Blockade of CD7 expression and chimeric antigen receptors for immunotherapy of T-cell malignancies

Abstract

The present invention relates to blockade of CD7 expression and chimeric antigen receptors for the immunotherapy of T-cell malignancies. The present invention provides compositions comprising an anti-CD7 chimeric activating receptor (CAR) and an anti-CD7 protein expression blocker, as well as methods of using such compositions in the treatment of cancer. [Selection diagram] None

Description

[Technical Field]

[0001] (CROSS-REFERENCE TO RELATED APPLICATIONS) This application claims the benefit of U.S. Provisional Patent Application Nos. 62 / 425,398, filed November 22, 2016, and 62 / 543,696, filed August 10, 2017, each of which is expressly incorporated by reference in its entirety for all purposes. Sequence Listing

[0002] This application contains a Sequence Listing that has been submitted electronically in ASCII format and is incorporated herein by reference in its entirety. The ASCII copy, created on November 21, 2017, is named 119419-5002-WO_ST25.txt and is 20,928 bytes in size. [Background technology]

[0003] Chimeric antigen receptors (CARs) can convert immune cells to specifically recognize and kill tumor cells. CARs are artificial multimolecular proteins composed of an antibody single-chain variable region (scFv) linked to a signaling molecule via a transmembrane domain. When the scFv binds to its cognate antigen, signal transduction is triggered, leading to tumor cell killing by CAR-expressing cytotoxic T lymphocytes (Non-Patent Document 1, Non-Patent Document 2, Non-Patent Document 3, Non-Patent Document 4, Non-Patent Document 5). Clinical trials using CAR-expressing autologous T lymphocytes have shown positive responses in patients with B-cell refractory leukemia and lymphoma (e.g., Non-Patent Document 6, Non-Patent Document 7). [Prior art documents] [Non-patent literature]

[0004] [Non-Patent Document 1] Eshhar Z, Waks T, et al.PNAS USA.90(2):720-724,1993 [Non-patent document 2] Geiger TL,et al.J Immunol.162(10):5931-5939,1999 [Non-patent document 3] Brentjens RJ, et al. Nat Med.9(3):279-286,2003 [Non-patent document 4] Cooper LJ, et al.Blood 101(4):1637-1644,2003 [Non-patent document 5] Imai C,et al.Leukemia.18:676-684,2004 [Non-patent document 6] Till BGet al.Blood 119(17):3940-3950,2012 [Non-Patent Document 7] Maude SL,et al.N Engl J Med.371(16):1507-1517,2014 Summary of the Invention [Problem to be solved by the invention]

[0005] The development of CAR technology for targeting T-cell malignancies has lagged considerably behind the progress made for their B-cell counterparts. Novel therapies for T-cell malignancies are needed, but progress to date has been slow. In particular, effective immunotherapeutic options are lacking, and treatment of T-cell acute lymphoblastic leukemia (T-ALL) relies on intensive chemotherapy and hematopoietic stem cell transplantation. Despite the morbidity and mortality of these approaches, results have been unsatisfactory.

[0006] In summary, there is a significant unmet need for novel treatment options for patients with T-cell malignancies. [Means for solving the problem]

[0007] In one aspect, the invention provides a genetically engineered immune cell comprising: (i) a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain, wherein the target binding molecule is a first antibody that specifically binds to CD7; and (ii) a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises a 4-1BB intracellular signaling domain, a CD3ζ intracellular signaling domain, and a second antibody that specifically binds to CD7.

[0008] In some embodiments, the first antibody that specifically binds to CD7 is a first single-chain variable fragment (scFv). In certain embodiments, the second antibody that specifically binds to CD7 is a second single-chain variable fragment (scFv).

[0009] In some embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2. In other embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 15. In certain embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 17.

[0010] In some embodiments, the localization domain comprises an amino acid sequence selected from the group consisting of an endoplasmic reticulum (ER) retention sequence, a Golgi apparatus retention sequence, a proteasome localization sequence, and a transmembrane domain sequence derived from CD8α, CD8β, 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, or FGFR2B. In some embodiments, the localization domain comprises an endoplasmic reticulum (ER) retention sequence comprising the amino acid sequence of SEQ ID NO:8 or SEQ ID NO:9. In other embodiments, the localization domain comprises a transmembrane domain sequence derived from a CD8α hinge and transmembrane domain sequence comprising the amino acid sequence of SEQ ID NO:13. In some embodiments, proteasomal localization of a target-binding molecule (e.g., scFv) is achieved by linking the scFv sequence to a tripartite motif-containing 21 (TRIM21) targeting domain sequence and co-expressing a nucleic acid sequence encoding the human TRIM21 E3 ubiquitin ligase protein.

[0011] In some embodiments, the 4-1BB intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:3 and the CD3ζ intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:4.

[0012] In some embodiments, the hinge and transmembrane domains comprise the amino acid sequence of SEQ ID NO:10.

[0013] In some embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2. In other embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 15. In yet other embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 17.

[0014] In some embodiments, the engineered cells are engineered T cells, engineered natural killer (NK) cells, engineered NK / T cells, engineered monocytes, engineered macrophages, or engineered dendritic cells.

[0015] In another aspect, the present invention provides a genetically engineered immune cell comprising: (i) a target binding molecule linked to a localization domain, where the target binding molecule is a first antibody that specifically binds to CD7; and (ii) a chimeric antigen receptor (CAR), where the CAR comprises a 4-1BB intracellular signaling domain, a CD3ζ intracellular signaling domain, and a second antibody that specifically binds to CD7.

[0016] In some embodiments, the first antibody that specifically binds to CD7 is a first single-chain variable fragment (scFv). In certain embodiments, the second antibody that specifically binds to CD7 is a second single-chain variable fragment (scFv).

[0017] In some embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2. In other embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 15. In certain embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 17.

[0018] In some embodiments, the localization domain comprises an amino acid sequence selected from the group consisting of an endoplasmic reticulum (ER) retention sequence, a Golgi apparatus retention sequence, a proteasome localization sequence, and a transmembrane domain sequence derived from CD8α, CD8β, 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, or FGFR2B. In some embodiments, the localization domain comprises an endoplasmic reticulum (ER) retention sequence comprising the amino acid sequence of SEQ ID NO:8 or SEQ ID NO:9. In other embodiments, the localization domain comprises a transmembrane domain sequence derived from a CD8α hinge and transmembrane domain sequence comprising the amino acid sequence of SEQ ID NO:13.

[0019] In some embodiments, the 4-1BB intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:3 and the CD3ζ intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:4.

[0020] In some embodiments, the hinge and transmembrane domains comprise the amino acid sequence of SEQ ID NO:10.

[0021] In some embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2. In other embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 15. In yet other embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 17.

[0022] In some embodiments, the engineered cells are engineered T cells, engineered natural killer (NK) cells, engineered NK / T cells, engineered monocytes, engineered macrophages, or engineered dendritic cells.

[0023] In some embodiments, provided herein is a pharmaceutical composition comprising a genetically engineered immune cell described herein and a pharmaceutically acceptable carrier.

[0024] In another aspect, the present invention provides a method of producing the genetically engineered immune cells described herein, comprising: (i) introducing into an immune cell: (a) a first nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain, wherein the target binding molecule is a first antibody that specifically binds to CD7, and (b) a second nucleic acid comprising a nucleotide sequence encoding a CAR, wherein the CAR comprises a 4-1BB intracellular signaling domain, a CD3ζ intracellular signaling domain, and a second antibody that specifically binds to CD7; and (ii) isolating the genetically engineered immune cell comprising the target binding molecule linked to the localization domain and the CAR, thereby producing the genetically engineered immune cell.

