve as coreceptors on the cell surface, maintaining high local concentrations of cytokines. Second, GAGs can regulate the bioactivity of growth factors and cytokines through multiple mechanisms, including dimerization and protection from proteolysis.

[0143] The GAG ​​binding domain of the mature form of the IL-12 p40 subunit is shown below in bold. JPEG0007771076000013.jpg67170

[0144] Modifications to the GAG-binding domain (KSKREKKDRV) are shown herein to increase the PK profile of constructs comprising the IL-12 cytokine with the mutated GAG-binding domain without any reduction in cytokine activity. Thus, in some embodiments, the IL-12p40 polypeptide comprises at least one amino acid modification to the GAG-binding domain. In some embodiments, the modification to the GAG-binding domain is a deletion mutation. In some embodiments, the modification to the GAG-binding domain is a deletion mutation and at least one substitution mutation.

[0145] In some embodiments, the GAG ​​binding domain comprises the amino acid sequence KDNTERV. In some embodiments, the IL-12p40 polypeptide comprises the amino acid sequence of SEQ ID NO: 57. In some embodiments, the GAG ​​binding domain comprises the amino acid sequence KDNTEGRV. In some embodiments, the IL-12p40 polypeptide comprises the amino acid sequence of SEQ ID NO: 58.

[0146] In some embodiments, the GAG ​​binding domain consists of the amino acid sequence KDNTERV. In some embodiments, the IL-12p40 polypeptide comprises the amino acid sequence SEQ ID NO: 57. In some embodiments, the GAG ​​binding domain consists of the amino acid sequence KDNTEGRV. In some embodiments, the IL-12p40 polypeptide comprises the amino acid sequence SEQ ID NO: 58.

[0147] In some embodiments, an IL-12p40 polypeptide or functional fragment thereof comprises an amino acid sequence having one or more cysteine ​​substitutions compared to the amino acid sequence of SEQ ID NO: 1. In some embodiments, an IL-12p40 polypeptide or functional fragment thereof comprises an amino acid sequence having an amino acid substitution at position C252 compared to the amino acid sequence of SEQ ID NO: 1. In some embodiments, the amino acid substitution at position C252 is C252S. In some embodiments, an IL-12p40 polypeptide comprises the amino acid sequence of SEQ ID NO: 59. In some embodiments, an IL-12p40 polypeptide comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 59. In some embodiments, an IL-12p40 polypeptide consists of the amino acid sequence of SEQ ID NO: 59.

[0148] In some embodiments, the IL-12p40 polypeptide comprises an amino acid sequence having one or more cysteine ​​substitutions compared to the amino acid sequence of SEQ ID NO: 1 and at least one amino acid modification to the GAG-binding domain. In some embodiments, the IL-12p40 polypeptide comprises an amino acid substitution at position C252S compared to the amino acid sequence of SEQ ID NO: 1, and the GAG-binding domain comprises the amino acid sequence KDNTERV. In some embodiments, the IL-12p40 polypeptide comprises an amino acid substitution at position C252S compared to the amino acid sequence of SEQ ID NO: 1, and the GAG-binding domain comprises the amino acid sequence KDNTEGRV. In some embodiments, the IL-12p40 polypeptide comprises the amino acid sequence of SEQ ID NO: 60. In some embodiments, the IL-12p40 polypeptide comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 60. In some embodiments, the IL-12p40 polypeptide consists of the amino acid sequence of SEQ ID NO:60.

[0149] In some embodiments, the IL-12p35 polypeptide comprises SEQ ID NO: 2. In some embodiments, the IL-12p35 polypeptide or functional fragment thereof comprises an amino acid sequence having at least one amino acid modification compared to the amino acid sequence of SEQ ID NO: 2. Each of the at least one amino acid modification can be any amino acid modification, such as a substitution, insertion, or deletion. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid substitutions compared to the amino acid sequence of SEQ ID NO: 2. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least five amino acid substitutions compared to the amino acid sequence of SEQ ID NO: 2.

[0150] In some embodiments, the IL-12p40-IL-12p35 linker is between 5 and 20 amino acids in length.

[0151] In some embodiments, the IL-12p40-IL-12p35 linker is rich in G and S amino acid residues.

[0152] In some embodiments, the IL-12p40-IL-12p35 linker comprises only amino acid residue types selected from the group consisting of G and S.

[0153] In some embodiments, the IL-12p40-IL-12p35 linker is [(G) n S], where n=4 or 5.

[0154] In some embodiments, the IL-12p40-IL-12p35 linker comprises (GGGGS) repeats.

[0155] In some embodiments, the IL-12p40-IL-12p35 linker comprises SEQ ID NO: 3 (GGGGSGGGGSGGGGS).

[0156] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises SEQ ID NO: 4. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least one amino acid modification compared to the amino acid sequence of SEQ ID NOs: 1 and 2. Each of the at least one amino acid modification can be any amino acid modification, such as a substitution, insertion, or deletion. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid substitutions compared to the amino acid sequence of SEQ ID NOs: 1 and 2. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having at least five amino acid substitutions compared to the amino acid sequence of SEQ ID NOs: 1 and 2.

[0157] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:4.

[0158] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 61. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 61.

[0159] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 62. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:62.

[0160] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 63. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:63.

[0161] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64. In some embodiments, the IL-12 cytokine or functional fragment thereof comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:64.

[0162] 1.2 Masking part Provided herein are masking moieties for use in masked cytokines. It is understood that the masking moiety is cleaved from the masked cytokine to form a cleavage product thereof. The masking moiety masks the IL-12 cytokine or a functional fragment thereof in the masked cytokine, thereby reducing or preventing binding of the IL-cytokine or a functional fragment thereof to its cognate receptor.

[0163] IL-12 receptor beta 1, or IL-12Rβ1, is a subunit of the IL-12 receptor complex. IL-12Rβ1 is also known as CD212. This protein binds interleukin-12 (IL-12) with low affinity. This protein forms disulfide-linked oligomers, which are required for its IL-12 binding activity. IL-12 receptor beta 2, or IL-12Rβ2, is a subunit of the IL-12 receptor complex. Coexpression of IL-12Rβ1 and IL-12Rβ2 proteins has been shown to lead to the formation of a high-affinity IL-12 binding site.

[0164] Methods for determining the degree of binding of a protein (eg, a cytokine) to a cognate protein (eg, a cytokine receptor) are well known in the art.

[0165] In some embodiments, the masking moiety comprises an IL-12 cytokine receptor, or a subunit or functional fragment thereof.

[0166] The interleukin 12 receptor subunit beta-1, also called CD212, has the following sequence: JPEG0007771076000014.jpg152170

[0167] The interleukin-12 receptor subunit beta-2 has the following sequence: JPEG0007771076000015.jpg193170

[0168] Bold indicates the propeptide, underlined italics indicates the extracellular domain, italics indicates the transmembrane domain, and underlined bold indicates the cytoplasmic domain.

[0169] In some embodiments, the masking moiety comprises the extracellular domain of human IL-12Rβ1, or a fragment, portion, or variant thereof, that retains or otherwise demonstrates affinity for IL-12.

[0170] In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of human IL-12Rβ1 with one to four amino acid substitutions, hi some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of human IL-12Rβ1 with one or two amino acid substitutions.

[0171] In some embodiments, the masking moiety comprises residues 24-237 of human IL-12Rβ1, i.e., the sequence having SEQ ID NO:5, or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12. In some embodiments, the masking moiety comprises IL-12Rβ1 having SEQ ID NO:5. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO:5. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO:5 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO:5 with one or two amino acid substitutions.

[0172] In some embodiments, the masking moiety comprises residues 24-545 of human IL-12Rβ1, i.e., the sequence having SEQ ID NO:6, or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12. In some embodiments, the masking moiety comprises IL-12Rβ1 having SEQ ID NO:6. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO:6. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO:6 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO:6 with one or two amino acid substitutions.

[0173] In some embodiments, the masking moiety comprises the extracellular domain of human IL-12Rβ2, or a fragment, portion, or variant thereof, that retains or otherwise demonstrates affinity for IL-12. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of human IL-12Rβ2 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of human IL-12Rβ2 with one or two amino acid substitutions.

[0174] In some embodiments, the masking moiety comprises residues 24-212 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 7. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO: 7. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 7 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 7 with one or two amino acid substitutions.

[0175] In some embodiments, the masking moiety comprises residues 24-222 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 8. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO: 8. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 8 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 8 with one or two amino acid substitutions.

[0176] In some embodiments, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 9. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO: 9. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 9 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 9 with one or two amino acid substitutions.

[0177] In some embodiments, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., the sequence having SEQ ID NO:9, with one or more cysteine ​​substitutions. In some embodiments, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., the sequence having SEQ ID NO:9, with an amino acid substitution at position C242. In some embodiments, the amino acid substitution at position C242 is C242S. In some embodiments, the masking moiety comprises the amino acid sequence of SEQ ID NO:65. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:65. In some embodiments, the masking moiety consists of the amino acids of SEQ ID NO:65. In some embodiments, the masking moiety comprises residues 24-622 of IL-12Rβ2, i.e., a sequence having SEQ ID NO: 10. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO: 10. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 10 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 10 with one or two amino acid substitutions.

[0178] In some embodiments, the masking moiety comprises residues 24-227 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 11. In some embodiments, the masking moiety comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of SEQ ID NO: 11. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 11 with one to four amino acid substitutions. In some embodiments, the masking moiety comprises an amino acid sequence having the amino acid sequence of SEQ ID NO: 11 with one or two amino acid substitutions.

[0179] 1.3 Linker Provided herein are linkers for use in masked cytokines or cleavage products thereof. Provided herein are linkers, which refer to a peptide of two additional amino acids that is used to link two functional components together in the masked cytokines described herein.

[0180] The masked cytokine comprises a first linker and a second linker, wherein one of the first linker or the second linker comprises a proteolytically cleavable peptide.

[0181] In some embodiments, the second linker comprises a proteolytically cleavable peptide (a linker referred to herein as a "proteolytically cleavable linker") and the first linker does not comprise a proteolytically cleavable peptide (a linker referred to herein as a "non-proteolytically cleavable linker"), such that the first polypeptide chain comprises: JPEG0007771076000016.jpg7170The second polypeptide chain comprises: JPEG0007771076000017.jpg7170

[0182] In some embodiments, the first linker comprises a proteolytically cleavable peptide (a linker referred to herein as a "proteolytically cleavable linker" or "cleavable linker") and the second linker does not comprise a proteolytically cleavable peptide (a linker referred to herein as a "non-proteolytically cleavable linker" or "non-cleavable linker"), such that the first polypeptide chain comprises: JPEG0007771076000018.jpg7170The second polypeptide chain comprises: JPEG0007771076000019.jpg7170

[0183] Non-cleavable and cleavable linkers of some embodiments are described in more detail below.

[0184] 1.3.1 Non-proteolytically cleavable linkers In some embodiments, the non-cleavable linker is 3 to 18 amino acids in length.

[0185] In some embodiments, the non-cleavable linker is 3 to 15 amino acids in length.

[0186] In some embodiments, the non-cleavable linker is rich in G and S amino acid residues.

[0187] In some embodiments, the non-cleavable linker comprises only amino acid residue types selected from the group consisting of G and S.

[0188] In some embodiments, the non-cleavable linker is [(G) n S], where n=4 or 5.

[0189] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 12 (GGGGS).

[0190] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 13 (GGGGSGGGGS).

[0191] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 14 (GGSGGGSGGGGGS).

[0192] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 54 (GGSGGSGGSGGSGGSSGP).

[0193] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 55 (PGGSGP).

[0194] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 56 (GGSPG).

[0195] In some embodiments, the second linker comprises a proteolytically cleavable peptide such that the second linker is a proteolytically cleavable linker, and the first linker does not comprise a proteolytically cleavable peptide such that the first linker is a non-proteolytically cleavable linker. In some embodiments, the non-cleavable linker is 3 to 18 amino acids in length. In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 12 (GGGGS). In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 13 (GGGGSGGGGS). In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 14 (GGSGGGSGGGGGS). In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 54 (GGSGGSGGSGGSGGSSGP). In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 55 (PGGSGP). In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 56 (GGSPG).

[0196] In some embodiments, it is desirable that the first and second polypeptide chains be the same or similar length to facilitate association of the first half-life prolonging domain with the second half-life prolonging domain and masking of the IL-12 cytokine or functional fragment thereof in the assembly construct. Thus, if the masking moiety is a shorter amino acid sequence than the IL-12 cytokine or functional fragment thereof, the difference in length can be fully or partially compensated for by using a longer linker L1.

[0197] 1.3.2 Proteolytically Cleavable Linkers In some embodiments, the cleavable linker is 10 to 25 amino acids in length.

[0198] In some embodiments, the cleavable linker comprises a proteolytically cleavable peptide (CP) flanked by spacer domains (SD) shown below. SD-CP-SD

[0199] Cleavable peptides The cleavable linker comprises a cleavable peptide.

[0200] A cleavable peptide is a polypeptide that contains a protease cleavage site such that the cleavable peptide is proteolytically cleavable. A protease is an enzyme that cleaves and hydrolyzes a peptide bond between two specific amino acid residues in a target substrate protein. As used herein, a "cleavage site" refers to a recognizable site for cleavage of a portion of a cleavable peptide found in any of the linkers comprising the cleavable peptides described herein. Thus, the cleavage site can be found in the sequence of the cleavable peptides described herein. In some embodiments, the cleavage site is an amino acid sequence that is recognized and cleaved by a cleaving agent.

[0201] In some embodiments, the protease cleavage site is a tumor-associated protease cleavage site. As provided herein, a "tumor-associated protease cleavage site" is an amino acid sequence recognized by a protease, the expression of which is specific to or upregulated in tumor cells or the tumor cell environment.

[0202] The tumor cell environment is complex and can contain multiple different proteases. Therefore, the exact site at which a given cleavable peptide is cleaved in the tumor cell environment can vary between tumor types, between patients with the same tumor type, and even between cleavage products formed in the same tumor, depending on the specific tumor cell environment. Furthermore, even after cleavage, further modification of the initial cleavage product, for example, by removing one or two terminal amino acids, can occur through the further action of proteases in the tumor cell environment. Therefore, a distribution of cleavage products can be expected to be formed in the tumor cell environment of a patient after administration of a single structure of the masked cytokine described herein.

[0203] It should be understood that the cleavage site referred to herein refers to the site between two specific amino acid residues in the cleavable peptide, which is the target of the protease known to be associated with tumor cell environment.In this sense, there can be more than one cleavage site in the cleavable peptide described herein, and different proteases cleave the cleavable peptide at different cleavage sites.It is also possible that more than one protease can act on the same cleavage site in the cleavable peptide.Discussion of protease cleavage site can be found in the art.

[0204] Thus, the cleavable peptides disclosed herein can be cleaved by one or more proteases.

[0205] In some embodiments, the cleavable peptide is a substrate for a protease that is co-localized within a region or tissue that expresses the IL-12 cytokine receptor.

[0206] In some embodiments, the cleavable peptide is a 5-mer (i.e., a peptide that is 5 amino acids in length), a 6-mer (i.e., a peptide that is 6 amino acids in length), a 7-mer (i.e., a peptide that is 7 amino acids in length), an 8-mer (i.e., a peptide that is 8 amino acids in length), a 9-mer (i.e., a peptide that is 9 amino acids in length), a 10-mer (i.e., a peptide that is 10 amino acids in length), an 11-mer (i.e., a peptide that is 11 amino acids in length), a 12-mer (i.e., a peptide that is 12 amino acids in length), a 13-mer (i.e., a peptide that is 13 amino acids in length), a 14-mer (i.e., a peptide that is 14 amino acids in length), a 15-mer (i.e., a peptide that is 15 amino acids in length), a 16-mer (i.e., a peptide that is 16 amino acids in length), a 17-mer (i.e., a peptide that is 17 amino acids in length), or an 18-mer (i.e., a peptide that is 18 amino acids in length).

[0207] In some embodiments, the cleavable peptide is 5 to 18 amino acids in length. In some embodiments, the cleavable peptide is 6 to 10 amino acids in length.

[0208] In some embodiments, the cleavable peptide in the cleavable linker comprises an amino acid selected from the group consisting of: [Table 1]

[0209] Purely by way of example, in the above table, * indicates a known or observed protease cleavage site within the cleavable peptide.

[0210] In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 15 (VPLS*LY), for example, the cleavable peptide may comprise the amino acid sequence of SEQ ID NO: 210 (VPLSLYSG). In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 41 (MPYD*LYHP). In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 42 (DSGG*FMLT). In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 43 (RAAA*VKSP). In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 44 (ISSGLL*SGRS), for example, the cleavable peptide may comprise the amino acid sequence of SEQ ID NO: 211 (ISSGLLSGRSDQP). In some embodiments, the cleavable peptide comprises the amino acid sequence of SEQ ID NO: 45 (DLLA*VVAAS).

[0211] In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 15 (VPLS*LY). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 210 (VPLSLYSG). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 41 (MPYD*LYHP). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 42 (DSGG*FMLT). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 43 (RAAA*VKSP). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 44 (ISSGLL*SGRS). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 211 (ISSGLLSGRSDQP). In some embodiments, the cleavable peptide consists of the amino acid sequence of SEQ ID NO: 45 (DLLA*VVAAS).

[0212] Cleavable peptides having the amino acid sequences set forth in SEQ ID NO: 44 or 45 have been found to demonstrate highly specific cleavage within a tumor cell environment compared to a non-tumor cell environment. Thus, when these cleavable peptides are incorporated into a masked IL-12 cytokine as disclosed elsewhere herein, any systemic side effects of the administered IL-12 cytokine or functional fragment thereof can be further reduced.

[0213] spacer domain The spacer domain can consist of one or more amino acids. The function of the spacer domain, if present, is to link the proteolytically cleavable peptide (CP) to other functional components in the constructs described herein.

[0214] It is understood that the spacer domain does not alter the biological interactions of the proteolytically cleavable peptide with proteases in a tumor cell environment or a non-tumor cell environment. In other words, even in the presence of a spacer domain, the inventive proteolytically cleavable peptides disclosed herein retain their advantageous tumor specificity.

[0215] In some embodiments, the spacer domains flanking the proteolytically cleavable peptide are different.

[0216] In some embodiments, the spacer domain is rich in the amino acid residues G, S, and P.

[0217] In some embodiments, the spacer domain comprises only amino acid residue types selected from the group consisting of G, S, and P.

[0218] In some embodiments, the cleavable linker comprises: JPEG0007771076000021.jpg7170SD1 is the first spacer domain and SD2 is the second spacer domain.

[0219] In some embodiments, the cleavable linker comprises: JPEG0007771076000022.jpg7170

[0220] In some embodiments, the first polypeptide chain comprises: JPEG0007771076000023.jpg7170 The second polypeptide chain comprises: JPEG0007771076000024.jpg7170

[0221] In some embodiments, the first polypeptide chain comprises: JPEG0007771076000025.jpg7170 The second polypeptide chain comprises: JPEG0007771076000026.jpg8170

[0222] In some embodiments, the N-terminus of SD1 is glycine (G).

[0223] In some embodiments, the first spacer domain (SD1) is 3 to 10 amino acids in length. In some embodiments, the first spacer domain (SD1) is 5 to 9 amino acids in length.

[0224] In some embodiments, SD1 comprises SEQ ID NO: 16 (GGSGGS).

[0225] In some embodiments, SD1 comprises SEQ ID NO: 17 (GGSGGSGGS).

[0226] In some embodiments, the C-terminal sequence of SD2 is JPEG0007771076000027.jpg7170.

[0227] In some embodiments, the second spacer domain (SD2) is 3 to 6 amino acids in length.

[0228] In some embodiments, SD2 comprises SEQ ID NO: 18 (SGP).

[0229] Exemplary combinations of SD1 and SD2 in cleavable linkers are shown below. [Table 2]

[0230] In some embodiments, the proteolytically cleavable linker comprises SD1-CP-SD2, where SD1 is a first spacer domain, CP is a cleavable peptide, and SD2 is a second spacer domain, and CP has the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, the spacer domain is rich in amino acid residues G, S, and P. In some embodiments, the spacer domain comprises only amino acid residue types selected from the group consisting of G, S, and P.

[0231] In some embodiments, the proteolytically cleavable linker comprises SD1-CP-SD2, where SD1 is a first spacer domain, CP is a cleavable peptide, and SD2 is a second spacer domain, and CP has the amino acid sequence set forth in SEQ ID NO: 45. In some embodiments, the spacer domain is rich in the amino acid residues G, S, and P. In some embodiments, the spacer domain comprises only amino acid residue types selected from the group consisting of G, S, and P.

[0232] In some embodiments, the proteolytically cleavable linker comprises SD1-CP-SD2, where SD1 is a first spacer domain, CP is a cleavable peptide, and SD2 is a second spacer domain, where CP has the amino acid sequence set forth in SEQ ID NO:44, and SD2 has the amino acid sequence set forth in SEQ ID NO:18. In some embodiments, SD1 is 3-6 amino acids in length. In some embodiments, the spacer domain is rich in the amino acid residues G, S, and P. In some embodiments, the spacer domain comprises only amino acid residue types selected from the group consisting of G, S, and P.

[0233] In some embodiments, the proteolytically cleavable linker comprises SD1-CP-SD2, where SD1 is a first spacer domain, CP is a cleavable peptide, and SD2 is a second spacer domain, where CP has the amino acid sequence set forth in SEQ ID NO:45, and SD2 has the amino acid sequence set forth in SEQ ID NO:18. In some embodiments, SD1 is 3-6 amino acids in length. In some embodiments, the spacer domain is rich in the amino acid residues G, S, and P. In some embodiments, the spacer domain comprises only amino acid residue types selected from the group consisting of G, S, and P.

[0234] In some embodiments, the cleavable linker is Contains JPEG0007771076000029.jpg8170.

[0235] In some embodiments, the cleavable linker is Contains JPEG0007771076000030.jpg7170.

[0236] In some embodiments, the cleavable linker is Contains JPEG0007771076000031.jpg8170.

[0237] In some embodiments, the cleavable linker is Contains JPEG0007771076000032.jpg7170.

[0238] In some embodiments, the cleavable linker is Contains JPEG0007771076000033.jpg7170.

[0239] In some embodiments, the cleavable linker is Contains JPEG0007771076000034.jpg8170.

[0240] In some embodiments, the cleavable linker is Contains JPEG0007771076000035.jpg8170.

[0241] In some embodiments, the cleavable linker is Contains JPEG0007771076000036.jpg7170.

[0242] In some embodiments, the cleavable linker is Contains JPEG0007771076000037.jpg7170.

[0243] In some embodiments, the cleavable linker is Contains JPEG0007771076000038.jpg7170.

[0244] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 12 (GGGGS) and the cleavable linker comprises Contains JPEG0007771076000039.jpg7170.

[0245] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 13 (GGGGSGGGGS) and the cleavable linker comprises Contains JPEG0007771076000040.jpg7170.

[0246] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 14 (GGSGGGSGGGGGS) and the cleavable linker comprises Contains JPEG0007771076000041.jpg8170.

[0247] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 12 (GGGGS) and the cleavable linker comprises Contains JPEG0007771076000042.jpg7170.

[0248] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 13 (GGGGSGGGGS) and the cleavable linker comprises Contains JPEG0007771076000043.jpg7170.

[0249] In some embodiments, the non-cleavable linker comprises the amino acid sequence set forth in SEQ ID NO: 14 (GGSGGGSGGGGGS) and the cleavable linker comprises Contains JPEG0007771076000044.jpg7170.

[0250] In some embodiments, the second linker comprises a proteolytically cleavable peptide such that the second linker is a proteolytically cleavable linker, and the first linker does not comprise a proteolytically cleavable peptide such that the first linker is a non-proteolytically cleavable linker, in which the cleavable linker comprises SEQ ID NO: 46 and the non-cleavable linker comprises SEQ ID NO: 55. In some embodiments, the cleavable linker comprises SEQ ID NO: 47 and the non-cleavable linker comprises SEQ ID NO: 55. In some embodiments, the cleavable linker comprises SEQ ID NO: 48 and the non-cleavable linker comprises SEQ ID NO: 55. In some embodiments, the cleavable linker comprises SEQ ID NO: 49 and the non-cleavable linker comprises SEQ ID NO: 56. In some embodiments, the cleavable linker comprises SEQ ID NO: 50 and the non-cleavable linker comprises SEQ ID NO: 55. In some embodiments, the cleavable linker comprises SEQ ID NO: 50 and the non-cleavable linker comprises SEQ ID NO: 14. In some embodiments, the cleavable linker comprises SEQ ID NO: 51 and the non-cleavable linker comprises SEQ ID NO: 56. In some embodiments, the cleavable linker comprises SEQ ID NO:51 and the non-cleavable linker comprises SEQ ID NO: 14. In some embodiments, the cleavable linker comprises SEQ ID NO:52 and the non-cleavable linker comprises SEQ ID NO:55. In some embodiments, the cleavable linker comprises SEQ ID NO:52 and the non-cleavable linker comprises SEQ ID NO:14. In some embodiments, the cleavable linker comprises SEQ ID NO:53 and the non-cleavable linker comprises SEQ ID NO:56. In some embodiments, the cleavable linker comprises SEQ ID NO:53 and the non-cleavable linker comprises SEQ ID NO:14.

[0251] In some embodiments, the proteolytically cleavable linker comprises a cleavable peptide consisting of the amino acid sequence of SEQ ID NO: 44 (ISSGLL*SGRS).

[0252] In some embodiments, the proteolytically cleavable linker comprises a cleavable peptide consisting of the amino acid sequence of SEQ ID NO: 45 (DLLA*VVAAS).

[0253] The linker combinations disclosed herein and in the exemplary AK molecules can be used with any IL-12 cytokine or fragment thereof disclosed herein. The linker combinations disclosed herein and in the exemplary AK molecules can be used with any masking moiety disclosed herein. The linker combinations disclosed herein and in the exemplary AK molecules can be used with any half-life prolonging domain. In other words, the linkers disclosed in the exemplary AK molecules can be used in combination with an IL-12 cytokine or fragment thereof disclosed herein, a masking moiety disclosed herein, and / or a half-life prolonging domain disclosed herein.

[0254] 1.4 Extended Half-Life Domains Provided herein is a half-life prolonging domain for use in a masked cytokine or its cleavage product. A long half-life in vivo is important for a therapeutic protein. Unfortunately, cytokines administered to a subject generally have a short half-life because they are typically rapidly removed from the subject by mechanisms including renal clearance and endocytic degradation. Therefore, in the masked cytokines provided herein, a half-life prolonging domain is linked to the masked cytokine for the purpose of prolonging the half-life of the cytokine in vivo.

[0255] The term "half-life prolonging domain" refers to a domain that prolongs the half-life of a target component in serum. The term "half-life prolonging domain" encompasses, for example, antibodies and antibody fragments.

[0256] The masked cytokines provided herein comprise a first half-life prolonging domain associated with a second half-life prolonging domain.

[0257] In some embodiments, the first half-life prolonging domain and the second half-life prolonging domain are non-covalently associated.

[0258] In some embodiments, the first half-life prolonging domain and the second half-life prolonging domain are covalently linked.

[0259] In some embodiments, the first half-life prolonging domain is linked to the second half-life prolonging domain via one or more disulfide bonds.

[0260] In some embodiments, the first half-life prolonging domain is linked to the second half-life prolonging domain via a half-life prolonging domain linker (HLDL).

[0261] In some embodiments, the first half-life prolonging domain and the second half-life prolonging domain are non-covalently associated, and further, the first half-life prolonging domain is linked to the second half-life prolonging domain via a disulfide bond.

[0262] In some embodiments, the first half-life prolonging domain comprises a first antibody or fragment thereof and the second half-life prolonging domain comprises a second antibody or fragment thereof.

[0263] Antibodies or fragments thereof capable of FcRn-mediated recirculation may reduce or otherwise delay clearance of the masked cytokine from a subject, thereby extending the half-life of the administered masked cytokine. In some embodiments, the antibody or fragment thereof is any antibody or fragment thereof capable of FcRn-mediated recirculation, such as any heavy chain polypeptide or portion thereof (e.g., an Fc domain or fragment thereof) capable of FcRn-mediated recirculation.

[0264] The antibody or fragment thereof can be any antibody or fragment thereof. However, in some embodiments of a masked cytokine comprising a first half-life prolonging domain and a second half-life prolonging domain, either the first half-life prolonging domain or the second half-life prolonging domain can comprise an antibody or fragment thereof that does not bind to the FcRn receptor, such as a light chain polypeptide. For example, in some embodiments of a masked cytokine, the first half-life prolonging domain comprises an antibody or fragment thereof comprising a light chain polypeptide or a portion thereof that does not directly interact with the FcRn receptor, but the masked cytokine nevertheless has an extended half-life by comprising a second half-life prolonging domain that is capable of interacting with the FcRn receptor, such as by comprising a heavy chain polypeptide. It is recognized in the art that FcRn-mediated recycling requires binding of the FcRn receptor to the Fc region of an antibody or fragment thereof. For example, studies have shown that residues I253, S254, H435, and Y436 (numbered according to the Kabat EU index numbering system) are important for the interaction between the human Fc region and the human FcRn complex. See, e.g., Firan, M., et al., Int. Immunol. 13 (2001) 993-1002; Shields, R.L., et al., J. Biol. Chem. 276 (2001) 6591-6604). Various variants of residues 248-259, 301-317, 376-382, and 424-437 (numbered according to the Kabat EU index numbering system) have also been investigated and reported. Yeung, Y.A., et al. (J. Immunol. 182 (2009) 7667-7671).

[0265] In some embodiments, the antibody or fragment thereof comprises either a heavy chain polypeptide or a light chain polypeptide. In some embodiments, the antibody or fragment thereof comprises a portion of either a heavy chain polypeptide or a light chain polypeptide. In some embodiments, the antibody or fragment thereof comprises an Fc domain or a fragment thereof. In some embodiments, the antibody or fragment thereof comprises a CH2 and a CH3 domain or a fragment thereof. In some embodiments, the antibody or fragment thereof comprises a constant domain of a heavy chain polypeptide. In some embodiments, the antibody or fragment thereof comprises a constant domain of a light chain polypeptide. In some embodiments, the antibody or fragment thereof comprises a heavy chain polypeptide or a fragment thereof (e.g., an Fc domain or a fragment thereof). In some embodiments, the antibody or fragment thereof comprises a light chain polypeptide.

[0266] In some embodiments, the first half-life prolonging domain comprises a first Fc domain or a fragment thereof, and the second half-life prolonging domain comprises a second Fc domain or a fragment thereof.

[0267] In some embodiments, the first and / or second Fc domain each comprise one or more modifications that promote non-covalent association of the first and second half-life prolonging domains. In some embodiments, the first half-life prolonging domain comprises an IgG1 Fc domain or a fragment thereof comprising the mutations Y349C, T366S, L38A, and Y407V, which form a "hole" in the first half-life prolonging domain, and the second half-life prolonging domain comprises an IgG1 Fc domain or a fragment thereof comprising the mutations S354C and T366W, which form a "knob" in the second half-life prolonging domain.

[0268] In some embodiments, the first and second half-life prolonging domains are each an IgG1, IgG2, or IgG4 Fc domain or fragment thereof. In some embodiments, the first and second half-life prolonging domains are each an IgG1 Fc domain or fragment thereof. The human IgG1 immunoglobulin heavy chain constant gamma 1 has the following sequence: JPEG0007771076000045.jpg79170

[0269] In some embodiments, the first and second half-life prolonging domains are derived from the sequence of human IgG1 immunoglobulin heavy chain constant gamma 1 having SEQ ID NO: 21 (the "parent sequence"), such that the first and second half-life prolonging domains each comprise SEQ ID NO: 21 or a fragment thereof with one or more amino acid modifications.

[0270] In some embodiments, the first and second half-life prolonging domains each comprise the portion of SEQ ID NO: 21 shown in bold above, optionally with one or more amino acid modifications, i.e., DKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 22)

[0271] In some embodiments, the first and second half-life prolonging domains comprise SEQ ID NO:22 with amino substitutions to promote association of the first and second half-life prolonging domains according to a "knob-into-holes" approach. In some embodiments, the sequence SEQ ID NO:22 comprises mutations Y349C, T366S, L38A, and Y407V (numbered according to the Kabat EU numbering system) that form "holes" in the first half-life prolonging domain, and mutations S354C and T366W (numbered according to the Kabat EU numbering system) that form "knobs" in the second half-life prolonging domain. These modified sequences have SEQ ID NOs:23 and 24, as shown below. First half-life prolonging domain (Y349C, T366S, L38A, and Y407V) SEQ ID NO: 23: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQ VSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG Second half-life prolonging domain (S354C and T366W) SEQ ID NO: 24: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTK NQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

[0272] In some embodiments, the first and second half-life extending domains each further comprise the amino substitution N297A, numbered according to the Kabat EU numbering system. First half-life prolonging domain (Y349C, T366S, L38A, Y407V, and N297A) SEQ ID NO: 25: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQ VSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG Second half-life prolonging domain (S354C, T366W, and N297A) SEQ ID NO: 26: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTK NQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

[0273] In some embodiments, the first and second half-life prolonging domains each further comprise the amino substitution I253A, numbered according to the Kabat EU numbering system.

[0274] In some embodiments, the first and second half-life extending domains each further comprise both amino substitutions N297A and I253A, numbered according to the Kabat EU numbering system. First half-life prolonging domain (Y349C, T366S, L38A, Y407V, N297A, and I253A) SEQ ID NO: 27: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMASRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKE YKCKVSNKALAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCA VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG Second half-life prolonging domain (S354C, T366W, N297A, and I253A) SEQ ID NO: 28: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMASRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEY KCKVSNKALAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG

[0275] In some embodiments, the first half-life prolonging domain comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of any one of SEQ ID NOs: 22, 23, 25, and 27.

[0276] In some embodiments, the second half-life prolonging domain comprises an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of the amino acid sequences of any one of SEQ ID NOs: 22, 24, 26, and 28.

[0277] In some embodiments, the first half-life prolonging domain comprises an amino acid sequence having one or more modifications, such as one or more amino acid substitutions, additions, or deletions, compared to the amino acid sequence of any one of SEQ ID NOs: 22, 23, 25, and 27. In some embodiments, the second half-life prolonging domain comprises an amino acid sequence having one or more modifications, such as one or more amino acid substitutions, additions, or deletions, compared to the amino acid sequence of any one of SEQ ID NOs: 22, 24, 26, and 28. The one or more modifications may be any modification or alteration described herein, in some embodiments, including any modification or alteration that promotes heterodimerization of polypeptide chains and / or inhibits homodimerization of polypeptide chains, or that alters or enhances effector function.

[0278] In some embodiments, the Fc domain or fragment thereof comprises one or more amino acid substitutions that alter effector function. In some embodiments, the half-life prolonging domain is an IgG1 Fc domain or fragment thereof and comprises one or more amino acid substitutions selected from the group consisting of N297A, N297G, N297Q, L234A, L235A, C220S, C226S, C229S, P238S, E233P, L234V, L234F, L235E, P331S, S267E, L328F, D265A, and P329G, numbered according to the Kabat EU numbering system. In some embodiments, the half-life prolonging domain is an IgG2 Fc domain or a fragment thereof and comprises the amino substitutions: V234A and G237A, H268Q, V309L, A330S, and A331S, and / or V234A, G237A, P238S, H268A, V309L, and A330S, numbered according to the Kabat EU numbering system. In some embodiments, the half-life prolonging domain is an IgG2 Fc domain or a fragment thereof and comprises one or more amino acid substitutions selected from the group consisting of: V234A, G237A, H268Q, V309L, A330S, A331S, P238S, H268A, and V309L, numbered according to the Kabat EU numbering system. In some embodiments, the half-life prolonging domain is an IgG4 Fc domain or a fragment thereof and comprises the amino substitutions: L235A, G237A, and E318A, S228P, L234A, and L235A, H268Q, V309L, A330S, and P331S, and / or S228P and L235A, numbered according to the Kabat EU numbering system. In some embodiments, the half-life prolonging domain is an IgG2 Fc domain or a fragment thereof and comprises one or more amino acid substitutions selected from the group consisting of: L235A, G237A, E318A, S228P, L234A, H268Q, V309L, A330S, and P331S, numbered according to the Kabat EU numbering system.

[0279] In some embodiments, the half-life prolonging domain comprises an Fc domain or a fragment thereof comprising one or more amino acid substitutions that enhance effector function. In some embodiments, the half-life prolonging domain is an IgG1 Fc domain or a fragment thereof, comprising the following amino acid substitutions, numbered according to the Kabat EU numbering system: S298A, E333A, and K334A; S239D and I332E; S239D, A330L, and I332E; P247I and A339D or A339Q; D280H and K290S; D280H, K290S, and either S298D or S298V; F243L, R292P, and Y300L; F243L, R292P, Y300L, and P396L; F243L, R292P, Y300L, V305I, and P396L; G 236A, S239D, and I332E; K326A and E333A; K326W and E333S; K290E, S298G, and T299A; K290E, S298G, T299A, and K326E; K290N, S298G, and T299A; K290N, S298G, T299A, and K326E; K334V; L235S, S239D, and K334V; K334V and Q331M, S239D, F243V, E294L, or S298T; E233L, Q311M, and K33 4V; L234I, Q311M, and K334V; K334V and S298T, A330M or A330F; K334V, Q311M, and either A330M or A330F; K334V, S298T, and either A330M or A330F; K334V, S239D, and either A330M or S298T; L234Y, Y296W, and K290Y, F243V or E294L; Y296W and either L234Y or K290Y; S239D, A330S, and I3 32E, V264I;F243L and V264I;L328M;I332E;L328M and I332E;V264I and I332E;S239E and I332E;S239Q and I332D;S239E;A330Y;I332D;L328I and I332E;L328Q and I332E;V264T;V240I;V266I;S239D;S239D and I332D;S239D and I332N;S239D and I332Q;S239E and I332D;S239E and I332N;S239E and I332Q; S239N and I332D; S239N and I332E; S239Q and I332D; A330Y and I332E; V264I, A330Y and I332E; A330L and I332E; V264I, A330L, and I332E; L234E, L234Y, or L234I; L235D, L235S, L235Y, or L235I; S239T; V240M; V264Y; A330I; N325T; I332E and L328D, L328V, L328T, or L328I; V264I, I332E, and either S239E or S239Q; S239E, V264I, A330Y, and I332E; A330Y, I332E, either S239D or S239N; A330L, I332E, either S239D or S239N; V264I, S298A, and I332E; S298A, I332 E, S239D, or S239N; S239D, V264I, and I332E; S239D, V264I, S298A, and I332E; S239D, V264I, A330L, and I332E; S239D, I332E, and A330I; P230A, P230A, E233D, and I332E; E272Y; K274T, K274E, K274R, K274L, or K274Y; F275W; N276L ;Y278T;V302I;E318R;S324D, S324I or S324V;K326I or K326T;T335D, T335R, or T335Y;V240I and V266I;S239D, A330Y, I332E, and L234I;S239D, A330Y, I332E, and L235D;S239D, A330Y, I332E, and V240I;S239D, A330Y, I332E, and V264T;and / or S239D, A330Y, I332E, and either K326E or K326T. In some embodiments, the half-life prolonging domain is an IgG1 Fc domain or a fragment thereof and comprises P230A, E233D, L234E, L234Y, L234I, L235D, L235S, L235Y, L235I, S239D, S239E, S239N, S239Q, S239T, V240I, V240M, F243L, V264I, V264T, V264Y, V266I, E272Y, K274T, K274E, K274R, K274L, K274Y, F275W, comprising one or more amino acid substitutions selected from the group consisting of N276L, Y278T, V302I, E318R, S324D, S324I, S324V, N325T, K326I, K326T, L328M, L328I, L328Q, L328D, L328V, L328T, A330Y, A330L, A330I, I332D, I332E, I332N, I332Q, T335D, T335R, and T335Y;

[0280] In some embodiments, the half-life prolonging domain comprises one or more amino acid substitutions that enhance binding of the half-life prolonging domain to FcRn, hi some embodiments, the one or more amino acid substitutions increase the binding affinity of the Fc-containing polypeptide (e.g., heavy chain polypeptide or Fc domain or fragment thereof) to FcRn at acidic pH. In some embodiments, the half-life extending domain comprises one or more amino acid substitutions selected from the group consisting of M428F, T250Q and M428F; M252Y, S254T, and T256E; P257I and N434H; D376V and N434H; P257I and Q3111; N434A; N434W; M428F and N434S; V259I and V308F; M252Y, S254T, and T256E; V259I, V308F, and M428F; T307Q and N434A; T307Q and N434S; T307Q, E380A, and N434A; V308P and N434A; N434H; and V308P.