[0025] In yet another aspect, the present invention provides methods of treating cancer in a subject (e.g., a patient) in need of treatment, the method comprising administering a therapeutic amount of genetically engineered immune cells to the patient, thereby treating the cancer in the subject in need of treatment. In some embodiments, the genetically engineered immune cells comprise: (i) a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain, where the target binding molecule is a first antibody that specifically binds to CD7, and (ii) a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), where the CAR comprises a 4-1BB intracellular signaling domain, a CD3ζ intracellular signaling domain, and a second antibody that specifically binds to CD7.

[0026] In some embodiments, the first antibody that specifically binds to CD7 is a first single-chain variable fragment (scFv). In certain embodiments, the second antibody that specifically binds to CD7 is a second single-chain variable fragment (scFv).

[0027] In some embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2. In other embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 15. In certain embodiments, the first single-chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 17.

[0028] In some embodiments, the localization domain comprises an amino acid sequence selected from the group consisting of an endoplasmic reticulum (ER) retention sequence, a Golgi apparatus retention sequence, a proteasome localization sequence, and a transmembrane domain sequence derived from CD8α, CD8β, 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, or FGFR2B. In some embodiments, the localization domain comprises an endoplasmic reticulum (ER) retention sequence comprising the amino acid sequence of SEQ ID NO:8 or SEQ ID NO:9. In other embodiments, the localization domain comprises a transmembrane domain sequence derived from a CD8α hinge and transmembrane domain sequence comprising the amino acid sequence of SEQ ID NO:13.

[0029] In some embodiments, the 4-1BB intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:3 and the CD3ζ intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:4.

[0030] In some embodiments, the hinge and transmembrane domains comprise the amino acid sequence of SEQ ID NO:10.

[0031] In some embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2. In other embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 15. In yet other embodiments, the second single chain variable fragment (scFv) comprises a heavy chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16 and a light chain variable domain having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 17.

[0032] In some embodiments, the engineered cells are engineered T cells, engineered natural killer (NK) cells, engineered NK / T cells, engineered monocytes, engineered macrophages, or engineered dendritic cells.

[0033] In some embodiments, the engineered immune cells are administered to the subject (e.g., patient) by intravenous infusion, intra-arterial infusion, intraperitoneal infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, or intrathecal administration.

[0034] In some embodiments, the cancer is a T-cell malignancy. In one embodiment, the T-cell malignancy is early T-cell precursor acute lymphoblastic leukemia (ETP-ALL).

[0035] The present disclosure provides genetically engineered immune cells and their use methods for treating T-cell hematological malignancies.Those skilled in the art will recognize that when CAR-T effector cells are used to treat T-cell leukemia, auto-killing or allo-killing of CAR T cells and killing of normal T cells may occur.Therefore, there is a need for genetically engineered immune cells and treatment methods that minimize or eliminate T-cell allo-killing.

[0036] The genetically engineered immune cells and therapeutic methods described herein utilize genetically engineered anti-CD7 PEBL cells and novel cognate killing-resistant CAR-T cells, such as anti-CD7 CAR-T cells. The genetically engineered immune cells can elicit potent and sustained therapeutic effects in patients with T-cell malignancies, including recurrent T-cell malignancies. Such cells can efficiently target and kill malignant T cells without significant effector T-cell cognate killing. [Brief explanation of the drawings]

[0037] [Figure 1]Figures 1A-1D illustrate CD7 expression in T-ALL. The percentage of ALL cells expressing CD7 at diagnosis, relapse, and during chemotherapy (MRD) indicates the number of bone marrow samples tested at each stage (Figure 1A). CD7 mean fluorescence intensity (MFI) in T-ALL cells and residual normal T cells from the same samples (n = 19, P < 0.0001 by paired t-test) (Figure 1B). CD7 MFI in T-ALL cells at diagnosis or relapse ("D / R") and follow-up bone marrow samples with MRD (n = 18) (Figure 1C). Flow cytometry contour plots show CD7 expression in T-ALL cells (CD3-negative) and normal T cells (CD3-positive) at diagnosis, MRD, and relapse in a representative patient (Figure 1D). [Figure 2]Figures 2A-2E. Anti-CD7 CAR design, expression, and signaling. Schematic diagram of the anti-CD7-41BB-CD3ζ construct (Figure 2A). Flow cytometry analysis of Jurkat cells transduced with either GFP alone ("Mock") or GFP plus anti-CD7 CAR. Dot plots show GFP fluorescence and CAR expression after staining with biotin-conjugated goat anti-mouse F(ab')2 antibody and streptavidin-APC (Jackson ImmunoResearch) (Figure 2B). Western blot analysis of CAR expression in Jurkat cells (Figure 2C). Cell lysates from mck- and CAR-transduced Jurkat cells were separated on a 10% polyacrylamide gel under reducing or non-reducing conditions. Blotted membranes were probed with mouse anti-human CD3ζ antibody (8D3, ​​BD Biosciences) and goat anti-mouse IgG conjugated to horseradish peroxidase (R&D Systems). Antibody binding was revealed using Clarity Western EC substrate (Bio-Rad). Anti-CD7 CAR induces expression of activation markers upon ligation. Bars indicate the mean (±SD) CD25 and CD69 MFI in CAR-transduced and mock-transduced Jurkat cells after 24 h in the presence or absence of CD7+ MOLT-4 cells. P values ​​by t-test are indicated for significant differences (*=0.016, ***<0.001) (Figure 2D). Figure 2E presents a representative flow cytometry histogram of the experiment shown in Figure 2D. [Figure 3-1]Figures 3A-3I show that expression of an anti-CD7 CAR in human peripheral blood T cells results in cognate killing that is prevented by CD7 downregulation. Percentage of viable T cells recovered 24 hours after electroporation in the presence or absence of anti-CD7 CAR mRNA (n=7) (Figure 3A). Viable cells were counted by flow cytometry. Percentage of viable T cells recovered 24 hours after retroviral vector CAR transduction compared to cells from the same donor transduced with GFP alone ("Mock") (n=10) (Figure 3B). Percentage of viable CAR-transduced or mock-transduced T cells recovered during the week after transduction (Figure 3C). Follow-up results for five of the ten experiments shown in Figure 3B are shown. Percentage of CD107a in T cells after electroporation in the presence or absence of anti-CD7 CAR mRNA (Figure 3D). Means (±SD) of triplicate determinations are shown. Schematic diagram of anti-CD7 protein expression blocker (PEBL) constructs (Figure 3E). Representative flow cytometry histograms show CD7 expression in T lymphocytes after retroviral transduction of three anti-CD7 PEBL constructs or mock-transduced GFP alone ("Mock") (Figure 3F). [Figure 3-2]T cells were stained with anti-CD7-PE (M-T701; BD Biosciences). Percentage of CD7 expression in anti-CD7 PEBL-1 retrovirally transduced or mock-transduced T cells (n = 5) (Figure 3G). Flow cytometry dot plots show downregulation of CD7 expression in T cells by PEBL transduction, along with expression of anti-CD7-41BB-CD3ζ CAR 12 hours after electroporation in the presence or absence of CAR mRNA (Figure 3H). Cells were stained with biotin-conjugated goat anti-mouse F(ab')2 antibody and streptavidin-APC (Jackson ImmunoResearch). Percentage of viable anti-CD7 PEBL-transduced T cells recovered 24 hours after electroporation of anti-CD7 CAR mRNA compared with cells transduced with vector electroporated with anti-CD7 CAR mRNA but without anti-CD7 PEBL (n = 6) (Figure 3I). The number of viable cells was measured by flow cytometry. **, P<0.01. ***, P<0.001. [Figure 4-1] Figures 4A-4F show that CD7 downregulation by PEBL did not alter T cell phenotype, proliferation, and functionality. Percentages of CD4 and CD8 cells 7-14 days after retroviral transduction with either anti-CD7 PEBL or GFP alone ("Mock") (Figure 4A). Each symbol corresponds to a different T cell donor. The proliferation rates of PEBL-transduced and mock-transduced T cells (from three donors) were maintained for 14 days with 200 IU / mL of IL-2 (Figure 4B). Symbols represent the mean (±SD) of triplicate measurements. PEBL-transduced and mock-transduced T cells were electroporated either in the presence or absence of anti-CD19-41BB-CD3ζ CAR mRNA (Figure 4C). Flow cytometry dot plots show GFP and CAR expression 12 hours after electroporation. CAR was detected using biotin-conjugated goat anti-mouse F(ab')2 antibody and streptavidin-APC (Jackson ImmunoResearch). [Figure 4-2]Cytotoxicity of PEBL- or mock-transduced T cells electroporated in the presence or absence of anti-CD19 CAR mRNA against CD19+ ALL cells (OP-1) (Figure 4D). Bars represent the mean (±SD) of cytotoxicity at 4 hours in 1:1 E:T. Figure 4E shows CD107a expression in T cells from the same experiment as described in Figure 4D. Figure 4F shows IFNγ production in PEBL- or mock-transduced T cells electroporated in the presence or absence of anti-CD19 CAR mRNA and cocultured with OP-1 in 1:1 E:T for 6 hours. Bars represent the mean (±SD) of triplicate experiments. ***, P<0.001. ****, P<0.0001. [Figure 5-1]Figures 5A-5F show that after expression of an anti-CD7 CAR, T cells with CD7 downregulated by PEBL acquire potent cytotoxicity against CD7+ leukemia cells. Cytotoxicity of anti-CD7 PEBL-transduced T cells electroporated in the presence or absence of anti-CD7 CAR mRNA against CD7+ cell lines (Figure 5A). Data from a 4-hour assay at 1:1 E:T is shown. Symbols represent the mean of triplicate measurements using T cells from four donors for MOLT-4, CCRF-CEM, and Jurkat, and five donors for Loucy and KG1a (P<0.001 for each comparison). Cytotoxicity of anti-CD7 PEBL-transduced T cells electroporated in the presence or absence of anti-CD7 CAR mRNA against primary leukemia cells from a T-ALL patient (Figure 5B). Data from a 4-hour assay at the indicated E:T is shown. Symbols represent the mean (±SD) of triplicate measurements. Figure 5C shows the overall specific cytotoxicity of T cells transduced with either anti-CD7 PEBL or GFP alone ("Mock") against five CD7+ cell lines after electroporation with anti-CD7 CAR mRNA. T cells from three donors were tested in a 4-hour assay at 1:1 E:T. Each symbol represents the specific percent cytotoxicity against a CD7+ cell line after subtraction of the percent cytotoxicity obtained with the same T cells electroporated in the absence of mRNA. Horizontal bars indicate the median value for each group. Anti-CD7 PEBL-transduced or mock-transduced T cells from three donors were electroporated in the presence or absence of anti-CD7 CAR mRNA (Figure 5D). Cytotoxicity against MOLT-4 cells was tested in a 4-hour assay at 1:1 E:T. The mean fluorescence intensity (MFI) of anti-CD107a-PE (H4A3, BD Biosciences) is shown. Bars represent the mean (±SD) of three experiments. [Figure 5-2]Anti-CD7 PEBL-transduced T cells were retrovirally transduced with either anti-CD7 CAR or mock transduced and tested against primary leukemia cells from T-ALL patients (Figure 5E). Each symbol represents the mean (±SD) of triplicate experiments. Mock-transduced or PEBL-transduced T cells, sequentially transduced with or without anti-CD7 CAR, were cultured alone or in the presence of Streck-treated MOLT-4 cells, with weekly addition of 120 IU / mL IL-2 (Figure 5F). Symbols represent the mean (±SD) of cell recovery relative to input cell number in triplicate cultures. **, P<0.01; ***, P<0.001; ****, P<0.0001. [Figure 6] Figures 6A-6D show that PEBL-transduced T cells expressing the anti-CD7-41BB-CD3ζ CAR exert antitumor activity in xenografts. NOD-SCID-IL2RG mice were intravenously (i.v.) injected with 1 x 10 CCRF-CEM cells labeled with luciferase. 2 x 10 PEBL-CAR T cells were administered intravenously to three and five mice on days 7 (Figure 6A) or 3 and 7 (Figure 6B) after leukemia cell injection. The remaining mice received either mock-transduced T cells or RPMI-1640 ("control") instead of cells. All mice received 20,000 IU of IL-2 intraperitoneally (i.p.) every other day. In vivo imaging of leukemia cell proliferation after i.p. injection of D-luciferin is shown. Abdominal images of mice on day 3 in Figure 6B are shown at increased sensitivity to demonstrate CCRF-CEM engraftment in all mice. The complete set of luminescence images is shown in Figure 14. Figure 6C shows leukemic cell proliferation, expressed as photons per second, in the mice shown in Figures 6A and 6B. Each symbol corresponds to the bioluminescence measurement in each mouse, normalized to the average ventral plus dorsal signal in all mice before CAR-T cell infusion. Kaplan-Meier curves show the overall survival rate of mice in different groups (8 mice in each group) (Figure 6D). Mice were euthanized when the total bioluminescence signal reached 1 x 10 photons per second. P values ​​calculated by the log-rank test. [Figure 7-1] Figures 7A-7E show PEBL-CAR-T cell activity against ETP-ALL in a patient-derived xenograft (PDX) model. Primary ETP-ALL cells, pre-expanded in NOD-SCID-IL2RG mice, were intravenously (iv) injected into 10 NOD-SCID-IL2RG mice at 2 x 10 cells per mouse (Figure 7A). Five mice ("control") were left untreated. The remaining five mice received a single intravenous infusion of PEBL-CAR T cells (2 x 10 cells for PEBL-CAR#1 and 2 x 10 cells for the remaining four mice) at the indicated time points (gray arrows) and 20,000 IU of IL-2 every two days; two of the five control mice also received IL-2. Black symbols (left y-axis) indicate the number of ETP-ALL cells / mL counted in peripheral blood. Gray symbols (right y-axis) indicate the number of PEBL-CAR T cells. Mice were euthanized when the percentage of ETP-ALL cells in blood mononuclear cells reached ≥80%. Figure 7B shows the percentage of ETP-ALL (denominator, total human + mouse CD45+ cells) in various organs of five untreated mice. Blood smears of treated (PEBL-CAR#1) and untreated ETP-ALL mice 7 days after T cell infusion. Stain cells were prominent in the blood after PEBL-CAR T cell infusion (Figure 7C). [Figure 7-2] Flow cytometry dot plots show the presence of CD7+ CD3- ETP-ALL cells in tissues of untreated control mice with ETP-ALL and the presence of CD7- CD3+ PEBL-CAR T cells in PEBL-CAR#1 mice treated with PEBL-CAR-T cells (Figure 7D). No ETP-ALL (<0.01%) was detected in treated mice. The events shown were normalized to those obtained for the corresponding plots shown for control mice. Spleens of treated (PEBL-CAR#1) and untreated mice (Figure 7E). [Figure 8]Figures 8A-8C show the specificity and function of the anti-CD7-41BB-CD3ζ CAR. OP-1 (CD7-) and MOLT-4 (CD7+) cells were incubated with supernatants collected from Jurkat cells transduced with anti-CD7 scFv or with a vector containing GFP alone ("control") (Figure 8A). After washing, the cells were incubated with a biotin-conjugated goat anti-mouse F(ab')2 antibody followed by streptavidin-APC (Jackson ImmunoResearch). Flow cytometry histograms show binding of anti-CD7 scFv to MOLT-4 but not to OP-1. Jurkat cells were transduced with a vector containing anti-CD7-41BB-CD3ζ CAR, anti-CD19-41BB-CD3ζ CAR, or GFP alone (Figure 8B). These cells were co-cultured with CD7+ MOLT-4 or CCRF-CEM cells, or CD7- cells OP-1 in a 1:1 E:T ratio. Target cells were labeled with calcein red-orange AM (Invitrogen). After 30 minutes of incubation, the percentage of cell doublets was measured by flow cytometry. Bars represent the mean (±SD) of triplicate determinations. Figure 8C shows that preincubating target cells with a soluble form of anti-CD7 scFv inhibits CAR-mediated cell aggregation. *** P<0.001. [Figure 9]Figures 9A-9B show the expression of anti-CD7-41BB-CD3ζ CAR in human peripheral blood T lymphocytes. Figure 9A presents representative flow cytometry dot plots of T lymphocytes activated with Dynabeads Human T Activator CD3 / CD28 (ThermoFisher Scientific) and IL-2 for 7 days and transduced with anti-CD7 CAR. The flow cytometry dot plots show GFP fluorescence and CAR expression, the latter revealed by staining with biotin-conjugated goat anti-mouse F(ab')2 antibody followed by streptavidin-APC (Jackson ImmunoResearch). Figure 9B shows Western blot analysis of CAR expression. Cell lysates of mock-transduced and CAR-transduced T cells were separated on a 10% polyacrylamide gel under reducing or non-reducing conditions. Blotted membranes were probed with mouse anti-human CD3ζ antibody (8D3; BD Biosciences) followed by goat anti-mouse IgG conjugated to horseradish peroxidase (R&D Systems). Antibody binding was revealed using Clarity Western EC substrate (Bio-Rad). [Figure 10]Figures 10A-10B show downregulation of CD7 protein expression by anti-CD7 PEBL. Flow cytometry dot plots show GFP expression (x-axis), CD7 expression (y-axis, top row), and intracellular anti-CD7 PEBL-1 expression (y-axis, bottom row) (Figure 10A). T lymphocytes were retrovirally transduced with vectors containing anti-CD7 PEBL-1 or GFP alone ("Mock"). T cells were stained with a phycoerythrin-conjugated anti-CD7 antibody (M-T701, BD Biosciences). Intracellular expression of PEBL-1 was examined using a PE-conjugated anti-Myc antibody (9B11; Cell Signaling Technology) that binds to the sequence EQKLISEEDL (SEQ ID NO: 40) incorporated into an ER-binding motif. Prior to antibody labeling, cells were permeabilized with 8E reagent (a permeabilization reagent developed in the applicant's laboratory). Figure 10B shows RT-PCR analysis of CD7 mRNA expression. cDNA derived from total mRNA extracted from Jurkat cells transduced with PEBL1-3, GFP alone ("mock"), or untransduced ("WT") was used as a template. CD7 cDNA (723 bp) was amplified using the following primers: forward, ATGGCCGGGCCTCCCG (SEQ ID NO: 38), reverse, TCACTGGTACTGGTTGGG (SEQ ID NO: 39). Electrophoresis was performed on a 1% agarose gel using SYBR Safe Gel Stain (ThermoFisher). Template controls are also not shown. As a control, an 87-bp region (nucleotides 676 to 762) of glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was amplified in parallel. [Figure 11]Figures 11A-11B show that anti-CD7 CAR signaling induced higher cytokine secretion in T cells with CD7 knockdown expression by anti-CD7 PEBL. T lymphocytes from three donors were transduced with anti-CD7 PEBL or GFP alone ("Mock") and electroporated in the presence or absence of anti-CD7-41BB-CD3ζ mRNA. Expression of intracellular IFNγ (Figure 11A) and TNFα (Figure 11B) was measured in T cells after 6 hours of coculture with MOLT4 cells. Bars represent the mean (±SD) of triplicate MFI measurements. **, P<0.01. ***, P<0.001. ****, P<0.0001. [Figure 12]