[0281] For manufacturing purposes, a signal peptide can be engineered upstream of the half-life domain to improve secretion of the protein. The signal peptide is selected according to the requirements of the cell line, as known in the art. It should be understood that the signal peptide is not expressed as part of the protein that is purified and formulated as a pharmaceutical.

[0282] 1.4.1 Heterodimerization modification The half-life prolonging domains described herein may contain one or more modifications that promote heterodimerization of two different half-life prolonging domains. In some embodiments, it is desirable to promote heterodimerization of the first and second half-life prolonging domains so that the production of the masked cytokine in its correct heterodimeric form is efficiently produced. Thus, one or more amino acid modifications can be made to the first half-life prolonging domain and one or more amino acid modifications can be made to the second half-life prolonging domain using any strategy available in the art, including any strategy described in Klein et al. (2012), MAbs, 4(6):653-663. Exemplary strategies and modifications are described in detail below.

[0283] Knob-into-hole approach One strategy for promoting heterodimerization of two different half-life extending domains is the so-called "knobs-into-holes" approach.

[0284] In some embodiments, the masked cytokine comprises a first half-life prolonging domain and a second half-life prolonging domain, each comprising a CH3 domain. In some embodiments, the half-life prolonging domain comprising a CH3 domain is a heavy chain polypeptide or a fragment thereof (e.g., an Fc domain or a fragment thereof). The CH3 domains of the two half-life prolonging domains can be modified, for example, by "knob-into-hole" technology, which is described in detail, with some examples, in, for example, WO 1996 / 027011; Ridgway, JB et al., Protein Eng. (1996) 9(7):617-621; Merchant, AM, et al., Nat. Biotechnol. (1998) 16(7):677-681. See also Klein et al. (2012), MAbs, 4(6):653-663. Using the knobs-into-holes method, the interaction surfaces of two CH3 domains are modified to increase heterodimerization of two half-life extending domains containing two modified CH3 domains. This is achieved by introducing a bulky residue into the CH3 domain of one of the half-life extending domains, which acts as a "knob." A "hole" capable of accommodating the knob is then formed in the other half-life extending domain to accommodate the bulky residue. One of the modified CH3 domains can be the "knob," while the other can be the "hole." The introduction of disulfide bridges further stabilizes the heterodimer (Merchant, AM, et al., Nat. Biotechnol. (1998) 16(7); Atwell, S., et al., J. Mol. Biol. (1997) 270(1):26-35) and increases the yield.

[0285] It has been reported that heterodimerization yields of over 97% can be achieved by introducing S354C and T366W mutations in the heavy chain to create a "knob" and Y349C, T366S, L368A, and Y407V mutations in the heavy chain to create a "hole" (residue numbering according to the Kabat EU numbering system). Carter et al. (2001), J. Immunol. Methods, 248:7-15; Klein et al. (2012), MAbs, 4(6):653-663.

[0286] In some embodiments comprising a first half-life prolonging domain and a second half-life prolonging domain, the first half-life prolonging domain comprises a heavy chain polypeptide or portion thereof (e.g., an Fc domain or fragment thereof) comprising the amino acid mutations S354C and T366W (numbered according to the Kabat EU numbering system), and the second half-life prolonging domain comprises a heavy chain polypeptide or portion thereof (e.g., an Fc domain or fragment thereof) comprising the amino acid mutations Y349C, T366S, L368A, and Y407V (numbered according to the Kabat EU numbering system). In some embodiments comprising a first half-life prolonging domain and a second half-life prolonging domain, the first half-life prolonging domain comprises a heavy chain polypeptide or portion thereof (e.g., an Fc domain or fragment thereof) comprising the amino acid mutations Y349C, T366S, L368A, and Y407V (numbered according to the Kabat EU numbering system), and the second half-life prolonging domain comprises a heavy chain polypeptide or portion thereof (e.g., an Fc domain or fragment thereof) comprising the amino acid mutations S354C and T366W (numbered according to the Kabat EU numbering system).

[0287] Additional examples of substitutions that can be made to form knobs and holes include those described in US20140302037A1, the contents of which are incorporated herein by reference. For example, in some embodiments, any of the following amino acid substitutions can be made in a first half-life prolonging domain ("first domain") and a paired second half-life prolonging domain ("second domain"), each containing an Fc domain: (a) Y407T in the first domain and T366Y in the second domain, (b) Y407A in the first domain and T366W in the second domain, (c) F405A in the first domain and T394W in the second domain, (d) F405W in the first domain and T394S in the second domain, (e) Y407T in the first domain and T366Y in the second domain, (f) Y407T in the first domain and T366Y in the second domain, (g) Y407T in the first domain and T366Y in the second domain, (h) Y407T in the first domain and T366Y in the second domain, (i) Y407T in the first domain and T366Y in the second domain, (j) Y407T in the first domain and T366Y in the second domain, (j) Y407A in the first domain and T366Y in the second domain, (k ... (g) T366W and F405W in the first domain and T394S and Y407A in the second domain; (h) F405W and Y407A in the first domain and T366W and T394S in the second domain; or (i) T366W in the first domain and T366S, L368A, and Y407V in the second domain.

[0288] In some embodiments, any of the following amino acid substitutions may be made in a first half-life prolonging domain ("first domain") and a paired second half-life prolonging domain ("second domain"), each containing an Fc domain: (a) Y407T in the second domain and T366Y in the first domain; (b) Y407A in the second domain and T366W in the first domain; (c) F405A in the second domain and T394W in the second domain; (d) F405W in the second domain and T394S in the first domain; (e) Y407T in the second domain and T366Y in the first domain; (f) Y407T in the second domain and T366Y in the first domain, numbered according to the Kabat EU numbering system. (g) T366W and F405A in the second domain and T394W and Y407T in the first domain, (h) F405W and Y407A in the second domain and T366W and T394S in the first domain, or (i) T366W in the second domain and T366S, L368A, and Y407V in the first domain.

[0289] In embodiments comprising a first half-life prolonging domain and a second half-life prolonging domain, each comprising an Fc domain, any of the heterodimerization modifications described herein can be used in the Fc domain to promote heterodimer formation of any of the masked cytokines described herein.

[0290] 1.5 Exemplary Masked Cytokines A masked cytokine according to the present disclosure can combine an IL-12 cytokine or a functional fragment thereof as described anywhere herein, a masking moiety as described anywhere herein, a first and second half-life domain as described anywhere herein, and a cleavable and non-cleavable linker as described anywhere herein.

[0291] Additionally, in certain embodiments, any specific sequence disclosed herein may optionally include additional amino acid substitutions, such as one, two, or three substitutions. In another embodiment, sequences having at least 90%, preferably 95%, and more preferably 99% homology to any specific sequence disclosed herein for the masked cytokine domain are also encompassed by the present invention.

[0292] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises human IL-12Rβ1 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0293] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-237 of human IL-12Rβ1, i.e., the sequence having SEQ ID NO: 5, or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0294] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-545 of human IL-12Rβ1, i.e., the sequence having SEQ ID NO: 6, or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0295] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0296] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 61, the masking portion comprises human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0297] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 62, the masking portion comprises human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0298] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 63, the masking portion comprises human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0299] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, wherein the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0300] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking portion comprises human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0301] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-212 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 7, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0302] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-222 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 8, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0303] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 9, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0304] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0305] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 63, the masking portion comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0306] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking portion comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0307] In some embodiments, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0308] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-622 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 10, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0309] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-227 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 11, the first half-life extending domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life extending domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0310] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises human IL-12Rβ1 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0311] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-237 of human IL-12Rβ1, i.e., the sequence having SEQ ID NO: 5, or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0312] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-545 of human IL-12Rβ1, i.e., the sequence having SEQ ID NO: 6, or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0313] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0314] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-212 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 7, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0315] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-222 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 8, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0316] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 9, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0317] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking portion comprises residues 24-622 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 10, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0318] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, the masking moiety comprises residues 24-227 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 11, the first half-life extending domain comprises SEQ ID NO: 27 (Y349C, T366S, L38A, Y407V, N297A, and I253A), and the second half-life extending domain comprises SEQ ID NO: 28 (S354C, T366W, N297A, and I253A).

[0319] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, and the masking moiety comprises residues 24 to 319 of human IL-12Rβ2, ie, the sequence having SEQ ID NO: 65.

[0320] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the non-cleavable linker comprises the amino acid sequence of SEQ ID NO: 14, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0321] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the non-cleavable linker comprises the amino acid sequence of SEQ ID NO: 55, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0322] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the non-cleavable linker comprises the amino acid sequence of SEQ ID NO: 56, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0323] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 41, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0324] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 43, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0325] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 44, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0326] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 51, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0327] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 53, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0328] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 46, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0329] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the non-cleavable linker comprises the amino acid sequence of SEQ ID NO: 56, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 51, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0330] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the non-cleavable linker comprises the amino acid sequence of SEQ ID NO: 14, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 53, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0331] In some embodiments, the IL-12 cytokine or functional fragment thereof comprises the amino acid sequence of SEQ ID NO: 64, the masking moiety comprises residues 24-319 of human IL-12Rβ2, i.e., a sequence having SEQ ID NO: 65, the non-cleavable linker comprises the amino acid sequence of SEQ ID NO: 55, the cleavable linker comprises the amino acid sequence of SEQ ID NO: 46, the first half-life prolonging domain comprises SEQ ID NO: 25 (Y349C, T366S, L38A, Y407V, and N297A), and the second half-life prolonging domain comprises SEQ ID NO: 26 (S354C, T366W, and N297A).

[0332] In some embodiments of the masked cytokine, the first polypeptide chain comprises: JPEG0007771076000046.jpg7170 The second polypeptide chain comprises: JPEG0007771076000047.jpg7170 "IL-12p40" is an IL-12p40 polypeptide or a functional fragment thereof, and "IL-12p35" is an IL-12p35 polypeptide or a functional fragment thereof. The first half-life extending domain (HL1), first linker (L1), masking moiety (MM), second half-life extending domain (HL2), second linker (L2), and IL-12 cytokine or fragment thereof ([IL-12p35-linker-IL-12p40]) can be as defined anywhere herein.

[0333] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:34 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:40.

[0334] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:81 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:40.

[0335] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:34 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:88.

[0336] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:81 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:88.

[0337] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:82 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:89.

[0338] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:83 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:90.

[0339] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:83 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:91.

[0340] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:82 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:92.

[0341] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:83 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:93.

[0342] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:82 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:94.

[0343] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:84 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:93.

[0344] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:84 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:94.

[0345] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:83 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:95.

[0346] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:82 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:96.

[0347] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:83 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:97.

[0348] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:82 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:98.

[0349] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:84 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:97.

[0350] In some embodiments, the masked cytokine comprises a first polypeptide chain comprising the amino acid sequence of SEQ ID NO:84 and a second polypeptide chain comprising the amino acid sequence of SEQ ID NO:98.

[0351] 2. Cleavage products Provided herein are cleavage products of the "dimeric" masked IL-12 cytokine described herein.

[0352] The masked IL-12 cytokine described herein comprises a cleavable linker. Upon proteolytic cleavage of the cleavable linker at the cleavage site, a cleavage product is formed containing the IL-12 cytokine or a functional fragment thereof. The IL-12 cytokine or a functional fragment thereof in the cleavage product is no longer masked by the masking moiety and is therefore activated. Thus, the IL-12 cytokine or a functional fragment thereof in the cleavage product is capable of binding to a target protein.

[0353] The tumor cell environment is complex and can include multiple different proteases. Thus, the exact site at which a given cleavable peptide in a masked IL-12 cytokine is cleaved within the tumor cell environment can vary between tumor types, between patients with the same tumor type, and even between cleavage products formed in the same tumor. Furthermore, even after cleavage, further modification of the initial cleavage product, for example, by removal of one or two terminal amino acids, can occur through the additional action of proteases within the tumor cell environment. Thus, a distribution of cleavage products can be expected to form within a patient's tumor cell environment following administration of a masked cytokine described herein.

[0354] Provided herein are cleavage products capable of binding to IL-12R, including IL-12 cytokines or functional fragments thereof, which can be prepared by proteolytic cleavage of a cleavable peptide in a masked IL-12 cytokine described anywhere herein.

[0355] Also provided herein are cleavage products of a masked IL-12 cytokine, wherein the cleavage products are capable of binding to IL-12R, and wherein the cleavage products comprise an IL-2 cytokine or a functional fragment thereof as defined anywhere herein. Also provided herein is a distribution of cleavage products that are obtained or obtainable from a single structure of a masked IL-12 cytokine, wherein each cleavage product within the distribution of cleavage products (i) is capable of binding to IL-12R and (ii) comprises an IL-12 cytokine or a functional fragment thereof as defined anywhere herein.

[0356] Provided herein are masked cleavage products of the IL-12 cytokine, wherein the cleavage products are capable of binding to IL-12R, and the cleavage products are JPEG0007771076000048.jpg7170PCP is a portion of a proteolytically cleavable peptide, SD is a spacer domain, and C is an IL-12 cytokine or a functional fragment thereof.

[0357] Further provided herein are masked cleavage products of the IL-12 cytokine, wherein the cleavage products are capable of binding to IL-12R, and the cleavage products are a) a first polypeptide chain comprising a first half-life prolonging domain; b) a second polypeptide chain comprising a polypeptide comprising Formula 5; and JPEG0007771076000049.jpg14170, wherein HL2 is a second half-life prolonging domain, L2 is a non-cleavable linker, and C is an IL-12 cytokine or a functional fragment thereof, and the first half-life prolonging domain is associated with the second half-life prolonging domain. Also provided herein is a distribution of cleavage products obtained or obtainable from a single structure of the masked IL-12 cytokine, wherein each cleavage product within the distribution of cleavage products (i) is capable of binding to IL-12R, and (ii) a) a first polypeptide chain comprising a first half-life prolonging domain; b) a second polypeptide chain comprising a polypeptide comprising Formula 5; and JPEG0007771076000050.jpg13170, wherein HL2 is a second half-life prolonging domain, L2 is a non-cleavable linker, and C is an IL-12 cytokine or a functional fragment thereof, and the first half-life prolonging domain is associated with the second half-life prolonging domain.

[0358] Further provided herein are masked cleavage products of the IL-12 cytokine, wherein the cleavage products are capable of binding to IL-12R, and the cleavage products are a) a first polypeptide chain, a first polypeptide chain, wherein HL1 is a first half-life extending domain, SD is a spacer domain, and PCP is a portion of a proteolytically cleavable peptide; b) a second polypeptide chain, and a second polypeptide chain, wherein HL2 is a second half-life extending domain, L2 is a linker, and C is an IL-12 cytokine or a functional fragment thereof; The first half-life prolonging domain is associated with the second half-life prolonging domain.

[0359] Within the cleavage product, the type of association between the masking moiety, half-life prolonging domain, IL-12 cytokine or functional fragment thereof, linker, spacer domain, and first half-life prolonging domain and second half-life prolonging domain can be any one of those described herein, and any combination of those described herein.

[0360] The location of the cleavable peptide determines the structure of the resulting cleavage products, including the IL-12 cytokine.

[0361] A "proteolytically cleavable peptide portion" refers to a portion of the original proteolytically cleavable peptide sequence after cleavage at the cleavage site. After cleavage, further modification of the initial cleavage product, for example, by removal of one or two terminal amino acids, may also occur due to the further action of proteases in the tumor cell environment. Thus, the cleavage products within the distribution of cleavage products that may be formed in the tumor cell environment of a patient after administration of a masked cytokine may not contain any portion of the proteolytically cleavable peptide.

[0362] In some embodiments, a "portion" refers to 1 amino acid, 2 amino acids, 3 amino acids, 4 amino acids, 5 amino acids, or 6 amino acids of the original proteolytically cleavable peptide sequence. In some embodiments, a "portion" refers to 2 amino acids of the original proteolytically cleavable peptide sequence. In some embodiments, a "portion" refers to 3 amino acids of the original proteolytically cleavable peptide sequence. In some embodiments, a "portion" refers to 4 amino acids of the original proteolytically cleavable peptide sequence.

[0363] In some embodiments, a "portion" of a proteolytically cleavable peptide is 3 to 6 amino acids in length. In some embodiments, a "portion" of a proteolytically cleavable peptide is 3 or 4 amino acids in length.

[0364] Cleavage sites for the cleavable linkers disclosed herein are disclosed below. [Table 3]

[0365] Purely by way of example, in the above table, * indicates a known or observed protease cleavage site within the cleavable peptide.

[0366] Thus, disclosed herein are cleavage products of any one of the masked cytokines disclosed herein.

[0367] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:29.

[0368] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:29.

[0369] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:66.

[0370] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:66.

[0371] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:67.

[0372] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:67.

[0373] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:68.

[0374] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:68.

[0375] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:69.

[0376] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:69.

[0377] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:70.

[0378] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:70.

[0379] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:71.

[0380] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:71.

[0381] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:72.

[0382] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:72.

[0383] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:73.

[0384] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:73.

[0385] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:74.

[0386] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:74.

[0387] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:75.

[0388] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:75.

[0389] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 76.

[0390] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:76.

[0391] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NO:77.

[0392] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:77.

[0393] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:78.

[0394] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:78.

[0395] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:79.

[0396] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:79.

[0397] In some embodiments, the cleavage products comprise an amino acid sequence having about or at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:80.

[0398] In some embodiments, the cleavage product comprises an amino acid sequence having an amino acid sequence comprising SEQ ID NO:80.

[0399] 3. Binding Assay The strength or affinity of an immunological binding interaction, such as that between a cytokine or a functional fragment thereof and a binding partner (e.g., a target protein such as a cytokine receptor) for which the cytokine or functional fragment thereof is specific, can be expressed in terms of the dissociation constant (Kd) of the interaction, with a smaller Kd representing a greater affinity. The binding of an IL-12 cytokine to an IL-12 cytokine receptor can be expressed in terms of Kd. In some embodiments, the immunological binding interaction is between a masked cytokine (in the presence or absence of a protease) and a target protein such as a cytokine receptor. The immunological binding properties of a protein can be quantified using methods well known in the art. For example, one method involves measuring the rates of cytokine receptor (e.g., IL-12R) / cytokine (e.g., IL-12) complex formation and dissociation; these rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that affect the rates in both directions equally. Both the "on-rate constant" (Kon) and the "off-rate constant" (Koff) can be determined by calculation of the concentrations and the actual rates of association and dissociation. The ratio Koff / Kon allows for the elimination of all parameters not related to affinity and is equal to the dissociation constant Kd. See Davies et al., Annual Rev Biochem. 59:439-473, (1990).

[0400] In some aspects, the masked cytokines described herein bind to a target protein with about the same or higher affinity upon cleavage by a protease compared to the parent cytokine that includes the masking moiety but does not include the cleavable peptide. The target protein can be any cytokine receptor.

[0401] In some embodiments, a masked cytokine provided herein that does not include a cleavable peptide in the linker has a dissociation constant (Kd) with a target protein of ≦1 M, ≦150 nM, 100 nM, ≦50 nM, ≦10 nM, ≦1 nM, ≦0.1 nM, ≦0.01 nM, or ≦0.001 nM (e.g., 10 M or less, e.g., 10 M to 10 M, e.g., 10 M to 10 M). In some embodiments, the masked cytokines provided herein that include a cleavable peptide in the linker have a dissociation constant (Kd) with the target protein prior to being cleavable by a protease of ≦1 M, ≦150 nM, ≦100 nM, ≦50 nM, ≦10 nM, ≦1 nM, ≦0.1 nM, ≦0.01 nM, or ≦0.001 nM (e.g., 10 M or less, e.g., 10 M to 10 M, e.g., 10 M to 10 M). In some embodiments, a masked cytokine provided herein comprising a cleavable peptide in the linker has a dissociation constant (Kd) with a target protein upon cleavage by a protease of ≦1 M, ≦150 nM, 100 nM, ≦50 nM, ≦10 nM, ≦1 nM, ≦0.1 nM, ≦0.01 nM, or ≦0.001 nM (e.g., 10 M or less, e.g., 10 M to 10 M, e.g., 10 M to 10 M). In some embodiments, the cytokine or functional fragment thereof of the masked cytokine provided herein has a dissociation constant (Kd) with the masking portion of the masked cytokine of ≥ 500M, ≥ 250M, ≥ 200M, ≥ 150M, ≥ 100M, ≥ 50M, ≥ 10M, ≥ 1M, ≥ 500nM, ≥ 250nM, ≥ 150nM, ≥ 100nM, ≥ 50nM, ≥ 10nM, ≥ 1nM, ≥ 0.1nM, ≥ 0.01nM, or ≥ 0.001nM.In some embodiments, the cytokines or functional fragments thereof of the masked cytokines provided herein have a dissociation constant (Kd) that is about 200 M to about 50 nM, such as about or at least about 175 M, about or at least about 150 M, about or at least about 125 M, about or at least about 100 M, about or at least about 75 M, about or at least about 50 M, about or at least about 25 M, about or at least about 5 M, about or at least about 1 M, about or at least about 750 nM, about or at least about 500 nM, about or at least about 250 nM, about or at least about 150 nM, about or at least about 100 nM, about or at least about 75 nM, or about or at least about 50 nM. Assays for assessing binding affinity are well known in the art.