[0023] Figure 1 shows that CD7-negative T cells expressing the anti-CD7-41BB-CD3ζ CAR exerted anti-tumor cytotoxicity against CD7+ cell lines. Results are shown for a 4-hour cytotoxicity assay performed with T cells transduced with anti-CD7 PEBL and then transduced with either CD7-41BB-CD3ζ or GFP alone ("Mock"). Symbols represent the mean (±SD) of three experiments at the indicated E:T ratio. P<0.001 for all comparisons. [Figure 13-1]Figures 13A-13E show functional comparison of anti-CD7-41BB-CD3ζ and anti-CD19-41BB-CD3ζ CARs. Figure 13A shows expression of anti-CD19 and anti-CD7 CARs (in an mCherry-containing vector) in peripheral blood T cells previously transduced with anti-CD7 PEBL. Flow cytometry dot plots show mCherry expression and staining of T cells with biotin-conjugated goat anti-mouse F(ab')2 antibody followed by streptavidin conjugated to allophycocyanin (Jackson ImmunoResearch). Results using T cells transduced with a vector containing mCherry alone ("Mock") are also shown. CD19 expression in CCRF-CEM and Jurkat cells transduced with a vector containing CD19 and GFP (Figure 13B). CD19 was detected with anti-CD19 APC (Miltenyi Biotech). Four-hour cytotoxicity assay targeting CD19+ CCRF-CEM or CD19+ Jurkat cells with anti-CD19 or anti-CD7 PEBL-CAR-T cells at different E:T ratios (Figure 13C). Symbols represent the mean (±SD) of triplicate determinations. P<0.001 for data using either CAR versus mock-transduced T cells at all E:T ratios. [Figure 13-2]Long-term cytotoxicity of anti-CD19 or anti-CD7 PEBL-CAR-T cells at different E:T ratios was measured by live-cell imaging analysis using the IncuCyte Zoom System (Essen Bioscience) (Figure 13D). Symbols represent the mean (±SD) of triplicate measurements of CD19+ CCRF-CEM (top) or CD19+ Jurkat cells (bottom) in wells containing CAR-T cells, mock-transduced T cells, or no T cells. Measurements were performed at 4-hour intervals. Proliferative potential of anti-CD19 and anti-CD7 PEBL-CAR-T cells with or without coculture with CD19+ Jurkat cells (Figure 13E). Anti-CD7 PEBL-transduced T cells sequentially transduced with anti-CD19 or anti-CD7 CAR or mCherry alone were cultured alone or in the presence of irradiated CD19+ Jurkat cells and supplemented weekly with 120 IU / mL of IL-2. Symbols represent the mean (±SD) percentage of cell recovery relative to input cell number for triplicate cultures. [Figure 14-1] Figures 14A-14C show that PEBL-transduced T cells expressing the anti-CD7-41BB-CD3ζ CAR exerted anti-tumor activity in a mouse model. NOD-SCID-IL2RG mice were intravenously injected with 1 × 10 CCRF-CEM cells labeled with luciferase. 2 × 10 PEBL-CAR T cells were administered intravenously to three and five mice, respectively, on days 7 (Figure 14A) or 3 and 7 (Figure 14B) after leukemia cell injection. The remaining mice received either mock-transduced T cells or RPMI-1640 ("control") instead of cells. All mice received 20,000 IU of IL-2 intraperitoneally (ip) every other day. In vivo imaging of leukemia cell proliferation was performed after intraperitoneal injection of D-luciferin. Abdominal images of mice on day 3 in Figure 14B are shown with increased sensitivity to demonstrate leukemic cell engraftment in all mice. [Figure 14-2]Leukemia cell proliferation was expressed as photons per second over time, normalized to the mean sum of the ventral and dorsal signals in all mice before CAR-T cell infusion (FIG. 14C). Each symbol corresponds to a bioluminescence measurement for each mouse. [Figure 15] Figures 15A-15B show that PEBL-transduced T cells expressing the anti-CD7-41BBCD3ζ CAR exerted antitumor activity in a mouse model and maintained activity against cells harvested at relapse. Figure 15A shows the percentage of CCRF-CEM cells among leukocytes in the blood from NOD-SCID-IL2RG null mice intravenously injected with luciferase-labeled CCRF-CEM cells and then treated intravenously with either PEBL-CAR-transduced T cells, mock-transduced T cells, or RPMI-1640 ("control") instead of cells, as described for Figure 6C. For "control" and "mock" mice, blood was obtained from euthanized mice that reached a bioluminescence threshold of 10 photons / second 17-23 days after leukemia cell injection. For PEBL-CAR mice, blood was obtained via cheek puncture 24 days after CCRF-CEM injection. CCRF-CEM cells harvested from the spleen and liver of PEBL-CAR-treated mice at the time of relapse were cultured for 2 days (Figure 15B). They were then used as targets in a 4-hour cytotoxicity assay in an E:T 1:1 ratio using the PEBL-CAR-transduced or mock-transduced T cells originally used for infusion. Comparisons were also made with the same batch of CCRF-CEM-expressing luciferase cells used to generate the xenografts. Percent cytotoxicity was determined from plate readings of bioluminescent signal after addition of the BrightGlo luciferase assay system (Promega). Bars represent the mean (±SD) of triplicate measurements; each white and gray bar corresponds to cells from a single mouse. [Figure 16]Figure 7 shows the immunophenotypic characteristics of ETP-ALL at diagnosis and after expansion in NOD-SCID-IL2RG null mice. Flow cytometry contour plots show the immunophenotypic bone marrow sample of ETP-ALL used to develop the PDX models in this study and of ETP-ALL cells recovered from the spleen of one of the control mice shown in Figure 7. The following antibodies were used: CD7-PE, CD45-APC-H7, CD34-PerCP, CD8-BV510, CD5-PE-Cy7, CD3-PerCP (for cytoplasmic staining), CD3-V450 (for surface staining), CD33-BV421 (Biolegend), and CD1a-PE (Beckman Coulter), all from BD Biosciences. Quadrants were delineated based on staining with isotype-matched, non-reactive antibodies conjugated to the same fluorochrome. [Figure 17] 1 is a schematic diagram of an exemplary embodiment of the present invention; DETAILED DESCRIPTION OF THE INVENTION