[0402] In some embodiments, a masked cytokine exhibiting a desired occlusion ratio is provided. As used herein, the term "occlusion ratio" refers to the ratio between (a) the maximum detectable level of a parameter under a first set of conditions and (b) the minimum detectable value of that parameter under a second set of conditions. In the context of a masked IL-12 polypeptide, it refers to the ratio between (a) the maximum detectable level of a target protein (e.g., an IL-12R protein) that binds to the masked IL-12 polypeptide in the presence of at least one protease capable of cleaving the cleavable peptide of the masked IL-12 polypeptide and (b) the minimum detectable value of a target protein (e.g., an IL-12R protein) that binds to the masked IL-12 polypeptide in the absence of the protease. Thus, the occlusion ratio of a masked cytokine can be calculated by dividing the EC50 of the masked cytokine before cleavage by the EC50 of the masked cytokine after cleavage. The occlusion ratio of a masked cytokine can also be calculated as the ratio of the dissociation constant of the masked cytokine before cleavage by a protease to the dissociation constant of the masked cytokine after cleavage by a protease. In some embodiments, a greater occlusion ratio of a masked cytokine indicates that the target protein bound by the masked cytokine is cleaved to a greater extent (e.g., to a greater extent) in the presence of a protease capable of cleaving the cleavable peptide of the masked cytokine than in the absence of the protease.

[0403] In some embodiments, provided herein are masked cytokines with optimal occlusion ratios. In some embodiments, the optimal occlusion ratio of a masked cytokine indicates that the masked cytokine has desirable properties useful in the methods or compositions contemplated herein. In some embodiments, the masked cytokines provided herein exhibit an optimal occlusion ratio of about 2 to about 10,000, e.g., about 80 to about 100. In further embodiments of any of the masked cytokines provided herein, the occlusion ratio is about 2 to about 7,500, about 2 to about 5,000, about 2 to about 2,500, about 2 to about 2,000, about 2 to about 1,000, about 2 to about 900, about 2 to about 800, about 2 to about 700, about 2 to about 600, about 2 to about 500, about 2 to about 400, about 2 to about 300, about 2 to about 200, about 2 to about 100, about 2 to about 50, about 2 to about 25, about 2 to about 15, about 2 to about 10, about 5 to about 10, about 5 to about 15, about 5 to about 20, about 10 to about 100, about 20 to about 100, about 30 to about 100, about 40 to about 100, about 50 to about 100, about 60 to about 100, about 70 to about 100, about 80 to about 100, or about 100 to about 1,000. In some embodiments, the masked cytokines provided herein exhibit an optimal occlusion ratio of about 2 to about 1,000. Binding of the masked IL-12 polypeptide to the target protein before and / or after cleavage by a protease can be determined using techniques well known in the art, such as by ELISA.

[0404] In some embodiments, the masking moieties described herein bind to a cytokine or functional fragment thereof described herein with an affinity that is lower than the affinity between the cytokine or functional fragment thereof and a target protein (e.g., a cytokine receptor). In certain embodiments, the masking moieties provided herein bind to a cytokine or functional fragment thereof with an affinity that is lower than the affinity between the cytokine or functional fragment thereof and a target protein (e.g., a cytokine receptor). It binds to a cytokine or functional fragment thereof described herein with a dissociation constant (Kd) of ≧500M, ≧250M, ≧200M, ≧150M, ≧100M, ≧50M, ≧10M, ≧1M, ≧500nM, ≧250nM, ≧150nM, ≧100nM, ≧50nM, ≧10nM, ≧1nM, ≧0.1nM, ≧0.01nM, or ≧0.001nM.

[0405] 4. Masked IL-12 Cytokine Production The masked cytokines described herein are prepared using techniques available in the art, exemplary methods of which are described.

[0406] 4.1 Antibody production Some embodiments of the masked IL-12 cytokine include antibodies or fragments thereof. The following sections provide further details on the production of antibodies, as well as antibody fragments, variants, and derivatives thereof, that may be used in some embodiments of the masked IL-12 cytokines provided herein. In some embodiments, the masked cytokine is in the form of a dimer produced by two copies of the masked IL-12 cytokine associated through a disulfide bond.

[0407] 1. Antibody fragment The present invention, in some embodiments, encompasses antibody fragments. An antibody fragment can be any antibody fragment, such as an Fc domain, a portion of a heavy chain, a portion of a light chain, a Fab, an Fv, or an scFv, among other fragments. Antibody fragments can be produced by conventional means, such as enzymatic digestion, or by recombinant techniques. In certain circumstances, there are advantages to linking an antibody fragment to a masked antibody fragment described herein rather than to a whole antibody. For a review of certain antibody fragments, see Hudson et al. (2003) Nat. Med. 9:129-134.

[0408] Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992) and Brennan et al., Science, 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. Fab, Fv, and ScFv antibody fragments can all be expressed in and secreted from E. coli and other cell types, such as HEK293 and CHO cells, thus allowing the facile production of large amounts of these fragments. Alternatively, Fab-SH fragments can be directly recovered from the culture medium and chemically coupled to form F(ab)2 fragments (Carter et al., Bio / Technology 10:163-167 (1992)). According to another approach, F(ab)2 fragments can be isolated directly from recombinant host cell culture. Fab and F(ab)2 fragments with increased in vivo half-lives containing FcRN / salvage receptor binding epitope residues are described in U.S. Patent No. 5,869,046. Other techniques for producing antibody fragments for use with masked cytokines will be apparent to those skilled in the art. In certain embodiments, the masked antibody comprises a single-chain Fv fragment (scFv). See WO 93 / 16185, U.S. Patent Nos. 5,571,894, and 5,587,458. scFv fusion proteins can be constructed to provide fusion of an effector protein at either the amino or carboxy terminus of the scFv. See Antibody Engineering, ed. Borrebaeck, supra. Also, in some embodiments, bi-scFvs, comprising two scFvs linked via a polypeptide linker, can be used with masked cytokines.

[0409] The present invention, in some embodiments, includes linear antibodies (e.g., as described in U.S. Pat. No. 5,641,870) or single-chain immunoglobulins comprising antibody heavy and light chain sequences linked via a suitable linker. Such linear antibodies or immunoglobulins can be monospecific or bispecific. Such single-chain immunoglobulins can dimerize, thereby maintaining a structure and activity similar to that of originally tetrameric antibodies. Also, in some embodiments, antibodies or fragments thereof can be antibodies having a single heavy chain variable region and no light chain sequence. Such antibodies are referred to as single-domain antibodies (sdAbs) or nanobodies. These antibodies are also encompassed within the meaning of functional fragments of antibodies according to the present invention. Antibody fragments can be linked to the masked cytokines described herein, following the guidance provided herein.

[0410] 2. Humanized antibodies The present invention, in some embodiments, encompasses humanized antibodies or antibody fragments thereof. In some embodiments, a humanized antibody can be any antibody, including any antibody fragment. Various methods for humanizing non-human antibodies are known in the art. For example, a humanized antibody can have one or more amino acid residues introduced from a non-human source. These non-human amino acid residues are often referred to as "import" residues, typically taken from an "import" variable domain. Humanization can be performed essentially according to the method of Winter (Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536) by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) in which substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies. Humanized antibodies can be linked to the masked cytokines described herein, following the guidance provided herein.

[0411] 3. Human antibodies Human antibodies of some embodiments of the invention can be constructed by combining Fv clone variable domain sequences selected from a human-derived phage display library with known human constant domain sequences. Alternatively, human monoclonal antibodies of some embodiments of the invention can be produced by the hybridoma method, for example, by using mouse, rat, bovine (e.g., dairy cow), or rabbit cells to produce human monoclonal antibodies. In some embodiments, human antibodies and human monoclonal antibodies can be antibodies that bind to any antigen. In some embodiments, human monoclonal antibodies of the invention can be produced by immunizing a non-human animal containing human immunoglobulin loci with a target antigen and isolating antibodies from the immunized animal or cells derived from the immunized animal. Examples of suitable non-human animals include transgenic or transchromosomic animals such as HuMAb Mouse® (Medarex, Inc.), KM Mouse®, "TC Mouse," and Xenomouse™. See, for example, Lonberg, et al. (1994) Nature 368:856-859, Fishwild, D. et al. (1996) Nature Biotechnology 14:845-851, WO2002 / 43478, U.S. Patent Nos. 5,939,598, 6,075,181, 6,114,598, 6,150,584, 6,162,963, and Tomizuka et al. (2000) Proc. Natl. Acad. Sci. USA 97:722-727.

[0412] Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described, for example, by Kozbor J. Immunol., 133:3001 (1984), Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987), and Boerner et al., J. Immunol., 147:86 (1991). Human antibodies can be linked to the masked cytokines described herein following the guidance provided herein.

[0413] 4. Bispecific antibodies Bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens. In certain embodiments, bispecific antibodies are human or humanized. In some embodiments, one of the binding specificities is for a first antigen and the other is for a second antigen, which can be two different epitopes on the same target protein or two different epitopes on two different target proteins. Bispecific antibodies can also be used to localize cytotoxic agents to cells expressing the first and / or second antigen. Bispecific antibodies can also be used to recruit cells, such as T cells or natural killer cells, to kill specific cells, e.g., cancer cells. Bispecific antibodies can be prepared as full-length antibodies or antibody fragments (e.g., F(ab')2 bispecific antibodies). Bispecific antibodies can be linked to the masked cytokines described herein following the guidance provided herein.

[0414] Methods for producing bispecific antibodies are known in the art. See Milstein and Cuello, Nature, 305:537 (1983); WO 93 / 08829 published May 13, 1993; Traunecker et al., EMBO J., 10:3655 (1991); Kontermann and Brinkmann, Drug Discovery Today, 20(7):838-847. For further details on producing bispecific antibodies, see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986). Bispecific antibodies include cross-linked or "heteroconjugate" antibodies. For example, one of the antibodies in the heteroconjugate can be coupled to avidin, while the other can be coupled to biotin. Heteroconjugate antibodies can be produced using any convenient cross-linking method. Suitable cross-linking agents are well known in the art and are disclosed in US Pat. No. 4,676,980, along with several cross-linking techniques.

[0415] 5. Single Domain Antibodies In some embodiments, a single domain antibody is linked to a masked cytokine according to the guidance provided herein. A single domain antibody can be any antibody. A single domain antibody is a single polypeptide chain comprising all or a portion of an antibody heavy chain variable domain or all or a portion of an antibody light chain variable domain. In certain embodiments, a single domain antibody is a human single domain antibody (Domantis, Inc., Waltham, Mass.; see, e.g., U.S. Patent No. 6,248,516 B1). In some embodiments, a single domain antibody consists of all or a portion of an antibody heavy chain variable domain. In some embodiments, a single domain antibody is a camelid-derived antibody obtained by immunizing a camelid with a target antigen. In some embodiments, a single domain antibody is a shark-derived antibody obtained by immunizing a shark with a target antigen. In some embodiments, a single domain antibody is a nanobody (see, e.g., WO2004041865A2 and US20070269422A1).

[0416] 6. Antibody Variants In some embodiments, amino acid sequence modifications of the antibodies or fragments thereof described herein are contemplated. For example, it may be desirable to improve the FcRn binding affinity and / or pH-dependent FcRn binding affinity of the antibody. It may also be desirable to promote heterodimerization of antibody heavy chains by introducing specific amino acid modifications. Methods for promoting heterodimerization of antibody chains, including specific modifications that can be made to promote heterodimerization, are described in Klein et al. (2012), MAbs, 4(6):653-663. Amino acid sequence variants of antibodies can be prepared by introducing appropriate changes into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and / or insertions into, and / or substitutions of residues within the amino acid sequence of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics. Amino acid alterations can be introduced into the subject antibody amino acid sequence at the time the sequence is generated.

[0417] A useful method for identifying specific residues or regions of an antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis," as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or group of target residues is identified (e.g., charged residues such as arg, asp, his, lys, and glu) and substituted with neutral or negatively charged amino acids (e.g., alanine or polyalanine) to affect the interaction of the amino acid with the antigen. Those amino acid locations demonstrating functional sensitivity to the substitution are then refined by introducing further or other variants at, or for, the substitution sites. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region, and the expressed immunoglobulins are screened for the desired activity.

[0418] Amino acid sequence insertions include amino- and / or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing 100 or more residues, as well as intrasequence insertions of single or multiple amino acid residues. An example of a terminal insertion is an antibody with an N-terminal methionyl residue. Other insertional variants of antibody molecules include the fusion to the N- or C-terminus of the antibody to an enzyme or a polypeptide which extends the serum half-life of the antibody.

[0419] In some embodiments, the masked cytokine is modified to eliminate, reduce, or otherwise prevent protease cleavage near the hinge region. The "hinge region" of IgG is generally defined as including E216 and ending at P230 for human IgG1 according to the EU index, such as Kabat's, although functionally, the flexible portion of the chain can be considered to include additional residues referred to as the upper and lower hinge regions, such as E216-G237 (Roux et al., 1998 J Immunol 161:4083), with the lower hinge being referred to as residues 233-239 of the Fc region, commonly responsible for FcyR binding. Modifications to any of the masked cytokines described herein can be made, for example, according to the methods described in US 20150139984A1, incorporated herein by reference, and by incorporating any of the modifications described herein.

[0420] In some embodiments, FcRn mutations that improve pharmacokinetics include, but are not limited to, M428L, T250Q / M428L, M252Y / S254T / T256E, P257I / N434H, D376V / N434H, P257I / Q3111, N434A, N434W, M428L / N434S, V259I / V308F, M252Y / S254T / T256E, V259I / V308F / M428L, T307Q / N434A, T307Q / N434S, T307Q / E380A / N434A, V308P / N434A, N434H, V308P. In some embodiments, such mutations enhance antibody binding to FcRn at low pH but do not alter antibody affinity at neutral pH.

[0421] In certain embodiments, an antibody or fragment thereof is modified to increase or decrease the extent to which the antibody is glycosylated. Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars, i.e., N-acetylgalactosamine, galactose, or xylose, to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine can also be used.

[0422] Addition or deletion of glycosylation sites to the masked cytokine is conveniently accomplished by altering the amino acid sequence to create or remove one or more of the tripeptide sequences described above (for N-linked glycosylation sites). Alterations may also be made by adding, deleting, or substituting one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).

[0423] If the antibody or fragment thereof comprises an Fc region, the carbohydrate attached thereto can be modified. For example, antibodies having a mature carbohydrate structure lacking fucose attached to the Fc region of the antibody are described in U.S. Patent Application No. US2003 / 0157108 (Presta, L.). See also U.S. Patent Application No. US2004 / 0093621 (Kyowa Hakko Kogyo Co., Ltd.). Antibodies having a bisecting N-acetylglucosamine (GlcNAc) in the carbohydrate attached to the Fc region of the antibody are referenced in WO 2003 / 011878, Jean-Mairet et al., and U.S. Patent No. 6,602,684, Umana et al. Antibodies having at least one galactose residue in the oligosaccharide attached to the Fc region of the antibody are reported in WO 1997 / 30087, Patel et al. See also WO 1998 / 58964 (Raju, S.) and WO 1999 / 22764 (Raju, S.) concerning antibodies with modified carbohydrate attached to the Fc region thereof. See also US 2005 / 0123546 (Umana et al.) concerning antigen-binding molecules with modified glycosylation.

[0424] In certain embodiments, the glycosylation variant comprises an Fc region, and the carbohydrate structure attached to the Fc region lacks or has reduced fucose. Such variants have improved ADCC function. Optionally, the Fc region further comprises one or more amino acid substitutions therein that further improve ADCC, e.g., substitutions at positions 298, 333, and / or 334 (EU numbering of residues) of the Fc region. Examples of publications related to "defucosylated" or "fucose-deficient" antibodies include US2003 / 0157108, WO2000 / 61739, WO2001 / 29246, US2003 / 0115614, US2002 / 0164328, US2004 / 0093621, US2004 / 0132140, US2004 / 0110704, US2004 / 0110282, US2004 / 0109865, WO2003 / 085119, WO2003 / 084570, WO2005 / 035586, WO2005 / 035778, WO2005 / 053742, Okazaki et al. et al. J. Mol. Biol. 336: 1239-1249 (2004), and Yamane-Ohnuki et al. Biotech. Bioeng. 87. 614 (2004). Examples of cell lines that produce defucosylated antibodies include Lee 13 CHO cells, which are deficient in protein fucosylation (Ripka et al., Arch. Biochem. Biophys. 249:533-545 (1986); U.S. Patent Application No. US2003 / 0157108A1, Presta, L., and WO2004 / 056312A1, Adams et al., especially Example 11), and knockout cell lines such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (Yamane-Ohnuki et al., Biotech. Bioeng. 87:614 (2004)), as well as cells overexpressing 31,4-N-acetylglucosaminyltransferase III (GnT-III) and Golgi p-mannosidase II (ManII).

[0425] In any of the embodiments herein, the masked cytokine may be engineered to improve antibody-dependent cell-mediated cytotoxicity (ADCC) activity. In some embodiments, the masked cytokine may be produced in a cell line with an alpha 1,6-fucosyltransferase (Fut8) knockout. In some embodiments, the host cell is modified to have reduced endogenous alpha 1,6-fucosylation activity. Examples of methods for modifying the fucosylation pathway in mammalian host cells can be found, for example, in Yamane-Ohnuki and Satoh, MAbs, 1(3):230-236 (2009), the contents of which are incorporated herein by reference. Examples of methods and compositions for partially or completely inactivating expression of the FUT8 gene are described, for example, in U.S. Publication No. 20160194665A1 and WO2006133148A2, the contents of which are incorporated herein by reference. In some embodiments, the masked cytokine is produced in a Lecl3 variant of CHO cells (see, e.g., Shields et al., J. Biol. Chem., 277(30):26733-40(2002)), or in the YB2 / 0 cell line with reduced FUT8 activity (see, e.g., Shinkawa et al., J. Biol. Chem., 278(5):3466-73(2003)). In some embodiments, small interfering RNA (siRNA) against genes associated with alpha 1,6-fucosylation can be introduced (see, e.g., Mori et al., Biotechnol. Bioeng. 88(7):901-908 (2004); Imai-Nishiya et al., BMC Biotechnol. 7:84 (2007); Omasa et al., J. Biosci. Bioeng., 106(2):168-173 (2008)). In some further embodiments, masked cytokines can be produced in cell lines overexpressing 31,4-N-acetylglucosaminyltransferase III (GnT-III). In further embodiments, the cell lines additionally overexpress Golgi p-mannosidase II (ManII).In some of the embodiments herein, the masked cytokine may contain at least one amino acid substitution in the Fc region that improves ADCC activity.

[0426] In some embodiments, the masked cytokine is modified to improve its serum half-life. To increase the serum half-life of an antibody, an FcRN / salvage receptor binding epitope can be incorporated into the linked antibody (particularly an antibody fragment), as described, for example, in U.S. Pat. No. 5,739,277. As used herein, the term "salvage receptor binding epitope" refers to an epitope in the Fc region of an IgG molecule (e.g., IgG1, IgG2, IgG3, or IgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule (see US 2003 / 0190311, U.S. Pat. No. 6,821,505, U.S. Pat. No. 6,165,745, U.S. Pat. No. 5,624,821, U.S. Pat. No. 5,648,260, U.S. Pat. No. 6,165,745, U.S. Pat. No. 5,834,597).