[0038] A description of an exemplary embodiment of the present invention follows.

[0039] The present invention is based, in part, on the design of a chimeric antigen receptor (CAR) for CD7, a 40 kDa type I transmembrane glycoprotein that is a primary marker of T-cell malignancies and is highly expressed in all cases of T-cell ALL, including early T-cell precursor acute lymphoblastic leukemia (ETP-ALL). As described herein, anti-CD7 CARs induce T cells to exert specific cytotoxicity against T-cell malignancies. Furthermore, when anti-CD7 CARs are used in combination with downregulation of CD7 expression on effector T cells, T cell cytotoxicity has been shown to be significantly increased. As demonstrated herein, downregulation (e.g., removal, reduction, and / or relocalization) of CD7 prevents the cognate killing effect exerted by the corresponding anti-CD7 CAR, resulting in greater T cell recovery after CAR expression and more effective cytotoxicity against T leukemia / lymphoma cells compared to cells that retain the target antigen (e.g., CD7).

[0040] Thus, in one aspect, the present invention relates to a genetically engineered immune cell comprising a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), the CAR comprising the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that specifically binds to cluster of differentiation 7 (CD7). The CAR of the present invention may be referred to herein as "anti-CD7-41BB-CD3ζ." An exemplary embodiment is shown in Figure 17.

[0041] As used herein, "genetically engineered" immune cells include immune cells that are genetically modified compared to naturally occurring immune cells. For example, genetically engineered T cells produced according to the methods of the present invention harbor a nucleic acid comprising a nucleotide sequence that does not naturally occur in the T cell from which the nucleotide sequence is derived.

[0042] In certain embodiments, the genetically engineered immune cells are genetically engineered T cells, genetically engineered natural killer (NK) cells, genetically engineered NK / T cells, genetically engineered monocytes, genetically engineered macrophages, or genetically engineered dendritic cells. In certain embodiments, the genetically engineered immune cells are genetically engineered T cells. As used herein, the term "nucleic acid" refers to a polymer comprising multiple nucleotide monomers (e.g., ribonucleotide monomers or deoxyribonucleotide monomers). "Nucleic acid" includes, for example, genomic DNA, cDNA, RNA, and DNA-RNA hybrid molecules. Nucleic acid molecules can be naturally occurring, recombinant, or synthetic. Furthermore, nucleic acid molecules can be single-stranded, double-stranded, or triple-stranded. In certain embodiments, nucleic acid molecules can be modified. In the case of a double-stranded polymer, "nucleic acid" can refer to either or both strands of the molecule.

[0043] The term "nucleotide sequence," with respect to nucleic acids, refers to a contiguous series of nucleotides linked by covalent bonds, such as phosphorus bonds (e.g., phosphodiester, alkyl and aryl phosphonate, phosphorothioate, phosphotriester bonds) and / or non-phosphorus bonds (e.g., peptide and / or sulfamate bonds). In certain embodiments, for example, the nucleotide sequence encoding the target binding molecule linked to the localization domain is a heterologous sequence (e.g., a gene originating from a different species or cell type).

[0044] The terms "nucleotide" and "nucleotide monomer" refer to naturally occurring ribonucleotide or deoxyribonucleotide monomers, as well as their non-naturally occurring derivatives and analogs.Thus, nucleotides can include, for example, nucleotides containing naturally occurring bases (e.g., adenosine, thymidine, guanosine, cytidine, uridine, inosine, deoxyadenosine, deoxythymidine, deoxyguanosine, or deoxycytidine) and nucleotides containing modified bases known in the art.

[0045] As will be appreciated by one of skill in the art, in some embodiments, the nucleic acid further comprises a plasmid sequence, which can include, for example, one or more of a promoter sequence, a selectable marker sequence, or a gene targeting sequence.

[0046] As used herein, "antibody" refers to an intact antibody or an antigen-binding fragment of an antibody, including an intact antibody or antigen-binding fragment that is modified or genetically engineered, or is a human antibody. Examples of modified or genetically engineered antibodies are chimeric antibodies, humanized antibodies, multiparatopic antibodies (e.g., biparatopic antibodies), and multispecific antibodies (e.g., bispecific antibodies). Examples of antigen-binding fragments include Fab, Fab', F(ab'), Fv, single-chain antibodies (e.g., scFv), minibodies, and diabodies.

[0047] The terms "specifically (or selectively) bind" or "specifically (or selectively) immunoreactive," when referring to a protein or peptide, often refer to a binding reaction that determines the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under specified immunoassay conditions, a particular antibody will bind to a particular protein in an amount at least 2-fold above background, and more commonly 10- to 100-fold above background. Specific binding to an antibody under such conditions requires the antibody to be selected for its specificity for a particular protein. For example, polyclonal antibodies can be selected to obtain only those polyclonal antibodies that specifically immunoreact with a selected antigen and not with other proteins. This selection may be achieved by subtracting out antibodies that cross-react with other molecules. A variety of immunoassay formats may be used to select antibodies that are specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Using Antibodies, A Laboratory Manual (1998) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).

[0048] In certain embodiments, the antibody that binds to CD7 is a single-chain variable fragment antibody ("scFv antibody"). scFv refers to an antibody fragment containing the VH and VL domains of an antibody, where these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the scFv to form the desired structure for antigen binding. For a review of scFvs, see Pluckthun (1994) "The Pharmacology of Monoclonal Antibodies," vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315. See also International Application No. PCT / WO88 / 01649 and U.S. Patent Nos. 4,946,778 and 5,260,203. As will be appreciated by those skilled in the art, a variety of suitable linkers can be designed and tested for optimal function, as provided in the art and as disclosed herein.

[0049] In certain embodiments, the anti-CD7 scFv comprises a variable heavy chain (heavy chain variable region or VH) and a variable light chain (light chain variable region or VL) having amino acid sequences having at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH and VL sequences set forth in SEQ ID NO:1 and SEQ ID NO:2, respectively. The heavy chain variable region may comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH sequence of SEQ ID NO: 1. The light chain variable region may comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VL sequence of SEQ ID NO:2. In some cases, the heavy chain variable region comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid substitution in the sequence set forth in SEQ ID NO: 1. In particular cases, the heavy chain variable region comprises 10 or fewer amino acid (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) substitutions in the sequence set forth in SEQ ID NO: 1. In some cases, the light chain variable region comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid substitution in the sequence set forth in SEQ ID NO: 2. In particular cases, the light chain variable region comprises 10 or fewer amino acid (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) substitutions in the sequence set forth in SEQ ID NO: 2.In some embodiments, the nucleic acid sequence encoding the VH comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 23. In other embodiments, the nucleic acid sequence encoding the VL comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 24.

[0050] In certain embodiments, the anti-CD7 scFv comprises a variable heavy chain (heavy chain variable region or VH) and a variable light chain (light chain variable region or VL) having sequences having at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH and VL sequences set forth in SEQ ID NO: 14 and SEQ ID NO: 15, respectively. The heavy chain variable region may comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH sequence of SEQ ID NO: 14. The light chain variable region may comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VL sequence of SEQ ID NO: 15.

[0051] In some cases, the heavy chain variable region comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid substitution in the sequence set forth in SEQ ID NO: 14. In certain cases, the heavy chain variable region comprises 10 or fewer amino acid (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10) substitutions in the sequence set forth in SEQ ID NO: 14. In some cases, the light chain variable region comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or more) amino acid substitution in the sequence set forth in SEQ ID NO: 15. In certain cases, the heavy chain variable region comprises 10 or fewer amino acid (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10) substitutions in the sequence set forth in SEQ ID NO: 15.

[0052] In some embodiments, the nucleic acid sequence encoding the VH comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 25. In other embodiments, the nucleic acid sequence encoding the VL comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 26.

[0053] In certain embodiments, the anti-CD7 scFv comprises a variable heavy chain (heavy chain variable region or VH) and a variable light chain (light chain variable region or VL) having sequences having at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH and VL sequences set forth in SEQ ID NO: 16 and SEQ ID NO: 17, respectively. The heavy chain variable region may comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH sequence of SEQ ID NO: 16. The light chain variable region may comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VL sequence of SEQ ID NO: 17.

[0054] In some cases, the heavy chain variable region comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid substitution in the sequence set forth in SEQ ID NO: 16. In particular cases, the heavy chain variable region comprises 13 or fewer amino acid (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13) substitutions in the sequence set forth in SEQ ID NO: 16. In some cases, the light chain variable region comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid substitution in the sequence set forth in SEQ ID NO: 17. In particular cases, the heavy chain variable region comprises 5 or fewer amino acid (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11) substitutions in the sequence set forth in SEQ ID NO: 17. In some embodiments, the nucleic acid sequence encoding the VH comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the nucleic acid sequence set forth in SEQ ID NO:27. In other embodiments, the nucleic acid sequence encoding the VL comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the nucleic acid sequence set forth in SEQ ID NO:28.

[0055] In some embodiments, an scFv of the invention comprises a variable heavy chain sequence having at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the variable heavy chain sequence of an anti-CD7 antibody. In some embodiments, the scFv of the invention comprises a variable light chain sequence that has at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the variable light chain sequence of an anti-CD7 antibody. For example, the anti-CD7 antibody can be any such antibody recognized by those of skill in the art.

[0056] [Table 1]

[0057] [Table 2-1] [Table 2-2] [Table 2-3]

[0058] The term "sequence identity" means that two nucleotide sequences or two amino acid sequences share at least 70% sequence identity, or at least 80% sequence identity, or at least 85% sequence identity, or at least 90% sequence identity, or at least 95% or more sequence identity when optimally aligned, such as by a program using default gap weights, such as GAP or BESTFIT. For sequence comparison, generally, one sequence serves as a reference sequence (e.g., parent sequence), and a test sequence is compared to the reference sequence. When using a sequence comparison algorithm, the test sequence and the reference sequence are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity of the test sequence(s) relative to the reference sequence based on the designated program parameters.

[0059] Optimal alignment of sequences for comparison can be achieved, for example, by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, 575 Science Dr., Madison, Wis.)), or by visual inspection (see generally Ausubel et al., Current Protocols in Molecular Biology). An example of a suitable algorithm for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (publicly accessible through the National Institutes of Health NCBI Internet server). Generally, sequence comparisons can be performed using default program parameters, although customized parameters can also be used. For amino acid sequences, the BLASTP program uses as default a word length (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).

[0060] As will be understood by one of skill in the art, in certain embodiments, the sequence of any of the various components disclosed herein (e.g., scFv, intracellular signaling domain, hinge, linker, localization sequence, and combinations thereof) can have at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the specific corresponding sequence disclosed herein. For example, in certain embodiments, the intracellular signaling domain 4-1BB can have at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to SEQ ID NO: 3, so long as it has the desired function. In certain embodiments, the intracellular signaling domain of 4-1BB comprises the sequence set forth in SEQ ID NO: 3 (KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL).

[0061] As another example, in certain embodiments, the intracellular signaling domain 4-1BB can be replaced with another intracellular signaling domain from a costimulatory molecule such as CD28, OX40, ICOS, CD27, GITR, HVEM, TIM1, LAF1, or CD2. In some embodiments, the intracellular signaling domain of the CAR can have at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the intracellular signaling domain of CD28, OX40, ICOS, CD27, GITR, HVEM, TIM1, LAF1, or CD2.

[0062] As another example, in certain cases, the intracellular signaling domain of 4-1BB can also include another intracellular signaling domain (or a portion thereof) from a costimulatory molecule such as CD28, OX40, ICOS, CD27, GITR, HVEM, TIM1, LAF1, or CD2. In some embodiments, the additional intracellular signaling domain can have at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the intracellular signaling domain of CD28, OX40, ICOS, CD27, GITR, HVEM, TIM1, LAF1, or CD2. In other embodiments, the additional intracellular signaling domain comprises at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to an intracellular signaling domain fragment(s) of CD28, OX40, ICOS, CD27, GITR, HVEM, TIM1, LAF1, or CD2.