[0427] Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced with a different residue. Targeted sites for substitution mutagenesis include hypervariable regions, although modifications of FRs are also contemplated. Conservative substitutions are shown in Table 3 under the heading of "preferred substitutions." If such substitutions result in a desired change in biological activity, larger substitution changes, such as those indicated as "exemplary substitutions" in Table 3 or further described below for classes of amino acids, can be introduced and the products screened. [Table 4]

[0428] Substitutional modifications in the biological properties of antibodies are achieved by selecting substitutions that have significantly different effects on (a) the conformation of the polypeptide backbone in the region of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) maintaining the bulk of the side chain. Amino acids can be grouped according to the similarity of their side chain properties (A.L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) Non-polar: Ala(A), Val(V), Leu(L), Ile(I), Pro(P), Phe(F), Trp(W), Met(M) (2) Uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gin (Q) (3) Acidic: Asp(D), Glu(E) (4) Basic: Lys(K), Arg(R), His(H)

[0429] Alternatively, naturally occurring residues can be divided into groups based on the following general side chain properties: (1) Hydrophobic: Norleucine, Met, Ala, Val, Leu, He, (2) Neutral hydrophilicity: Cys, Ser, Thr, Asn, Gin, (3) Acidic: Asp, Glu, (4) Basic: His, Lys, Arg, (5) Residues that influence chain directionality: Gly, Pro, (6) Aromatic: Trp, Tyr, Phe.

[0430] Non-conservative substitutions involve exchanging a member of one of these classes for another. Such substituted residues also may be introduced into the conservative substitution sites or into the remaining (non-conserved) sites.

[0431] Another type of substitution variant involves substituting a naturally occurring amino acid residue with a non-naturally occurring amino acid residue, which can be incorporated, for example, through tRNA recoding or through any of the methods described in WO2016154675A1, which is incorporated herein by reference.

[0432] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variants selected for further development have modified (e.g., improved) biological properties relative to the parent antibody from which they are generated. A convenient method for generating such substitutional variants involves affinity maturation using phage display, yeast display, or mammalian display. Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site. The antibodies thus generated are displayed from filamentous phage particles as fusions to at least a portion of a phage coat protein (e.g., the gene III product of M13) packaged within each particle. Phage-displayed variants are then screened for biological activity (e.g., binding affinity). To identify candidate hypervariable region sites for modification, scanning mutagenesis (e.g., alanine scanning) can be performed to identify hypervariable region residues that contribute significantly to antigen binding. Alternatively, or in addition, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and adjacent residues are candidates for substitution by techniques known in the art, including those detailed herein. Once such variants are generated, the panel of variants can be screened using techniques known in the art, including those described herein, and antibodies with superior properties in one or more relevant assays can be selected for further development.

[0433] Nucleic acid molecules encoding amino acid sequence variants of masked cytokines are prepared by a variety of methods known in the art, including, but not limited to, isolation from natural sources (in the case of naturally occurring amino acid sequence variants) or preparation by, for example, oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of previously prepared variant or non-variant versions of the antibody.

[0434] It may be desirable to introduce one or more amino acid modifications into the Fc region of an antibody of the invention, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3, or IgG4 Fc region) containing an amino acid modification (e.g., substitution) at one or more amino acid positions, including the hinge cysteine ​​amino acid positions.

[0435] In some embodiments, the masked cytokines provided herein comprise antibodies or fragments thereof having an IgG1, IgG2, IgG3, or IgG4 isotype with enhanced effector function. In some embodiments, the masked cytokines provided herein comprise antibodies or fragments thereof having an IgG1 isotype with enhanced effector function. In some embodiments, the masked cytokines provided herein have an IgG1 isotype with enhanced effector function. In some embodiments, the masked cytokine is defucosylated. In some embodiments, the masked cytokine has increased levels of mannose moieties. In some embodiments, the masked cytokine has increased levels of bisecting glycan moieties. In some embodiments, the IgG1 comprises an amino acid mutation.

[0436] In some embodiments, the masked cytokine provided herein comprises an antibody having an IgG1 isotype (e.g., a human IgG1 isotype). In some embodiments, the IgG1 comprises one or more amino acid substitutions that enhance effector function. In one embodiment, the IgG1 comprises amino acid substitutions S298A, E333A, and K334A, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises amino acid substitutions S239D and I332E, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises amino acid substitutions S239D, A330L, and I332E, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises amino acid substitutions P247I and A339D or A339Q, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions D280H, K290S with or without S298D, or S298V, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions F243L, R292P, and Y300L, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions F243L, R292P, Y300L, and P396L, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions F243L, R292P, Y300L, V305I, and P396L, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions G236A, S239D, and I332E, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions K326A and E333A, where amino acid residues are numbered according to the EU index as in Kabat.In one embodiment, IgG1 comprises the amino acid substitutions K326W and E333S, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions K290E, S298G, T299A, with or without K326E, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions K290N, S298G, T299A, with or without K326E, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitution K334V, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions L235S, S239D, and K334V, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions K334V and Q331M, S239D, F243V, E294L, or S298T, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions E233L, Q311M, and K334V, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions L234I, Q311M, and K334V, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions K334V and S298T, A330M, or A330F, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions K334V, Q311M, and either A330M or A330F, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions K334V, S298T, and either A330M or A330F, where amino acid residues are numbered according to the EU index as in Kabat.In one embodiment, IgG1 comprises amino acid substitutions K334V, S239D, and either A330M or S298T, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions L234Y, Y296W, and K290Y, F243V, or E294L, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions Y296W and either L234Y or K290Y, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises amino acid substitutions S239D, A330S, and I332E, where amino acid residues are numbered according to the EU index as in Kabat.

[0437] In some embodiments, IgG1 comprises one or more amino acid substitutions that reduce or inhibit effector function. In one embodiment, IgG1 comprises the amino acid substitution N297A, N297G, or N297Q, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitution L234A or L235A, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions C220S, C226S, C229S, and P238S, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, IgG1 comprises the amino acid substitutions C226S, C229S, E233P, L234V, and L235A, where amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions L234F, L235E, and P331S, where the amino acid residues are numbered according to the EU index as in Kabat. In one embodiment, the IgG1 comprises the amino acid substitutions S267E and L328F, where the amino acid residues are numbered according to the EU index as in Kabat.

[0438] In accordance with this description and teachings in the art, it is contemplated that in some embodiments, a masked cytokine antibody or fragment thereof may contain one or more modifications, e.g., within the Fc region, compared to a wild-type corresponding antibody. For example, it is contemplated that specific modifications may be made to the Fc region that will result in altered (i.e., either improved or decreased) C1q binding and / or complement-dependent cytotoxicity (CDC), as described, for example, in WO 99 / 51642. See also Duncan & Winter Nature 322:738-40 (1988), U.S. Patent No. 5,648,260, U.S. Patent No. 5,624,821, and WO 94 / 29351 for other examples of Fc region variants. WO 00 / 42072 (Presta) and WO 2004 / 056312 (Lowman) describe antibody variants with improved or decreased binding to FcRs. The contents of these patent publications are specifically incorporated herein by reference. See also Shields et al. J. Biol. Chem. 9(2):6591-6604 (2001). Antibodies with increased half-life and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgG to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005 / 0014934A1 (Hinton et al.). These antibodies comprise an Fc region with one or more substitutions therein that improve binding of the Fc region to FcRn. Polypeptide variants with altered Fc region amino acid sequences and increased or decreased C1q binding ability are described in U.S. Patent No. 6,194,551 B1 and WO 99 / 51642, the contents of which are specifically incorporated herein by reference. See also Idusogie et al. J Immunol. 164:4178-4184 (2000).

[0439] 4.2 Masked IL-12 cytokine-drug conjugates The present invention also provides masked IL-12 cytokine-drug conjugates (MCDCs) comprising the masked IL-12 cytokines provided herein, which can be any of the IL-12 masked cytokines disclosed herein conjugated to one or more agents. In some embodiments, the one or more agents comprise a chemotherapeutic agent or drug, a growth inhibitory agent, a toxin (e.g., a protein toxin, an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or a fragment thereof), or a radioisotope. In some embodiments, the one or more agents are immunostimulatory agents.

[0440] In some embodiments, the one or more drugs conjugated to the masked IL-12 cytokine include maytansinoids (see U.S. Pat. Nos. 5,208,020, 5,416,064, and European Patent EP 0425235 B1), auristatins such as monomethyl auristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483, 5,780,588, and 7,498,298), dolastatins, calicheamicin or derivatives thereof (see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296; Hinman et al., Cancer Res. 53:3336-3342 (1993), and Lode et al., Cancer Res. 58:2925-2928 (1998)), anthracyclines such as daunomycin or doxorubicin (Kratz et al., Current Med. Chem. 13:477-523 (2006); Jeffrey et al., Bioorganic & Med. Chem. Letters 16:358-362 (2006); Torgov et al., Bioconj. Chem. 16:717-721 (2005); Nagy et al., Proc. Natl. Acad. Sci. USA 97:829-834 (2000); Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002), King et al., J. Med. Chem. 45:4336-4343 (2002), and U.S. Patent No. 6,630,579), methotrexate, vindesine, taxanes such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel, trichothecenes, and CC1065.

[0441] In another embodiment, the one or more drugs conjugated to the masked IL-12 cytokine include, but are not limited to, inhibitors of tubulin polymerization (e.g., maytansinoids and auristatins), DNA damaging agents (e.g., pyrrolobenzodiazepine (PBD) dimers, calicheamicins, duocarmycins, and indolinobenzodiazepine dimers), and DNA synthesis inhibitors (e.g., exatecan derivatives Dxd).

[0442] In another embodiment, the masked IL-12 cytokine-drug conjugate comprises a masked IL-12 cytokine described herein conjugated to an enzymatically active toxin or fragment thereof, including, but not limited to, diphtheria A chain, a non-binding active fragment of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii protein, dianthin protein, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogenin, restrictocin, phenomycin, enomycin, and a trichothecene.

[0443] In another embodiment, the masked IL-12 cytokine-drug conjugate comprises a masked IL-12 cytokine described herein conjugated to a radioactive atom to form a radioconjugate. A variety of radioisotopes are available for producing radioconjugates. Examples include At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, B1212, P32, Pb212, and radioactive isotopes of Lu. When a radioconjugate is used for detection, it may contain a radioactive atom for scintigraphic studies, such as TC99m or 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as iodine-123, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese, or iron.

[0444] In some embodiments, the masked IL-12 cytokine-drug conjugate comprises a masked IL-12 cytokine described herein conjugated to one or more immunostimulatory agents, which in some embodiments are stimulators of interferon genes (STING) agonists or toll-like receptor (TER) agonists.

[0445] The STING agonist can be any agonist of STING. In some embodiments, the STING agonist is a cyclic dinucleotide (CDN). The CDN can be any CDN or a derivative or variant thereof. In some embodiments, the STING agonist is a CDN selected from the group consisting of cGAMP, c-di-AMP, c-di-GMP, cAIMP, and c-di-IMP. In some embodiments, the STING agonist is a derivative or variant of a CDN selected from the group consisting of cGAMP, c-di-AMP, c-di-GMP, cAIMP, and c-di-IMP. In some embodiments, the STING agonist is 4-(2-chloro-6-fluorobenzyl)-N-(furan-2-ylmethyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]thiazine-6-carboxamide, or a derivative or variant thereof. See, for example, Sali et al. (2015) PloS Pathog., 11(12):e!005324.

[0446] The TLR agonist can be an agonist of any TLR, such as TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, or TLR10. In some embodiments, the TLR agonist is an agonist of a TLR expressed on the cell surface, such as TLR1, TLR2, TLR4, or TLR5. In some embodiments, the TLR agonist is an agonist of a TLR expressed intracellularly, such as TLR3, TLR7, TLR8, TLR9, or TLR10.

[0447] Conjugates of masked IL-12 cytokine and cytotoxic agents can be made using a variety of bifunctional protein coupling agents, such as N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis(p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, ricin immunotoxins can be prepared as described in Vitetta et al., Science 238:1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylenetriaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugating radionucleotides to antibodies. See WO94 / 11026. The linker can be a "cleavable linker" that facilitates release of the cytotoxic drug in cells. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker, or disulfide-containing linker (Chari et al., Cancer Res. 52:127-131 (1992); U.S. Pat. No. 5,208,020) can be used.

[0448] As used herein, MCDC refers to BMPS, EMCS, GMBS, HBVS, LC-SMCC, Expressly contemplated are such conjugates prepared using cross-linking reagents including, but not limited to, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfonebenzoate) commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., USA)).

[0449] 4.3 Vectors, host cells, and recombinant methods For recombinant production of the IL-12 masked cytokine of the present invention, one or more nucleic acids encoding same may be prepared for further cloning (DNA amplification), or isolated and inserted into a replicable vector for expression. DNA encoding the masked IL-12 cytokine, including its components, is readily isolated and sequenced using conventional procedures. Many vectors are available. The choice of vector will depend in part on the host cell to be used. Generally, the host cell will be of either prokaryotic or eukaryotic (generally mammalian) origin. It will be understood that, where applicable, the constant region of any isotype of antibody or fragment thereof can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species. In some embodiments, one vector is used to encode the IL-12 masked cytokine. In some embodiments, more than one vector is used to encode the masked IL-12 cytokine.

[0450] 1. Production of Masked IL-12 Cytokine Using Prokaryotic Host Cells a. Vector construction Polynucleotide sequences encoding polypeptide components of the masked cytokines of the present invention can be obtained using standard recombinant techniques. The desired polynucleotide sequence of an antibody or antibody fragment thereof can be isolated and sequenced from antibody-producing cells, such as hybridoma cells. Alternatively, polynucleotides can be synthesized using a nucleotide synthesizer or PCR technology, or obtained from other sources. Once obtained, the sequences encoding the masked cytokine components are inserted into a recombinant vector capable of replicating and expressing heterologous polynucleotides in a prokaryotic host. Many vectors available and known in the art can be used for the purposes of the present invention. Selection of an appropriate vector will depend primarily on the size of the nucleic acid to be inserted into the vector and the specific host cell to be transformed with the vector. Each vector contains various components depending on its function (amplification or expression of the heterologous polynucleotide, or both) and its compatibility with the specific host cell in which it will reside. Vector components generally include, but are not limited to, an origin of replication, a selectable marker gene, a promoter, a ribosome binding site (RBS), a signal sequence, the heterologous nucleic acid insert, and a transcription terminator sequence.

[0451] Plasmid vectors containing replicon and control sequences derived from species compatible with the host cell are generally used in connection with these hosts. The vector usually carries a replication site as well as marking sequences capable of providing phenotypic selection in transformed cells. For example, E. coli is typically transformed using pBR322, a plasmid derived from an E. coli species. pBR322 contains genes encoding ampicillin (Amp) and tetracycline (Tet) resistance, thus providing an easy means for identifying transformed cells. pBR322, its derivatives, or other microbial plasmids or bacteriophages may also contain, or be modified to contain, promoters that can be used by the microorganism for expression of endogenous proteins. Examples of pBR322 derivatives used to express specific antibodies are described in Carter et al., U.S. Pat. No. 5,648,237.

[0452] Additionally, phage vectors containing replicon and control sequences compatible with host microorganisms can be used as transforming vectors in connection with these hosts. For example, bacteriophages such as 7GEM.TM.-11 can be utilized to generate recombinant vectors that can be used to transform susceptible host cells such as E. coli LE392.

[0453] The expression vector of the present invention may contain two or more promoter-cistron pairs, one encoding each of the polypeptide components. A promoter is a non-translated regulatory sequence located upstream (5') of a cistron that controls its expression. Prokaryotic promoters are typically divided into two classes: inducible and constitutive. An inducible promoter is a promoter that initiates increased levels of transcription of the cistron under its control in response to a change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.

[0454] Numerous promoters recognized by a variety of potential host cells are well known. The promoter of choice can be operably linked to the cistron DNA encoding either chain of the masked cytokine by removing the promoter from the source DNA via restriction enzyme digestion and inserting the isolated promoter sequence into the vector of the invention. Both the native promoter sequence and many heterologous promoters can be used to direct amplification and / or expression of the target gene.

[0455] In some embodiments, heterologous promoters are utilized because they generally allow for greater transcription and higher yields of the expressed target gene compared to the native target polypeptide promoter.

[0456] Suitable promoters for use with prokaryotic hosts include the PhoA promoter, the [3-galactamase and lactose promoter systems, the tryptophan (trp) promoter system, and hybrid promoters such as the tac or trc promoter. However, other promoters that function in bacteria (such as other known bacterial or phage promoters) are similarly suitable. Their nucleotide sequences have been published, allowing one of skill in the art to operably ligate them into cistrons encoding target light and heavy chains, for example, for masked cytokines containing light and heavy chains, using linkers or adapters to provide any necessary restriction sites (Siebenlist et al. (1980) Cell 20:269).

[0457] In one aspect of the present invention, each cistron in a recombinant vector contains a secretory signal sequence component that directs translocation of the expressed polypeptide across a membrane. Generally, the signal sequence may be a component of the vector or may be part of the target polypeptide DNA inserted into the vector. The signal sequence selected for purposes of the present invention should be one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell. For prokaryotic host cells that do not recognize and process the native signal sequence for a heterologous polypeptide, the signal sequence is substituted with a prokaryotic signal sequence selected from the group consisting of, for example, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II (STII) leaders, LamB, PhoE, PelB, OmpA, and MBP. In one embodiment of the present invention, the signal sequences used in both cistrons of the expression system are STII signal sequences or variants thereof.

[0458] In another aspect, production of polypeptide components according to the present invention can occur in the cytoplasm of the host cell, thereby not requiring the presence of a secretory signal sequence in each cistron. In this regard, for embodiments including immunoglobulin light and heavy chains, for example, the light and heavy chains can be expressed with or without masking moieties, linker sequences, and then, for example, folded and assembled to form functional immunoglobulins in the cytoplasm. Certain host strains (e.g., E. coli trxB strains) provide cytoplasmic conditions favorable for disulfide bond formation, thereby allowing proper folding and assembly of the expressed protein subunits. See Proba and Pluckthun Gene, 159:203 (1995).

[0459] The masked cytokines of the invention can also be produced by using an expression system in which the quantitative ratio of the expressed polypeptide components can be adjusted to maximize the yield of secreted and properly assembled antibodies of the invention, such adjustment being achieved at least in part by simultaneously adjusting the translational strength of the polypeptide components.

[0460] Suitable prokaryotic host cells for expressing the masked cytokines of the present invention include, for example, archaebacteria and eubacteria, such as gram-negative or gram-positive organisms. Examples of useful bacteria include Escherichia (e.g., E. coli), Bacilli (e.g., B. subtilis), Enterobacteria, Pseudomonas species (e.g., P. aeruginosa), Salmonella typhimurium, Serratia marcescans, Klebsiella, Proteus, Shigella, Rhizobia, Vitreoscilla, or Paracoccus. In one embodiment, gram-negative cells are used. In one embodiment, E. coli cells are used as hosts in the present invention. Examples of E. coli strains include the W3110 strain (Bachmann, Cellular and Molecular Biology, vol. 2 (Washington, DC: American Society for Microbiology, 1987), pp. 1190-1219; ATCC Deposit No. 27,325) and its derivatives, including the 33D3 strain having the genotype W3110 AfhuA (AtonA) ptr3 lac Iq lacL8 AompTA (nmpc-fepE) degP41 kanR (U.S. Patent No. 5,639,635). Other strains and their derivatives, such as E. coli 294 (ATCC 31,446), E. coli B, E. coli 1776 (ATCC 31,537), and E. coli RV308 (ATCC 31,608), are also suitable. These examples are illustrative and not limiting. Methods for constructing derivatives of any of the above-mentioned bacteria with defined genotypes are known in the art and are described, for example, in Bass et al., Proteins, 8:309-314 (1990). It is generally necessary to select an appropriate bacterium taking into account the replicability of the replicon within the bacterial cell.For example, E. coli, Serratia, or Salmonella species can be suitably used as hosts when well-known plasmids such as pBR322, pBR325, pACYC177, or pKN410 are used to supply the replicon. Typically, the host cell should secrete minimal amounts of proteolytic enzymes, and additional protease inhibitors can desirably be incorporated into the cell culture.

[0461] B. Masked cytokine production Host cells are transformed with the expression vectors described above and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.

[0462] Transformation refers to the introduction of DNA into a prokaryotic host so that the DNA is replicable either as an extrachromosomal element or by chromosomal integration. Depending on the host cell used, transformation is carried out using standard techniques appropriate for such cells. Calcium treatment using calcium chloride is commonly used for bacterial cells that contain substantial cell wall barriers. Another method for transformation uses polyethylene glycol / DMSO. Yet another technique that can be used is electroporation.

[0463] The prokaryotic cells used to produce the masked cytokines of the present invention are grown in media known in the art and suitable for culturing the selected host cells. An example of a suitable medium is Luria Broth (LB) supplemented with necessary nutritional supplements. In some embodiments, the medium also contains a selection agent selected based on the construction of the expression vector, which selectively allows the growth of prokaryotic cells containing the expression vector. For example, ampicillin is added to the medium for the growth of cells expressing an ampicillin resistance gene.

[0464] Any necessary supplements other than carbon, nitrogen, and inorganic phosphate sources may also be included at appropriate concentrations, either alone or in admixture with the medium, such as another supplement or a complex nitrogen source. Optionally, the culture medium may contain one or more reducing agents selected from the group consisting of glutathione, cysteine, cystamine, thioglycollate, dithioerythritol, and dithiothreitol.

[0465] Prokaryotic host cells are cultured at a suitable temperature. In certain embodiments, for growth of E. coli, the growth temperature ranges from about 20°C to about 39°C, from about 25°C to about 37°C, or about 30°C. The pH of the medium can be any pH ranging from about 5 to about 9, depending primarily on the host organism. In certain embodiments, for E. coli, the pH is about 6.8 to about 7.4, or about 7.0.

[0466] When an inducible promoter is used in the expression vector of the present invention, protein expression is induced under the conditions suitable for promoter activation.In one aspect of the present invention, PhoA promoter is used to control the transcription of polypeptide.Therefore, transformed host cells are cultured in phosphate-limited medium for induction.In certain embodiments, phosphate-limited medium is CRAP medium (see, for example, Simmons et al., J.Immunol.Methods (2002), 263:133-147).As known in the art, various other inducers can be used according to the vector construction used.

[0467] In one embodiment, the expressed masked cytokine of the present invention is secreted into the periplasm of the host cell and recovered therefrom. Protein recovery typically involves disrupting the microorganism, generally by means such as osmotic shock, sonication, or lysis. Once the cells are disrupted, cell debris or whole cells can be removed by centrifugation or filtration. The protein can be further purified, for example, by affinity resin chromatography. Alternatively, the protein can be transported into the culture medium and isolated therein. The cells can be removed from the culture, and the culture supernatant filtered and concentrated for further purification of the produced protein. The expressed polypeptide can be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assays.

[0468] In one aspect of the present invention, masked cytokine production is carried out on a large scale by a fermentation process. A variety of large-scale fed-batch fermentation procedures are available for recombinant protein production. Large-scale fermentations have a volume of at least 1000 liters, and in certain embodiments, a volume of about 1,000 to 100,000 liters. These fermentors use agitator impellers to distribute oxygen and nutrients, particularly glucose. Small-scale fermentation generally refers to fermentation in fermentors with a volumetric capacity of about 100 liters or less, and can range from about 1 liter to about 100 liters.

[0469] In fermentation processes, induction of protein expression typically begins after cells have been grown under suitable conditions to a desired density, e.g., an OD550 of about 180-220, at which point the cells are in early stationary phase. Various inducers are known in the art and may be used according to the vector construct used, as described above. Cells may be grown for a shorter period before induction. Cells are usually induced for about 12-50 hours, although longer or shorter induction times may be used.

[0470] Various fermentation conditions can be modified to improve the production yield and quality of the polypeptides of the present invention. For example, to improve the proper assembly and folding of secreted antibody polypeptides, additional vectors overexpressing chaperone proteins, such as Dsb proteins (DsbA, DsbB, DsbC, DsbD, and / or DsbG) or FkpA (a peptidyl prolyl cis, trans-isomerase with chaperone activity), can be used to co-transform prokaryotic host cells. Chaperone proteins have been demonstrated to promote the proper folding and solubility of heterologous proteins produced in bacterial host cells. Chen et al. (1999) J.Biol.Chem.274:19601-19605, Georgiou et ak, US Patent No. 6,083,715, Georgiou et ak, US Patent No. 6,027,888, Bothmann and Pluckthun (2000) J.Biol.Chem.275:17100-17105, Ramm and Pluckthun (2000) J.Biol.Chem.275:17106-17113, Arie et ak (2001) Mol.Microbiol.39:199-210.

[0471] To minimize proteolysis of expressed heterologous proteins (especially proteins that are proteolytically sensitive), certain host strains deficient in proteolytic enzymes can be used in the present invention. For example, host cell strains can be modified to affect genetic mutations in genes encoding known bacterial proteases, such as protease III, OmpT, DegP, Tsp, protease I, protease Mi, protease V, protease VI, and combinations thereof. Several E. coli protease-deficient strains are available and are described, for example, in Joly et al. (1998), supra; Georgiou et al., U.S. Pat. No. 5,264,365; Georgiou et al., U.S. Pat. No. 5,508,192; and Kara et al., Microbial Drug Resistance, 2:63-72 (1996).

[0472] In one embodiment, an E. coli strain that is deficient in a proteolytic enzyme and transformed with a plasmid that overexpresses one or more chaperone proteins is used as a host cell in the expression system of the present invention.

[0473] c. Purification of masked cytokines In some embodiments, the masked cytokines produced herein are further purified to obtain preparations that are substantially homogeneous for further assays and uses. Standard protein purification methods known in the art can be used. The following procedures are examples of suitable purification procedures: fractionation on immunoaffinity or ion exchange columns, ethanol precipitation, reverse-phase HPLC, chromatography on silica or on cation exchange resins such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, and gel filtration using, for example, Sephadex G-75.

[0474] In some embodiments, Protein A immobilized on a solid phase is used for immunoaffinity purification of the masked cytokines of the present invention. Protein A is a 41 kD cell wall protein from Staphylococcus aureus that binds with high affinity to the Fc region of antibodies. Lindmark et al. (1983) J. Immunol. Meth. 62:1-13. The solid phase to which Protein A is immobilized can be a column containing a glass or silica surface, or a controlled pore glass column or a silicic acid column. In some applications, the column may be coated with a reagent such as glycerol to prevent nonspecific adhesion of contaminants.

[0475] As a first step in purification, the preparation from the cell culture described above can be applied to a Protein A-immobilized solid phase to allow specific binding of the antibody of interest to Protein A. The solid phase is then washed to remove contaminants nonspecifically bound to the solid phase. Finally, the masked cytokine of interest is recovered from the solid phase by elution.

[0476] Other methods of purification that provide high affinity binding to the masked cytokine component can be used according to standard protein purification methods known in the art.

[0477] 2. Production of Masked Cytokines Using Eukaryotic Host Cells Vectors for use in eukaryotic host cells generally include one or more of the following components, but are not limited to: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.

[0478] a. signal sequence component Vectors for use in eukaryotic host cells may also contain a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide of interest. The heterologous signal sequence selected may be one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell. In mammalian cell expression, mammalian signal sequences and viral secretory leaders, for example, the herpes simplex gD signal, are available.

[0479] The DNA for such a precursor region is ligated in reading frame to DNA encoding the masked cytokine.

[0480] b. Origin of replication Generally, the origin of replication component is not needed for mammalian expression vectors. For example, the SV40 origin may typically be used only because it contains the early promoter.

[0481] C. selection gene component Expression and cloning vectors may contain a selection gene, also called a selectable marker. Typical selection genes encode (a) a protein that confers resistance to antibiotics or other toxins, such as ampicillin, neomycin, methotrexate, or tetracycline, (b) a protein that complements an auxotrophic deficiency, if relevant, or (c) a protein that supplies a vital nutrient that is not available from complex media.

[0482] One example of a selection scheme utilizes drugs to arrest the growth of host cells. Those cells that are successfully transformed with the heterologous gene produce a protein that confers drug resistance and therefore survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid, and hygromycin.

[0483] Other examples of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up masked cytokine encoding nucleic acids such as DHFR, thymidine kinase, metallothionein-I and -II, primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, and the like.

[0484] For example, in some embodiments, cells transformed with the DHFR selection gene are first identified by culturing all transformants in culture medium containing methotrexate (Mtx), a competitive antagonist of DHFR. In some embodiments, when wild-type DHFR is used, a suitable host cell is a Chinese hamster ovary (CHO) cell line deficient in DHFR activity (e.g., ATCC CRL-9096).

[0485] Alternatively, host cells transformed or co-transformed with DNA sequences encoding a masked cytokine, wild-type DHFR protein, and another selectable marker, such as aminoglycoside 3'-phosphotransferase (APH) (particularly wild-type hosts containing endogenous DHFR) can be selected by growing the cells in medium containing a selection agent for the selectable marker, such as an aminoglycoside antibiotic, e.g., kanamycin, neomycin, or G418. See U.S. Patent No. 4,965,199. Host cells can include NS0, including cell lines deficient in glutamine synthetase (GS). Methods for using GS as a selectable marker for mammalian cells are described in U.S. Patent Nos. 5,122,464 and 5,891,693.

[0486] d. promoter component Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to a nucleic acid encoding a masked cytokine of interest, which may be any of the masked cytokines described herein. Promoter sequences are known for eukaryotes. For example, nearly all eukaryotic genes have an AT-rich region located approximately 25-30 bases upstream from the site where transcription begins. Another sequence found 70-80 bases upstream from the start of transcription of many genes is a CNCAAT region, where N can be any nucleotide. At the 3' end of most eukaryotic genes is an AATAAA sequence, which may be a signal for addition of a polyA tail to the 3' end of the coding sequence. In certain embodiments, any or all of these sequences may be suitably inserted into a eukaryotic expression vector.

[0487] Transcription from vectors in mammalian host cells is controlled by promoters obtained, for example, from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis B virus, and simian virus 40 (SV40), from heterologous mammalian promoters, such as the actin promoter or immunoglobulin promoters, or from heat shock promoters, provided that such promoters are compatible with the host cell system.

[0488] The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment. A system for expressing DNA in mammalian hosts using bovine papilloma virus as a vector is disclosed in U.S. Patent No. 4,419,446. A modification of this system is described in U.S. Patent No. 4,601,978. See also Reyes et al., Nature 297:598-601 (1982), which describes expression of human β-interferon cDNA in mouse cells under the control of the thymidine kinase promoter from herpes simplex virus. Alternatively, the Rous sarcoma virus long terminal repeat can be used as a promoter.

[0489] e. enhancer element component Transcription of DNA encoding the masked cytokine of the present invention by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, α-fetoprotein, and insulin). However, typically, an enhancer from a eukaryotic cell virus will be used. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the human cytomegalovirus early promoter enhancer, the mouse cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. See also Yaniv, Nature 297:17-18 (1982), which describes enhancer elements for activation of eukaryotic promoters. The enhancer can be spliced ​​into the vector at a position 5' or 3' to the masked cytokine coding sequence, but is generally located at a site 5' from the promoter.

[0490] f. transcription termination component Expression vectors used in eukaryotic host cells may also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally, 3' untranslated regions of eukaryotic or viral DNA or cDNA. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the masked cytokine. One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94 / 11026 and the expression vector disclosed therein.

[0491] g. Host Cell Selection and Transformation Suitable host cells for cloning or expressing the DNA in the vectors herein include the higher eukaryotic cells described herein, including vertebrate host cells. Propagating vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines include monkey kidney CV1 transformed with SV40 (COS-7, ATCC CRL 1651), human embryonic kidney (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)), baby hamster kidney cells (BHK, ATCC CCL 10), Chinese hamster ovary cells / -DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)), mouse Sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)), monkey kidney cells (CV1 ATCC CCL 70), African green monkey kidney cells (VERO-76, ATCC CRL-1587), human cervical carcinoma cells (HELA, ATCC CCL 2), canine kidney cells (MDCK, ATCC CCL 34), buffalo rat liver cells (BEL 3A, ATCC CRL 1442), human lung cells (W138, ATCC CCL 75), human liver cells (Hep G2, HB 8065), mouse mammary tumor (MMT 060562, ATCC CCL51), TRI cells (Mather et al., Annals NY Acad. Sci. 383:44-68 (1982)), MRC5 cells, FS4 cells, and a human hepatoma line (Hep G2).

[0492] Host cells are transformed with the expression or cloning vectors described above for production of masked cytokines and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.

[0493] h. Host cell culture The host cells used to produce the masked cytokines of the present invention can be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma), minimal essential medium (MEM, Sigma), RPMI-1640 (Sigma), and Dulbecco's modified Eagle's medium (DMEM, Sigma) are suitable for culturing host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58:44 (1979), Barnes et al., Anal. Biochem. 102:255 (1980), U.S. Pat. Nos. 4,767,704, 4,657,866, A,921,162, 4,560,655, or 5,122,469, WO 90 / 03430, WO 87 / 00195, or U.S. Pat. Reissue No. 30,985 can be used as a culture medium for host cells. Any of these media may be supplemented, as needed, with hormones and / or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as the drug GENTAMYCIN™), trace elements (usually defined as inorganic compounds present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other supplements may also be included at appropriate concentrations that would be known to one of skill in the art. Culture conditions, such as temperature, pH, and the like, will be those previously used with the host cell selected for expression and will be apparent to one of skill in the art.

[0494] i. Purification of masked cytokines When using recombinant techniques, masked cytokines can be produced intracellularly or directly secreted into the culture medium. If the masked cytokine is produced intracellularly as a first step, particulate debris, either host cells or lysed fragments, can be removed, for example, by centrifugation or ultrafiltration. If the masked cytokine is secreted into the culture medium, the supernatant from such an expression system can first be concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor, such as PMSF, can be included in any of the aforementioned steps to inhibit proteolysis, and antibiotics can be included to prevent the growth of adventitious contaminants.

[0495] Masked cytokine compositions prepared from cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a convenient technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domains present in the masked cytokine, if any. Protein A can be used to purify antibodies based on human IgG1, IgG2, or IgG4 heavy chains (Lindmark et al., J. Immunol. Methods 62:1-13 (1983)). Protein G is recommended for all mouse isotypes and human y3 (Guss et al., EMBO J. 5:15671575 (1986)). The matrix to which the affinity ligand is attached can be agarose, although other matrices are also available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. If the masked cytokine contains a CH3 domain, Bakerbond ABX™ resin (JT Baker, Phillipsburg, NJ) is useful for purification.

[0496] Other techniques for protein purification, such as fractionation on ion exchange columns, ethanol precipitation, reverse-phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSE™, chromatography on anion or cation exchange resins (such as polyaspartic acid columns), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation, are also available depending on the masked cytokine to be recovered.

[0497] Following any preliminary purification steps, the mixture containing the masked cytokine of interest and contaminants may be subjected to further purification, for example, by low pH hydrophobic interaction chromatography using an elution buffer at a pH of about 2.5 to 4.5, performed at a low salt concentration (e.g., about 0 to 0.25 M salt).

[0498] In general, various methodologies for preparing masked cytokines for use in research, testing, and clinical applications are established in the art consistent with those described above and / or as deemed appropriate by the skilled artisan for a particular masked cytokine of interest.

[0499] 5. Composition In some aspects, also provided herein are compositions comprising any of the IL-12 masked cytokines described herein. In some embodiments, the composition comprises any of the exemplary embodiments of the masked IL-12 cytokines described herein. In some embodiments, the composition comprises a dimer of any of the masked IL-12 cytokines described herein. In some embodiments, the composition is a pharmaceutical composition. In some embodiments, the composition comprises a masked IL-12 cytokine and further comprises one or more of the components described in detail below. For example, in some embodiments, the composition comprises one or more pharmaceutically acceptable carriers, excipients, stabilizers, buffers, preservatives, isotonicity agents, non-ionic surfactants or detergents, or other therapeutic agents or active compounds, or combinations thereof. Various embodiments of compositions may also be referred to herein as formulations.

[0500] Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired purity with optional pharmaceutically acceptable carriers, excipients, or stabilizers (Remington: The Science and Practice of Pharmacy, 20th Ed., Lippincott Williams & Wiklins, Pub., Gennaro Ed., Philadelphia, Pa. 2000). Acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the dosages and concentrations employed and include buffers, ascorbic acid, methionine, vitamin E, antioxidants including sodium metabisulfite, preservatives, isotonicity agents, stabilizers, metal complexes (e.g., Zn-protein complexes), chelating agents such as EDTA, and / or non-ionic surfactants.

[0501] Buffers can be used to adjust the pH within a range that optimizes therapeutic efficacy, particularly when stability is pH-dependent. Buffers can be present at concentrations ranging from about 50 mM to about 250 mM. Suitable buffers for use with the present invention include both organic and inorganic acids and their salts, such as citrate, phosphate, succinate, tartrate, fumarate, gluconate, oxalate, lactate, and acetate. Additionally, buffers can be comprised of histidine salts, such as Tris, and trimethylamine salts.

[0502] Preservatives may be added to prevent microbial growth and are typically present in the range of about 0.2% to 1.0% (w / v). Examples of suitable preservatives commonly used with therapeutic agents include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium halides (e.g., chloride, bromide, iodide), benzethonium chloride, thimerosal, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, m-cresol, o-cresol, p-cresol, methyl p-hydroxybenzoate, propyl p-hydroxybenzoate, 2-phenoxyethanol, butyl p-hydroxybenzoate, 2-phenylethanol, ethanol, chlorobutanol, thiomerosal, bronopol, benzoic acid, imidurea, chlorhexidine, sodium dehydroacetate, chlorocresol, ethyl p-hydroxybenzoate, and chlorphenesin (3p-chlorophenoxypropane-1,2-diol).

[0503] Isotonicity agents, sometimes known as "stabilizers," may be present to adjust or maintain the isotonicity of the liquid in the composition. When used with large charged biomolecules such as proteins and antibodies, they are often referred to as "stabilizers" because they can interact with the charged groups of amino acid side chains, thereby reducing the likelihood of inter- and intra-molecular interactions.

[0504] The isotonicity agent can be present in any amount from about 0.1% to about 25% by weight, or from about 1% to about 5% by weight, taking into account the relative amounts of other ingredients. In some embodiments, the isotonicity agent includes a polyhydric sugar alcohol, a trihydric or higher sugar alcohol such as glycerin, erythritol, arabitol, xylitol, sorbitol, and mannitol.

[0505] Additional excipients include agents that can act as one or more of: (1) bulking agents, (2) solubility enhancers, (3) stabilizers, and (4) agents that prevent denaturation or adhesion to container walls. Such excipients include polyhydric sugar alcohols (as listed above), amino acids such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, and threonine, organic sugars or sugar alcohols such as sucrose, lactose, lactitol, trehalose, stachyose, mannose, sorbose, xylose, ribose, ribitol, myo-inisitose, myo-inisitol, galactose, galactitol, glycerol, cyclitols (e.g., inositol), and polyethylene glycol. Examples of suitable reducing agents include sulfur-containing reducing agents such as alcohol, urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, α-monothioglycerol, and sodium thiosulfate; low molecular weight proteins such as human serum albumin, bovine serum albumin, gelatin, or other immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; monosaccharides (e.g., xylose, mannose, fructose, glucose); disaccharides (e.g., lactose, maltose, sucrose); trisaccharides such as raffinose; and polysaccharides such as dextrin or dextran.

[0506] A non-ionic surfactant or detergent (also known as a "wetting agent") may be present to help solubilize the therapeutic agent and protect the therapeutic protein from agitation-induced aggregation, which also allows the formulation to be exposed to shear surface stresses without causing denaturation of the active therapeutic protein or antibody. The non-ionic surfactant is present in a range of about 0.05 mg / ml to about 1.0 mg / ml, or about 0.07 mg / ml to about 0.2 mg / ml. In some embodiments, the non-ionic surfactant is present in a range of about 0.001% to about 0.1% w / v, or about 0.01% to about 0.1% w / v, or about 0.01% to about 0.025% w / v.

[0507] Suitable nonionic surfactants include polysorbates (e.g., 20, 40, 60, 65, 80), poloxamers (e.g., 184, 188), PLURONIC® polyol, TRITON®, polyoxyethylene sorbitan monoethers (e.g., TWEEN®-20, TWEEN®-80), lauromacrogol 400, polyoxyl 40 stearate, polyoxyethylene hydrogenated castor oil 10, 50, and 60, glycerol monostearate, sucrose fatty acid esters, methylcellulose, and carboxymethylcellulose. Anionic detergents that can be used include sodium lauryl sulfate, sodium dioctyl sulfosuccinate, and sodium dioctyl sulfonate. Cationic detergents include benzalkonium chloride or benzethonium chloride.

[0508] For use in in vivo administration, the formulation must be sterile.The formulation can be sterilized by filtration through a sterile filtration membrane.The therapeutic compositions herein are generally placed into a container with a sterile access port, for example, an intravenous solution bag or a vial with a stopper that can be pierced by a hypodermic injection needle.

[0509] The route of administration will be in accordance with known and accepted methods, for example, by subcutaneous, intravenous, intraperitoneal, intramuscular, intraarterial, intralesional, or intraarticular route, topical administration, by inhalation, or by slow or sustained release means, in a suitable manner such as injection or infusion, as single or multiple boluses, or by infusion over an extended period of time.