[0063] As another example, in certain embodiments, the intracellular signaling domain of CD3ζ can have at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to SEQ ID NO: 4, so long as it has the desired function. In certain embodiments, the intracellular signaling domain of CD3ζ comprises the sequence set forth in SEQ ID NO: 4 (RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR).

[0064] In some cases, the intracellular signaling domain comprises an immunoreceptor tyrosine-based activation motif (ITAM) or a portion thereof, so long as it has the desired function. The intracellular signaling domain of a CAR can comprise at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the ITAM. In certain embodiments, the intracellular signaling domain can have at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to FcεRIγ, CD4, CD7, CD8, CD28, OX40, or H2-Kb, so long as it has the desired function.

[0065] In certain embodiments, the anti-CD7 CAR further comprises a hinge and a transmembrane sequence. Hinge and transmembrane sequences suitable for use in the present invention are known in the art and are provided, for example, in International Publication No. 2016 / 126213, the entire contents of which are incorporated herein by reference. In certain embodiments, the hinge sequence comprises the sequence set forth in SEQ ID NO: 5 (TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD). In certain embodiments, the transmembrane sequence comprises the sequence set forth in SEQ ID NO: 6 (IYIWAPLAGTCGVLLLSLVITLYC). In some embodiments, the hinge and transmembrane domain of the anti-CD7 CAR can comprise a signaling domain (e.g., a transmembrane domain) from 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, FGFR2B, or other transmembrane proteins.

[0066] In certain embodiments, the anti-CD7 CAR further comprises a CD8α signal peptide (MALPVTALLLPLLLHLAARP, SEQ ID NO: 7). A schematic diagram of an anti-CD7 CAR, including embodiments described herein, is shown in Figure 17.

[0067] In certain embodiments of the present invention, the chimeric antigen receptor (CAR) is capable of binding to molecules expressed on the surface of cells, including, but not limited to, members of the CD1 family of glycoproteins, CD2, CD3, CD4, CD5, CD7, CD8, CD25, CD28, CD30, CD38, CD45, CD45RA, CD45RO, CD52, CD56, CD57, CD99, CD127, and CD137.

[0068] As described herein, when an anti-CD7 CAR is used in combination with downregulation of CD7 expression on effector T cells, it has been shown that the cytotoxicity of T cells is significantly increased. As demonstrated herein, downregulation (e.g., removal, reduction, and / or relocalization) of CD7 prevents the cognate killing effect exerted by the corresponding anti-CD7 CAR, resulting in greater T cell recovery after CAR expression compared to cells that retain the target antigen (e.g., CD7), and more effective cytotoxicity against T leukemia / lymphoma cells. As will be understood by those skilled in the art, downregulation of CD7 expression on effector T cells can be achieved according to various known methods, including, for example, "intrabodies" against CD7 (as described in WO 2016 / 126213), RNAi against CD7, or gene editing methods such as meganucleases, TALENs, CRISPR / Cas9, and zinc finger nucleases.

[0069] In certain embodiments, the genetically engineered immune cells further comprise a nucleic acid comprising a nucleotide sequence encoding a target-binding molecule linked to a localization domain. A "target-binding molecule linked to a localization domain" is sometimes referred to herein as a protein expression blocker (PEBL), or in some cases, as an "intrabody," as described in International Publication No. WO 2016 / 126213, the teachings of which are incorporated by reference in their entirety. Exemplary embodiments of PEBLs are shown in Figures 3E and 17.

[0070] As used herein, "linked" in the context of protein expression blockers refers to a gene encoding a target binding molecule that is directly adjacent to and in frame with one or more genes encoding one or more localization domains (e.g., without a linker). Alternatively, the gene encoding the target binding molecule may be connected to one or more genes encoding one or more localization domains via a linker sequence, as described, for example, in WO 2016 / 126213. As will be understood by those skilled in the art, such linker sequences and variants of such linker sequences are known in the art. Methods for designing constructs incorporating linker sequences and methods for evaluating functionality are readily available to those skilled in the art.

[0071] In certain embodiments, the target binding molecule is an antibody that binds to CD7. In certain embodiments, the antibody is an scFv. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 1 and the VL sequence set forth in SEQ ID NO: 2. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 14 and the VL sequence set forth in SEQ ID NO: 15. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 16 and the VL sequence set forth in SEQ ID NO: 17. As described herein, in certain embodiments, the scFv comprises a VH and a VL that have at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH and VL sequences set forth in SEQ ID NO:1 and SEQ ID NO:2, respectively, SEQ ID NO:14 and SEQ ID NO:15, respectively, or SEQ ID NO:16 and SEQ ID NO:17, respectively.

[0072] In some embodiments, the anti-CD7 protein expression blocker is made using the nucleic acid sequence of SEQ ID NO: 23 encoding the immunoglobulin heavy chain variable region of the anti-CD7 scFv and the nucleic acid sequence of SEQ ID NO: 24 encoding the immunoglobulin light chain variable region of the anti-CD7 scFv. In other embodiments, the anti-CD7 protein expression blocker is made using the nucleic acid sequence of SEQ ID NO: 25 encoding the immunoglobulin heavy chain variable region of the anti-CD7 scFv and the nucleic acid sequence of SEQ ID NO: 26 encoding the immunoglobulin light chain variable region of the anti-CD7 scFv. In a specific embodiment, the anti-CD7 protein expression blocker is made using the nucleic acid sequence of SEQ ID NO: 27 encoding the immunoglobulin heavy chain variable region of the anti-CD7 scFv and the nucleic acid sequence of SEQ ID NO: 28 encoding the immunoglobulin light chain variable region of the anti-CD7 scFv.

[0073] In certain embodiments, an antibody that binds CD7 in the context of a CAR, as described herein, can be different from an antibody that binds CD7 in the context of a target binding molecule (PEBL). By way of example only, an antibody that binds CD7 in the context of a CAR can comprise the VH sequence set forth in SEQ ID NO: 1 and the VL sequence set forth in SEQ ID NO: 2, while an antibody that binds CD7 in the context of PEBL can comprise the VH sequence set forth in SEQ ID NO: 14 and the VL sequence set forth in SEQ ID NO: 15. In certain embodiments, an antibody that binds CD7 in the context of a CAR, as described herein, can be identical to an antibody that binds CD7 in the context of a target binding molecule (PEBL).

[0074] In certain embodiments, the localization domain of PEBL comprises an endoplasmic reticulum (ER) or Golgi apparatus retention sequence, a proteasome localization sequence, and a transmembrane domain sequence derived from CD8α, CD8β, 4-1BB, CD28, CD34, CD4, CD16, OX40, FcεRIγ, CD16, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, or FGFR2B. In certain embodiments, the localization domain comprises the CD8α hinge and transmembrane domain (TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIIWAPLAGTCGVLLLSLVITLY) (SEQ ID NO: 10) followed by the endoplasmic reticulum (ER) retention peptide EQKLISEEDLKDEL (SEQ ID NO: 8), (GGGGS)4AEKDEL (SEQ ID NO: 9), or KYKSRRSFIDEKKMP (SEQ ID NO: 11), as described herein. The localization domain can direct PEBL to a specific cellular compartment, such as the Golgi apparatus or endoplasmic reticulum, the proteasome, or the plasma membrane, depending on the application. ER or Golgi apparatus retention sequences include the amino acid sequence KDEL (SEQ ID NO: 18), KKXX (wherein X is any amino acid) (SEQ ID NO: 19), KXD / E (such as KXD or KXE) (wherein X is any amino acid) (SEQ ID NO: 20), or YQRL (SEQ ID NO: 21). The proteasome localization sequence may include a PEST (SEQ ID NO: 22) motif.