[0510] Any of the masked IL-12 cytokines described herein can be used alone or in combination with other therapeutic agents, as in the methods described herein. The term "in combination with" encompasses two or more therapeutic agents (e.g., masked IL-12 cytokines) in the same or separate formulations. In some embodiments, "in combination with" refers to "concurrent" administration, where administration of the masked IL-12 cytokine of the present invention occurs simultaneously with administration of one or more additional therapeutic agents (e.g., at the same time or within one hour between administration of the masked IL-12 cytokine and administration of the one or more additional therapeutic agents). In some embodiments, "in combination with" refers to sequential administration, where administration of the masked IL-12 cytokine of the present invention occurs before and / or after administration of one or more additional therapeutic agents (e.g., more than one hour between administration of the masked IL-12 cytokine and administration of the one or more additional therapeutic agents). Agents contemplated herein include, but are not limited to, a cytotoxic agent, a cytokine, an agent that targets an immune checkpoint molecule, an agent that targets an immune stimulatory molecule, a growth inhibitory agent, an immunostimulatory agent, or an anti-cancer agent.

[0511] The formulations herein may also contain more than one active compound as needed for the particular indication being treated, preferably with complementary activities that do not adversely affect each other. Alternatively, or in addition, the composition may include a cytotoxic agent, a cytokine, an agent that targets an immune checkpoint or stimulatory molecule, a growth inhibitor, an immunostimulatory agent, an anti-inflammatory agent, or an anti-cancer agent. Such molecules are suitably present in combination in amounts effective for the intended purpose.

[0512] The formulations may be presented in any suitable form, such as a liquid formulation, a solid (lyophilized) formulation, or a frozen formulation, etc. Approaches for preparing each of these types of formulations for therapeutic use are well known in the art.

[0513] 6. Treatment Methods Provided herein are methods for treating or preventing a disease in a subject, comprising administering to the subject an effective amount of any masked IL-12 cytokine or composition thereof described herein. In some aspects, methods are provided for treating a disease in a subject, comprising administering to the subject any composition described herein. In some embodiments, the subject (e.g., a human patient) has been diagnosed with cancer or is at risk of developing such a disorder. In some embodiments, methods are provided for treating or preventing a disease in a subject, comprising administering to the subject an effective amount of any masked IL-12 cytokine or composition thereof described herein, wherein the masked IL-12 cytokine is activated upon enzymatic cleavage. In some embodiments, the masked IL-12 cytokine is activated in the tumor microenvironment. The masked IL-12 cytokine is therapeutically active after cleavage. Thus, in some embodiments, the active agent is a cleavage product.

[0514] For the prevention or treatment of disease, the appropriate dosage of the active agent will depend on the type of disease being treated, as defined above, the severity and course of the disease, whether the agent is being administered for prophylactic or therapeutic purposes, previous therapy, the subject's clinical history and response to the agent, and the discretion of the treating physician. The agent is suitably administered to the subject at one time or over a series of treatments.

[0515] In some embodiments of the methods described herein, the interval between administrations of a masked IL-12 cytokine described herein is about 1 week or more. In some embodiments of the methods described herein, the interval between administrations of a masked IL-12 cytokine described herein is about 2 days or more, about 3 days or more, about 4 days or more, about 5 days or more, or about 6 days or more. In some embodiments of the methods described herein, the interval between administrations of a masked IL-12 cytokine described herein is about 1 week or more, about 2 weeks or more, about 3 weeks or more, or about 4 weeks or more. In some embodiments of the methods described herein, the interval between administrations of a masked IL-12 cytokine described herein is about 1 month or more, about 2 months or more, or about 3 months or more. As used herein, the interval between administrations refers to the period between one administration of a masked IL-12 cytokine and the next administration of a masked IL-12 cytokine. As used herein, an interval of about 1 month includes 4 weeks. In some embodiments, the treatment includes multiple administrations of the masked IL-12 cytokine, and the interval between administrations can vary. For example, in some embodiments, the interval between the first and second administrations is about one month, and the interval between subsequent administrations is about two weeks. In some embodiments, the interval between the first and second administrations is about two, three, four, five, or six days, and the interval between subsequent administrations is about one week.

[0516] In some embodiments, the masked IL-12 cytokine is administered multiple times over a period of time. The multiple doses administered to a subject can, in some embodiments, be the same dose for each administration, or in some embodiments, the masked cytokine can be administered to a subject in two or more different doses. For example, in some embodiments, the masked IL-12 cytokine is initially administered one or more times at one dose, and later, beginning at a later time, administered one or more times at a second dose.

[0517] In some embodiments, the masked IL-12 polypeptides described herein are administered at a flat rate. In some embodiments, the masked IL-12 polypeptides described herein are administered to a subject at a dose of about 25 mg to about 500 mg per dose. In some embodiments, the masked IL-12 polypeptides are administered at a dose of about 25 mg to about 50 mg, about 50 mg to about 75 mg, about 75 mg to about 100 mg, about 100 mg to about 125 mg, about 125 mg to about 150 mg, about 150 mg to about 175 mg, about 175 mg to about 200 mg, about 200 mg to about 225 mg, or about 225 mg to about 250 mg per dose. The subject is administered a dose of about 250 mg to about 275 mg, about 275 mg to about 300 mg, about 300 mg to about 325 mg, about 325 mg to about 350 mg, about 350 mg to about 375 mg, about 375 mg to about 400 mg, about 400 mg to about 425 mg, about 425 mg to about 450 mg, about 450 mg to about 475 mg, or about 475 mg to about 500 mg.

[0518] In some embodiments, the masked IL-12 polypeptides described herein are administered to a subject at a dosage based on the subject's body weight or body surface area (BSA). Depending on the type and severity of the disease, a masked IL-12 polypeptide of about 1 μg / kg to 15 mg / kg (e.g., 0.1 mg / kg to 10 mg / kg) may be an initial candidate dosage for administration to a patient, whether by one or more separate administrations or by continuous infusion, for example. One typical daily dosage may range from about 1 μg / kg to about 100 mg / kg or more, depending on the factors discussed above. For repeated administration over several days or longer, depending on the condition, treatment would generally be maintained until a desired suppression of disease symptoms occurs. One exemplary dosage of a masked IL-12 polypeptide would be in the range of about 0.05 mg / kg to about 10 mg / kg. Thus, one or more doses of about 0.5 mg / kg, about 2.0 mg / kg, 4.0 mg / kg, or 10 mg / kg (or any combination thereof) may be administered to a patient. In some embodiments, the masked IL-12 polypeptide described herein is administered to a subject at a dose of about 0.1 mg / kg to about 10 mg / kg or about 1.0 mg / kg to about 10 mg / kg. In some embodiments, the masked IL-12 polypeptide described herein is administered to a subject at a dose of any of about 0.1 mg / kg, about 0.5 mg / kg, about 1.0 mg / kg, about 1.5 mg / kg, about 2.0 mg / kg, about 2.5 mg / kg, about 3.0 mg / kg, about 3.5 mg / kg, about 4.0 mg / kg, about 4.5 mg / kg, about 5.0 mg / kg, about 5.5 mg / kg, about 6.0 mg / kg, about 6.5 mg / kg, about 7.0 mg / kg, about 7.5 mg / kg, about 8.0 mg / kg, about 8.5 mg / kg, about 9.0 mg / kg, about 9.5 mg / kg, or about 10.0 mg / kg.In some embodiments, the masked IL-12 polypeptides described herein are administered at a concentration of about or at least about 0.1 mg / kg, about or at least about 0.5 mg / kg, about or at least about 1.0 mg / kg, about or at least about 1.5 mg / kg, about or at least about 2.0 mg / kg, about or at least about 2.5 mg / kg, about or at least about 3.0 mg / kg, about or at least about 3.5 mg / kg, about or at least about 4.0 mg / kg, about or at least about 4.5 mg / kg, about or at least about 5.0 mg / kg, about or at least about 5.5 mg / kg, about or at least about 6.0 mg / kg, about or at least about 6.5 mg / kg, about, or at least about 7.0 mg / kg. The subject is administered a dose of about or at least about 7.5 mg / kg, about or at least about 8.0 mg / kg, about or at least about 8.5 mg / kg, about or at least about 9.0 mg / kg, about or at least about 9.5 mg / kg, about or at least about 10.0 mg / kg, about or at least about 15.0 mg / kg, about or at least about 20 mg / kg, about or at least about 30 mg / kg, about or at least about 40 mg / kg, about or at least about 50 mg / kg, about or at least about 60 mg / kg, about or at least about 70 mg / kg, about or at least about 80 mg / kg, about or at least about 90 mg / kg, or about or at least about 100 mg / kg. Any of the administration frequencies described above may be used.

[0519] A method of treatment contemplated herein is the treatment of a disorder or disease, such as cancer, with any of the masked IL-12 cytokines or compositions described herein. Disorders or diseases treatable using the formulations of the invention include leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer (e.g., Merkel cell carcinoma), or testicular cancer.

[0520] In some embodiments, provided herein are methods of treating or preventing cancer by administering any of the masked IL-12 cytokines or compositions described herein. In some embodiments, provided herein are methods of treating or preventing cancer by administering any of the IL-12 masked cytokines or compositions described herein in combination with an anti-cancer agent. The anti-cancer agent can be any agent capable of reducing cancer growth, interfering with cancer cell replication, directly or indirectly killing cancer cells, reducing metastasis, reducing tumor blood supply, or reducing cell survival. In some embodiments, the anti-cancer agent is a PD-1 inhibitor, an EGFR inhibitor, a HER2 inhibitor, a VEGFR inhibitor, a CTLA-4 inhibitor, a BTLA inhibitor, a B7H4 inhibitor, a B7H3 inhibitor, a CSFIR inhibitor, a HVEM inhibitor, a CD27 inhibitor, a KIR inhibitor, an NKG2A inhibitor, an NKG2D agonist, a TWEAK inhibitor, an ALK inhibitor, a CD52-targeting antibody, a CCR4-targeting antibody, a PD-L1 inhibitor, a KIT inhibitor, a PDGFR inhibitor, a BAFF inhibitor, a HDL1 inhibitor, a PDGFR inhibitor, a BAFF inhibitor, a PD-L1 inhibitor, a PDGFR inhibitor, a BAFF inhibitor, a HDL1 ... AC inhibitor, VEGF ligand inhibitor, CD19 targeting molecule, FOFR1 targeting molecule, DFF3 targeting molecule, DKK1 targeting molecule, MUC1 targeting molecule, MUG16 targeting molecule, PSMA targeting molecule, MSFN targeting molecule, NY-ES0-1 targeting molecule child, B7H3 targeting molecule, B7H4 targeting molecule, BCMA targeting molecule, CD29 targeting molecule, CD151 targeting molecule, CD123 targeting molecule, CD33 targeting molecule, CD37 targeting molecule, CDH19 targeting molecule, CEA targeting molecule, claudin 18.2 targeting molecule, CFEC12A targeting molecule, EGFRVIII targeting molecule, EPCAM targeting molecule, EPHA2 targeting molecule, FCRH5 targeting molecule, FLT3 targeting molecule, GD2 targeting molecule, glypican 3 targeting molecule, gpA33 targeting molecule, GPRC5D targeting molecule, IL-123R targeting molecule, IL-1RAP targeting molecule, MCSP targeting molecule, RON targeting molecule, ROR1 targeting molecule, STEAP2 targeting molecule, TfR targeting molecule, CD166 targeting molecule, TPBG targeting molecule, TROP2 targeting molecule, proteasome inhibitor, ABE inhibitor, CD30 inhibitor, FLT3 inhibitor, MET inhibitor, RET inhibitor, IL-1(3 inhibitor), MEK inhibitor, ROS1 inhibitor, BRAE inhibitor, CD38 inhibitor, RANKE inhibitor inhibitor, B4GALNT1 inhibitor, SLAMF7 inhibitor, IDH2 inhibitor, mTOR inhibitor, CD20 targeting antibody, BTK inhibitor, PI3K inhibitor, FLT3 inhibitor, PARP inhibitor, CDK4 inhibitor, CDK6 inhibitor, EGFR inhibitor, RAF inhibitor, JAK1 inhibitor, JAK2 inhibitor, JAK3 inhibitor, IL-6 inhibitor, IL-17 inhibitor, smoothened inhibitor, IL-6R inhibitor, BCL2 inhibitor, PTCH inhibitor, PIGF inhibitor, TGFB inhibitor, CD28 agonist, CD3 agonist, CD40 agonist, GITR agonist, OX40 agonist, VISTA agonist, CD137 agonist, LAG3 inhibitor, TIM3 inhibitor, TIGIT inhibitor, and IL-12R inhibitor.

[0521] In some embodiments, provided herein are methods of treating or preventing cancer by administering any of the masked IL-12 cytokines described herein in combination with an anti-inflammatory agent. The anti-inflammatory agent can be any agent capable of preventing, counteracting, inhibiting, or otherwise reducing inflammation.

[0522] In some embodiments, the anti-inflammatory agent is a cyclooxygenase (COX) inhibitor. The COX inhibitor can be any agent that inhibits the activity of COX-1 and / or COX-2. In some embodiments, the COX inhibitor selectively inhibits COX-1 (i.e., the COX inhibitor inhibits the activity of COX-1 more than it inhibits the activity of COX-2). In some embodiments, the COX inhibitor selectively inhibits COX-2 (i.e., the COX inhibitor inhibits the activity of COX-2 more than it inhibits the activity of COX-1). In some embodiments, the COX inhibitor inhibits both COX-1 and COX-2.

[0523] In some embodiments, the COX inhibitor is a selective COX-1 inhibitor and is selected from the group consisting of SC-560, FR122047, P6, mofezolac, TFAP, flurbiprofen, and ketoprofen. In some embodiments, the COX inhibitor is a selective COX-2 inhibitor and is selected from the group consisting of celecoxib, rofecoxib, meloxicam, piroxicam, deracoxib, parecoxib, valdecoxib, etoricoxib, chromene derivatives, chroman derivatives, N-(2-cyclohexyloxynitrophenyl)methanesulfonamide, parecoxib, lumiracoxib, RS 57067, T-614, BMS-347070, JTE-522, S-2474, SVT-2016, CT-3, ABT-963, SC-58125, nimesulide, flosulide, NS-398, L-745337, RWJ-63556, L-784512, dalbuferone, CS-502, LAS-34475, LAS-34555, S-33516, diclofenac, mefenamic acid, and SD-8381. In some embodiments, the COX inhibitor is selected from the group consisting of ibuprofen, naproxen, ketorolac, indomethacin, aspirin, naproxen, tolmetin, piroxicam, and meclofenamate.In some embodiments, the COX inhibitor is SC-560, FR122047, P6, mofezolac, TFAP, lurbiprofen, ketoprofen, celecoxib, rofecoxib, meloxicam, piroxicam, deracoxib, parecoxib, valdecoxib, etoricoxib, chromene derivatives, chroman derivatives, N-(2-cyclohexyloxynitrophenyl)methanesulfonamide, parecoxib, lumiracoxib, RS 57067, T-614, BMS-347070, JTE-522, S-2474, SVT-2016, CT-3, ABT-963, SC-58125, nimesulide, flosulide, NS-398, L-745337, RWJ-63556, L-784512, dalbuferon, CS-502, LAS-34475, LAS-34555, S-33516, diclofenac, mefenamic acid, SD-8381, ibuprofen, naproxen, ketorolac, indomethacin, aspirin, naproxen, tolmetin, piroxicam, and meclofenamate.

[0524] In some embodiments, the anti-inflammatory agent is an NF-kB inhibitor. The NF-kB inhibitor can be any agent that inhibits the activity of the NF-kB pathway. In some embodiments, the NF-kB inhibitor is selected from the group consisting of an IKK complex inhibitor, an IkB degradation inhibitor, an NF-kB nuclear translocation inhibitor, a p65 acetylation inhibitor, an NF-kB DNA binding inhibitor, an NF-kB transactivation inhibitor, and a p53 induction inhibitor.

[0525] In some embodiments, the IKK complex inhibitor is selected from the group consisting of TPCA-1, NF-kB activation inhibitor VI (BOT-64), BMS-345541, amlexanox, SC-514 (GK-01140), IMD-0354, and IKK-16. In some embodiments, the IkB degradation inhibitor is selected from the group consisting of BAY-11-7082, MG-115, MG-132, lactacystin, epoxomicin, parthenolide, carfilzomib, and MLN-4924 (pevonedistat). In some embodiments, the NF-kB nuclear translocation inhibitor is selected from the group consisting of JSH-23 and rolipram. In some embodiments, the p65 acetylation inhibitor is selected from the group consisting of gallic acid and anacardic acid. In some embodiments, the NF-kB DNA binding inhibitor is selected from the group consisting of GYY-4137, p-XSC, CV-3988, and prostaglandin E2 (PGE2). In some embodiments, the NF-kB transactivation inhibitor is selected from the group consisting of LY-294002, wortmannin, and mesalamine. In some embodiments, the p53 induction inhibitor is selected from the group consisting of quinacrine and flavopiridol. In some embodiments, the NF-kB inhibitor is selected from the group consisting of TPCA-1, NF-kB activation inhibitor VI (BOT-64), BMS-345541, amlexanox, SC-514 (GK-01140), IMD-0354, IKK-16, BAY-11-7082, MG-115, MG-132, lactacystin, epoxin, parthenolide, carfilzomib, MLN-4924 (pevonedistat), JSH-23 rolipram, gallic acid, anacardic acid, GYY-4137, p-XSC, CV-3988, prostaglandin E2 (PGE2), LY-294002, wortmannin, mesalamine, quinacrine, and flavopiridol.

[0526] In some embodiments, provided herein are methods for treating or preventing cancer by administering any of the masked IL-12 cytokines or compositions described herein in combination with an anti-cancer therapeutic protein. The anti-cancer therapeutic protein can be any therapeutic protein capable of reducing cancer growth, interfering with cancer cell replication, directly or indirectly killing cancer cells, reducing metastasis, reducing tumor blood supply, or reducing cell survival. Exemplary anti-cancer therapeutic proteins can occur in the form of an antibody or fragment thereof, an antibody derivative, a bispecific antibody, a chimeric antigen receptor (CAR) T cell, a fusion protein, or a bispecific T-cell engager (BiTE). In some embodiments, provided herein are methods for treating or preventing cancer by administering any of the masked IL-2 cytokines or compositions described herein in combination with CAR-NK (natural killer) cells.

[0527] 7. Manufactured articles or kits In another aspect, an article of manufacture or kit is provided that includes any of the masked IL-12 cytokines described herein. The article of manufacture or kit may further include instructions for using the cytokine in the methods of the invention. Thus, in certain embodiments, the article of manufacture or kit may include instructions for using the masked cytokine in a method for treating or preventing a disorder (e.g., cancer) in an individual, comprising administering to the individual an effective amount of the masked cytokine. For example, in certain embodiments, the article of manufacture or kit includes instructions for using the masked IL-12 polypeptide in a method for treating or preventing a disorder (e.g., cancer) in an individual, comprising administering to the individual an effective amount of the masked IL-12 polypeptide. In certain embodiments, the individual is a human. In some embodiments, the individual has a disease selected from the group consisting of leukemia, lymphoma, head and neck cancer, colorectal cancer, prostate cancer, pancreatic cancer, melanoma, breast cancer, neuroblastoma, lung cancer, ovarian cancer, osteosarcoma, bladder cancer, cervical cancer, liver cancer, kidney cancer, skin cancer, or testicular cancer.

[0528] The article of manufacture or kit may further comprise a container. Suitable containers include, for example, bottles, vials (e.g., dual-chamber vials), syringes (such as single- or dual-chamber syringes), test tubes, and intravenous (IV) bags. The container may be formed from a variety of materials, such as glass or plastic. The container holds the formulation. In some embodiments, the formulation is a lyophilized formulation. In some embodiments, the formulation is a frozen formulation. In some embodiments, the formulation is a liquid formulation.

[0529] The article of manufacture or kit may further include a label or package insert on or associated with the container, which may indicate instructions for reconstitution and / or use of the formulation. The label or package insert may further indicate that the formulation is useful or intended for subcutaneous, intravenous, or other administration for treating or preventing a disorder (e.g., cancer) in an individual. The container holding the formulation may be a single-use or multi-use vial, which allows for repeated administration of the reconstituted formulation. The article of manufacture or kit may further include a second container containing a suitable diluent. The article of manufacture or kit may further include other materials desirable from commercial, therapeutic, and user standpoints, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.

[0530] In a specific embodiment, the present invention provides a kit for single-dose administration units, such kit comprising a container of an aqueous formulation of a therapeutic cytokine; This includes both single and multi-chamber pre-filled syringes. Exemplary pre-filled syringes are available from Vetter GmbH (Ravensburg, Germany).

[0531] The article of manufacture or kit herein optionally further comprises a container containing a second agent, wherein the masked cytokine is the first agent, and the article or kit further comprises instructions on a label or package insert for treating a subject with the second agent in an effective amount.

[0532] In another embodiment, provided herein is an article of manufacture or kit comprising the formulations described herein for administration in an auto-injector device. Auto-injectors may be described as injection devices that, upon activation, deliver their contents without further action required from the patient or administrator. They are particularly suited for self-medication of therapeutic formulations when the delivery rate must be constant and the delivery time is longer than a few moments.

[0533] 8. Definition Unless otherwise defined, all terminology, notations, and other technical and scientific terms used herein are intended to have the same meaning as commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and / or ease of reference, and the inclusion of such definitions herein should not necessarily be construed as representing a substantial difference from what is commonly understood in the art.

[0534] It is to be understood that this invention is not limited to particular compositions or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting. As used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to "an IL-12 polypeptide" optionally includes a combination of two or more such polypeptides and equivalents.

[0535] The term "about," as used herein, refers to a normal range of error for the respective value, which is readily known to one of ordinary skill in the art. Reference herein to "about" a value or parameter includes (and describes) embodiments that are inherently directed to that value or parameter.

[0536] It is to be understood that aspects and embodiments of the invention described herein include "comprising," "consisting of," and "consisting essentially of" aspects and implementations.

[0537] As used herein, the term "and / or" refers to any one of the items, any combination of the items, or all of the items with which the term is associated. For example, the phrase "A, B, and / or C" is intended to encompass each of the following embodiments: A, B, and C, A, B, or C, A or B, A or C, B or C, A and B, A and C, B and C, A and B or C, B and A or C, C and A or B, A alone, B alone, and C alone.

[0538] The term "antibody" includes polyclonal antibodies, monoclonal antibodies (including full-length antibodies having an immunoglobulin Fc region), antibody compositions with polyepitopic specificity, multispecific antibodies (e.g., bispecific antibodies, diabodies, and single-chain molecules), and antibody fragments (e.g., Fab, F(ab'), and Fv). The term "immunoglobulin (Ig)" is used interchangeably with "antibody" herein.

[0539] The term "antibody" refers to a small antibody fragment with two antigen-binding sites comprising a heavy-chain variable (VH) domain connected to a light-chain variable (VL) domain in the same polypeptide chain (VH-VL).

[0540] The basic four-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. IgM antibodies consist of five basic heterotetrameric units, along with an additional polypeptide called the J chain, and contain 10 antigen-binding sites, while IgA antibodies contain two to five basic four-chain units that can polymerize with the J chain to form multivalent aggregates. In the case of IgG, the four-chain unit is generally approximately 150,000 daltons. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds, depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges. Each H chain has a variable domain (VH) at the N-terminus, followed by three constant domains (CH) for each of the a and y chains, and four CH domains for the p and s isotypes. Each L chain has a variable domain (VL) at its N-terminus followed by a constant domain at its other end. The VL is aligned with the VH, and the CL is aligned with the first constant domain of the heavy chain (CHI). Particular amino acid residues are thought to form an interface between the light-chain variable domain and the heavy-chain variable domain. The pairing of a VH and a VL together forms a single antigen-binding site. For the structure and properties of different classes of antibodies, see, for example, Basic and Clinical Immunology, 8th Edition, Daniel P. Sties, Abba I. Terr and Tristram G. Parsolw (eds), Appleton & Lange, Norwalk, CT, 1994, page 71 and Chapter 6.

[0541] Light chains from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequence of their constant domains. Depending on the amino acid sequence of the constant domain (CH) of their heavy chains, immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, with heavy chains designated a, b, e, y, and p, respectively. The y and a classes are further divided into subclasses based on relatively minor differences in CH sequence and function; for example, humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. IgG1 antibodies can exist in multiple polymorphic variants called allotypes (reviewed in Jefferis and Lefranc 2009. mAbs Vol 1 Issue 4 1-7), any of which are suitable for use in the present invention. Common allotypic variants in the human population are those designated by the letters a, f, n, and z.

[0542] An "isolated" antibody is an antibody that has been identified, separated, and / or recovered from a component of its production environment (e.g., natural or recombinant). In some embodiments, an isolated polypeptide is free from association with all other components from its production environment. Contaminating components of its production environment, such as those resulting from recombinantly transfected cells, are typically materials that would interfere with research, diagnostic, or therapeutic uses of the antibody and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments, the polypeptide is purified to (1) greater than 95%, and in some embodiments, greater than 99%, by weight of the antibody as determined, for example, by the Lowry method; (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a rolling cup sequencer; or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or silver staining. Since at least one component of the antibody's natural environment will not be present, an isolated antibody includes the antibody in situ within recombinant cells. Ordinarily, however, isolated polypeptide or antibody will be prepared by at least one purification step.

[0543] The term "monoclonal antibody," as used herein, refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and / or post-translational modifications (e.g., isomerization, amidation), which may be present in minor amounts. In some embodiments, the monoclonal antibody has a C-terminal truncation in the heavy and / or light chain. For example, 1, 2, 3, 4, or 5 amino acid residues are truncated at the C-terminus of the heavy and / or light chain. In some embodiments, the C-terminal truncation removes the C-terminal lysine from the heavy chain. In some embodiments, the monoclonal antibody has an N-terminal truncation in the heavy and / or light chain. For example, 1, 2, 3, 4, or 5 amino acid residues are truncated at the N-terminus of the heavy and / or light chain. In some embodiments, truncated forms of the monoclonal antibody can be produced by recombinant techniques. In some embodiments, the monoclonal antibody is highly specific and directed against a single antigenic site. In some embodiments, monoclonal antibodies are highly specific and directed against multiple antigenic sites (e.g., bispecific or multispecific antibodies). The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including, for example, hybridoma methods, recombinant DNA methods, phage display technology, and techniques for producing human or human-like antibodies in animals having some or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences.

[0544] The terms "full-length antibody," "intact antibody," or "whole antibody" are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antibody fragment. Specifically, whole antibodies include those having heavy and light chains, including the Fc region. The constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof. In some cases, intact antibodies may have one or more effector functions.

[0545] "Antibody fragments" include portions of intact antibodies, such as the antigen-binding and / or variable regions of the intact antibody and / or the constant regions of the intact antibody. Examples of antibody fragments include the Fc region of an antibody, a portion of the Fc region, or a portion of an antibody comprising the Fc region. Examples of antigen-binding antibody fragments include domain antibodies (dAbs), Fab, Fab', F(ab')2, and Fv fragments, antibodies, linear antibodies (see U.S. Pat. No. 5,641,870, Example 2; Zapata et al., Protein Eng. 8(10):1057-1062

[1995] ), single-chain antibody molecules, and multispecific antibodies formed from antibody fragments. Single heavy-chain or single light-chain antibodies can be engineered or, in the case of heavy chains, isolated from camelids, sharks, libraries, or mice engineered to produce single heavy-chain molecules.

[0546] Papain digestion of antibodies produces two identical antigen-binding fragments called "Fab" fragments and a residual "Fc" fragment, a name reflecting their ability to crystallize readily. Fab fragments consist of the entire light chain, along with the variable region domain (VH) of the heavy chain and the first constant domain (CHI) of one heavy chain. Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site. Pepsin treatment of antibodies produces a single large F(ab')2 fragment, which roughly corresponds to two disulfide-linked Fab fragments with different antigen-binding activities and is still capable of cross-linking antigen. Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CHI domain, including one or more cysteines from the antibody hinge region. Fab'-SH is the designation used herein for Fab' in which the cysteine ​​residues in the constant domain bear a free thiol group. F(ab')2 antibody fragments were originally produced as pairs of Fab' fragments with hinge cysteines between them. Other chemical combinations of antibody fragments are also known. The Fc fragment contains the carboxy-terminal portions of both H chains held together by disulfides. The effector functions of the antibody are determined by sequences and glycans within the Fc region, a region also recognized by Fc receptors (FcRs) found on certain cell types.

[0547] "Percent (%) amino acid sequence identity" to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical to those in the reference polypeptide sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and does not take into account any conservative substitutions as part of the sequence identity. Alignment to determine percent amino acid sequence identity can be accomplished by a variety of methods within the skill of the art, for example, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment across the full length of the sequences being compared. For example, the % amino acid sequence identity of a given amino acid sequence A to, with, or relative to a given amino acid sequence B (which may alternatively be referred to as a given amino acid sequence A having or comprising a certain % amino acid sequence identity to, with, or relative to a given amino acid sequence B) is calculated as follows: 100 x fraction X / Y

[0548] where X is the number of amino acid residues scored as identical matches by the program's sequences in the alignment of A and B, and Y is the total number of amino acid residues in B. It should be understood that if the length of amino acid sequence A is not equal to the length of amino acid sequence B, then the % amino acid sequence identity of A to B will not be equal to the % amino acid sequence identity of B to A.

[0549] Antibody "effector functions" refer to the biological activities attributable to the Fc region of an antibody (a native sequence Fc region or an amino acid sequence variant Fc region) and vary with the antibody isotype. Examples of antibody effector functions include Clq binding and complement-dependent cytotoxicity, Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), phagocytosis, down-regulation of cell surface receptors (e.g., B cell receptors), and B cell activation.

[0550] "Binding affinity," as used herein, refers to the strength of noncovalent interactions between a single binding site of a molecule (e.g., a cytokine) and its binding partner (e.g., a cytokine receptor). In some embodiments, the affinity of a binding protein (e.g., a cytokine) can generally be represented by the equilibrium dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.

[0551] An "isolated" nucleic acid molecule encoding a cytokine polypeptide described herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is normally associated in the environment in which it is produced. In some embodiments, an isolated nucleic acid is free from all components associated with the production environment. Isolated nucleic acid molecules encoding the polypeptides and cytokine polypeptides of the present invention are in a form other than the form or environment in which they are found in nature. Isolated nucleic acid molecules are therefore distinguished from nucleic acids encoding the polypeptides and cytokine polypeptides of the present invention that naturally occur in cells.

[0552] The term "pharmaceutical formulation" refers to a preparation that is in a form that allows the biological activity of the active ingredient to be effective and that does not contain additional ingredients that are unacceptably toxic to the subject to which the formulation is administered.

[0553] Such formulations are sterile.

[0554] As used herein, a "carrier" includes a pharmaceutically acceptable carrier, excipient, or stabilizer that is nontoxic to cells or mammals exposed thereto at the dosages and concentrations employed. Physiologically acceptable carriers are often aqueous pH-buffered solutions. Examples of physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; proteins such as low molecular weight (less than about 10 residues) polypeptides, serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and / or nonionic surfactants such as TWEEN™, polyethylene glycol (PEG), and PLURONICS™.

[0555] As used herein, the term "treatment" refers to a clinical intervention designed to alter the natural history of the individual or cell being treated during the course of clinical pathology. Desirable effects of treatment include slowing the rate of disease progression, improving or mitigating the disease state, and remission or improved prognosis. An individual is successfully "treated," for example, if one or more symptoms associated with a disorder (e.g., a neoplastic disease) are reduced or eliminated. For example, an individual is successfully "treated" if the treatment results in an improvement in the quality of life of an individual suffering from a disease, a reduction in the dose of other medications required to treat the disease, a reduction in the frequency of disease recurrences, a reduction in the severity of the disease, a delay in the onset or progression of the disease, and / or an extension of the individual's survival.

[0556] As used herein, "in conjunction with" or "in combination with" refers to the administration of one therapeutic modality in addition to another therapeutic modality. Thus, "in conjunction with" or "in combination with" refers to the administration of one therapeutic modality before, during, or after the administration of another therapeutic modality to an individual.

[0557] As used herein, the term "prevention" includes providing protection against the occurrence or recurrence of a disease in an individual. An individual may be predisposed to, susceptible to, or at risk of developing a disorder, but has not been diagnosed with the disorder. In some embodiments, the masked cytokines described herein are used to delay the onset of a disorder.

[0558] As used herein, an individual "at risk" of developing a disorder may or may not have detectable disease or disease symptoms, and may or may not exhibit detectable disease or disease symptoms prior to the treatment methods described herein. "At risk," as known in the art, indicates that an individual has one or more risk factors, which are measurable parameters that correlate with the development of a disease. Individuals with one or more of these risk factors have a higher probability of developing a disorder than individuals without one or more of these risk factors.

[0559] An "effective amount" refers to at least an amount effective, at dosages and for periods of time necessary, to achieve a desired or indicated effect, including a therapeutic or prophylactic result.

[0560] An effective amount can be provided in one or more administrations. A "therapeutically effective amount" is at least the minimum concentration required to affect measurable improvement in a particular disorder. The therapeutically effective amount herein may vary depending on factors such as the patient's disease state, age, sex, and weight, as well as the ability of the antibody to induce a desired response in an individual. A therapeutically effective amount may also be an amount in which the therapeutically beneficial effects outweigh any toxic or harmful effects of the masked cytokine. A "prophylactically effective amount" refers to an amount effective at a dosage and for a period of time necessary to achieve the desired preventative result. Typically, but not necessarily, a prophylactically effective amount may be less than a therapeutically effective amount, since a prophylactic dose is used in subjects before or at an early stage of disease.

[0561] "Chronic" administration refers to the administration of a drug in a continuous mode, as opposed to an acute mode, so as to predominate the initial therapeutic effect (activity) over an extended period of time. "Intermittent" administration is treatment that is not continuous without interruption, but rather is cyclic in nature.

[0562] As used herein, an "individual" or "subject" is a mammal. For purposes of treatment, "mammals" include humans, domestic and farm animals, and zoo, sport, or pet animals such as dogs, horses, rabbits, cows, pigs, hamsters, gerbils, mice, ferrets, rats, cats, etc. In some embodiments, the individual or subject is a human.

[0563] 9. Working Example The present invention will be more fully understood by reference to the following examples, which, however, should not be construed as limiting the scope of the present invention. It should be understood that the examples and embodiments described herein are for illustrative purposes only, and that various modifications or variations thereof in light of this will be suggested to those skilled in the art and are to be included within the spirit and purpose of this application and the scope of the appended claims.

[0564] Although some examples describe the engineering, production, and / or testing of "masked" versions of IL-2 polypeptide constructs, some examples also use a parent "unmasked" version of the IL-2 polypeptide construct, such as for comparison, or other constructs that include one or more of the components described herein that are tested as controls for comparison. Thus, for example, a description of testing performed on a masked IL-2 polypeptide construct does not necessarily mean that an unmasked version of the construct was not also tested.

[0565] Example 1: Engineering a masked IL-2 polypeptide Masked IL-2 polypeptides are produced according to the teachings herein. In the Examples that follow, some experiments involve the use of a monomeric form of a masked IL-2 polypeptide construct, and some experiments involve the use of a dimeric form of a masked IL-2 construct, such as a dimer formed through a disulfide bond linking two copies of the same masked polypeptide construct (homodimer), or a heterodimer formed by two different polypeptides (see, e.g., Table 5).

[0566] Masked IL-2 polypeptide constructs are generated that include an IL-2 polypeptide or a functional fragment thereof, a masking moiety, and a half-life prolonging domain, such as an antibody or fragment thereof (e.g., an Fc region, heavy chain, and / or light chain). Some IL-2 polypeptide constructs are also generated that include an IL-2 polypeptide or a functional fragment thereof linked to a half-life prolonging domain without including a masking moiety. Some of the constructs also include a linker that includes a cleavable peptide and links the masking moiety to the IL-2 polypeptide or a functional fragment thereof, thereby resulting in an activatable masked IL-2 polypeptide construct. Some of the constructs also include a linker that links the IL-2 polypeptide or a functional fragment thereof to the half-life prolonging domain. Some of the constructs also include a linker that links the IL-2 polypeptide or a functional fragment thereof to the masking moiety. Masked IL-2 polypeptide constructs that do not contain a cleavable peptide within the linker connecting the IL-2 polypeptide or functional fragment thereof to the masking moiety are also referred to as deactivatable masked IL-2 polypeptide constructs or deactivatable IL-2 polypeptide constructs, since they do not contain a cleavable peptide. The structures and compositions of exemplary IL-2 polypeptide constructs are provided in Table 3. [Table 5]

[0567] Masked IL-2 polypeptide constructs are also produced, comprising an IL-2 polypeptide or a functional fragment thereof, a first masking moiety, a second masking moiety, and a half-life prolonging domain such as albumin, an antibody or fragment thereof (e.g., an Fc region, heavy chain, and / or light chain), an albumin-binding peptide, an IgG-binding peptide, or a polyamino acid sequence. Some of the constructs also comprise a linker linking the first masking moiety to the IL-2 polypeptide or a functional fragment thereof. Some of the constructs also comprise a linker linking the second masking moiety to the IL-2 polypeptide or a functional fragment thereof. Some of the constructs comprise a cleavable peptide within the linker linking the first masking moiety to the IL-2 polypeptide or a functional fragment thereof and / or the linker linking the seco...

Claims

1. 1. A masked IL-12 cytokine comprising a protein heterodimer, wherein the protein heterodimer comprises: a first polypeptide chain comprising: and a second polypeptide chain comprising: HL1 is a first half-life prolonging domain, L1 is a first linker, MM is a masking moiety, HL2 is a second half-life prolonging domain, L2 is a second linker, and C is an IL-12 cytokine or functional fragment thereof comprising an IL-12p40 polypeptide covalently linked to an IL-12p35 polypeptide via an IL-12p40-IL-12p35 linker; A masked IL-12 cytokine, wherein a first half-life prolonging domain is associated with a second half-life prolonging domain, the first linker is a non-cleavable linker, and the second linker comprises a cleavable peptide of SEQ ID NO: 44 (ISSGLLSGRS), SEQ ID NO: 41 (MPYDLYHP), or SEQ ID NO: 43 (RAAAVKSP).

2. The masked IL-12 cytokine described in claim 1, wherein the IL-12p40 polypeptide comprises the amino acid sequence of SEQ ID NO:

60.

3. The masked IL-12 cytokine described in claim 1, wherein the IL-12p35 polypeptide comprises the amino acid sequence of SEQ ID NO:

2.

4. A masked IL-12 cytokine as described in claim 1, wherein the first linker is 3 to 18 amino acids in length.

5. A masked IL-12 cytokine as described in claim 4, wherein the first linker is rich in amino acid residues G and S.

6. 2. The masked IL-12 cytokine of claim 1, wherein the IL-12p40-IL-12p35 linker is 5 to 20 amino acids in length.

7. 7. The masked IL-12 cytokine of claim 6, wherein the IL-12p40-IL-12p35 linker is rich in G and S amino acid residues.

8. The masked IL-12 cytokine of any one of claims 1 to 7, wherein the IL-12 cytokine or a functional fragment thereof comprises SEQ ID NO:

64.

9. 2. The masked IL-12 cytokine of claim 1, wherein the masking moiety comprises the extracellular domain of human IL-12Rβ2 or a fragment, portion, or variant thereof that retains or otherwise demonstrates affinity for IL-12.

10. The masked IL-12 cytokine of claim 9, wherein the masking portion comprises sequence number 65.

11. 2. The masked IL-12 cytokine of claim 1, wherein the first half-life prolonging domain comprises a first IgG1 Fc domain or a fragment thereof, and the second half-life prolonging domain comprises a second IgG1 Fc domain or a fragment thereof.

12. The masked IL-12 cytokine of claim 11, wherein the first and / or second Fc domains each contain one or more modifications that promote non-covalent association of the first and second half-life extending domains.

13. 13. The masked IL-12 cytokine of claim 12, wherein the first half-life prolonging domain comprises SEQ ID NO:25 and the second half-life prolonging domain comprises SEQ ID NO:

26.

14. A nucleic acid encoding the masked IL-12 cytokine of claim 1.

15. A vector comprising the nucleic acid of claim 14.

16. A host cell comprising the nucleic acid described in claim 14.

17. A composition comprising the masked IL-12 cytokine of claim 1.

18. 10. A pharmaceutical composition comprising the masked IL-12 cytokine of claim 1 and a pharmaceutically acceptable carrier.

19. 17. A method for producing a masked IL-12 cytokine as defined in claim 1, comprising culturing the host cell of claim 16 under conditions to produce the masked IL-12 cytokine.

20. A masked IL-12 cytokine for use in medicine as defined in claim 1.

21. 10. The masked IL-12 cytokine of claim 1 for use in the treatment or prevention of cancer.

Images