[0075] In some embodiments, proteasome localization is achieved by linking an scFv sequence to a tripartite motif-containing 21 (TRIM21) targeting domain sequence and coexpressing a sequence encoding the human TRIM21 E3 ubiquitin ligase protein. TRIM21 binds with high affinity to the Fc domain of antibodies and can recruit the ubiquitin-proteosome complex to degrade molecules (e.g., proteins and peptides) bound to the antibody. The TRIM21 targeting domain sequence encodes an amino acid sequence selected from the group of human immunoglobulin G (IgG) constant region (Fc) genes, such as IgG1, IgG2, or IgG4, and is used to form a fusion protein containing the scFv domain and the Fc domain. In this embodiment, the exogenously expressed TRIM21 protein binds to the scFv-Fc fusion protein bound to a target protein (e.g., CD7) and directs the complex to the proteasome for degradation.

[0076] Details of the amino acid sequence of the human TRIM21 E3 ligase protein can be found, for example, in the NCBI protein database under NCBI Ref.Seq.No.NP003132.2. Details of the nucleic acid sequence encoding the human TRIM21 E3 ligase protein can be found, for example, in the NCBI protein database under NCBI Ref.Seq.No.NM_003141.3.

[0077] In certain embodiments, the protein expression blocker is any one or more anti-CD7 PEBLs as disclosed in WO 2016 / 126213, the disclosure of which is incorporated herein by reference in its entirety for all purposes. Thus, the genetically engineered immune cells described herein can include PEBL (a target binding molecule linked to a localization domain) that binds to CD7, as described in WO 2016 / 126213. The sequences of components of anti-CD7 intrabodies are as described in Figure 2 and Tables 1 and 2 of WO 2016 / 126213. Exemplary embodiments of anti-CD7 PEBLs are illustrated in Figures 3E and 17.

[0078] [Table 3]

[0079] In some embodiments, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 1, the amino acid sequence of SEQ ID NO: 2, and a VH-VL linker. The VH-VL linker can be a (GGGGS)n linker, where n can be in the range of 1 to 6, e.g., 1, 2, 3, 4, 5, or 6. In one embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 1, the amino acid sequence of SEQ ID NO: 2, and the amino acid sequence of SEQ ID NO: 12. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 1, the amino acid sequence of SEQ ID NO: 2, and the amino acid sequence of SEQ ID NO: 12. In a specific embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 2, and the amino acid sequence of SEQ ID NO: 12. In other embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 2, and the amino acid sequence of SEQ ID NO: 12. In some cases, the anti-CD7 protein expression blocker also comprises a localization domain selected from any one of the sequences set forth in SEQ ID NO: 8, SEQ ID NO: 9, or SEQ ID NO: 13. In some cases, the anti-CD7 protein expression blocker also comprises a CD8α signal peptide, such as, but not limited to, the CD8α signal peptide set forth in SEQ ID NO: 7. In other cases, the anti-CD7 protein expression blocker also comprises a CD8α hinge and transmembrane domain, such as, but not limited to, the CD8α hinge and transmembrane domain set forth in SEQ ID NO: 10.

[0080] In some embodiments, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 14, the amino acid sequence of SEQ ID NO: 15, and a VH-VL linker. The VH-VL linker can be a (GGGGS)n linker, where n can be in the range of 1 to 6, e.g., 1, 2, 3, 4, 5, or 6. In one embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 14, the amino acid sequence of SEQ ID NO: 15, and the amino acid sequence of SEQ ID NO: 12. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 14, the amino acid sequence of SEQ ID NO: 15, and the amino acid sequence of SEQ ID NO: 12. In a specific embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 14, the amino acid sequence having at least 95% sequence identity to SEQ ID NO: 15, and the amino acid sequence of SEQ ID NO: 12. In other embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 14, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 5, and the amino acid sequence of SEQ ID NO: 12. In some cases, the anti-CD7 protein expression blocker also comprises a localization domain selected from any one of the sequences set forth in SEQ ID NO: 8, SEQ ID NO: 9, or SEQ ID NO: 13. In some cases, the anti-CD7 protein expression blocker also comprises a CD8α signal peptide, such as, but not limited to, the CD8α signal peptide set forth in SEQ ID NO: 7. In other cases, the anti-CD7 protein expression blocker also comprises a CD8α hinge and transmembrane domain, such as, but not limited to, the CD8α hinge and transmembrane domain set forth in SEQ ID NO: 10.

[0081] In some embodiments, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 16, the amino acid sequence of SEQ ID NO: 17, and a VH-VL linker. The VH-VL linker can be a (GGGGS)n linker, where n can be in the range of 1 to 5, e.g., 1, 2, 3, 4, 5, or 6 (SEQ ID NO: 29). In one embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 16, the amino acid sequence of SEQ ID NO: 17, and the amino acid sequence of SEQ ID NO: 12. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 16, the amino acid sequence of SEQ ID NO: 17, and the amino acid sequence of SEQ ID NO: 12. In a specific embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 16, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 17, and the amino acid sequence of SEQ ID NO: 12. In other embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 16, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 17, and the amino acid sequence of SEQ ID NO: 12. In some cases, the anti-CD7 protein expression blocker also comprises a localization domain selected from any one of the sequences set forth in SEQ ID NO: 8, SEQ ID NO: 9, or SEQ ID NO: 13. In some cases, the anti-CD7 protein expression blocker also comprises a CD8α signal peptide, such as, but not limited to, the CD8α signal peptide set forth in SEQ ID NO: 7. In other cases, the anti-CD7 protein expression blocker also comprises a CD8α hinge and transmembrane domain, such as, but not limited to, the CD8α hinge and transmembrane domain set forth in SEQ ID NO: 10.

[0082] In some embodiments, the nucleic acid sequence encoding anti-CD7 PEBL comprises one or more nucleic acid sequences set forth in Table 4. In some embodiments, the VH domain of the anti-CD7 scFv of PEBL comprises the nucleotide sequence of SEQ ID NO: 23, and the VL domain of the anti-CD7 scFv of PEBL comprises the nucleotide sequence of SEQ ID NO: 24. In specific embodiments, the VH domain of the anti-CD7 scFv of PEBL comprises a nucleotide sequence having at least 90% sequence identity (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to SEQ ID NO: 23, and the VL domain of the anti-CD7 scFv of PEBL comprises a nucleotide sequence having at least 90% sequence identity (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to SEQ ID NO: 24.

[0083] [Table 4-1] [Table 4-2]

[0084] In some embodiments, the nucleic acid sequence encoding the localization domain of the anti-CD7 protein expression blocker comprises a sequence selected from SEQ ID NO: 32, SEQ ID NO: 33, or SEQ ID NO: 34, or a codon-optimized variant thereof.

[0085] In certain aspects of the invention, the protein expression blocker is capable of binding to molecules expressed on the surface of cells, including, but not limited to, members of the CD1 family of glycoproteins, CD2, CD3, CD4, CD5, CD7, CD8, CD25, CD28, CD30, CD38, CD45, CD45RA, CD45RO, CD52, CD56, CD57, CD99, CD127, and CD137.

[0086] In some aspects of the present invention, the expression of members of the CD1 family of glycoproteins, CD2, CD3, CD4, CD5, CD7, CD8, CD25, CD28, CD30, CD38, CD45, CD45RA, CD45RO, CD52, CD56, CD57, CD99, CD127, or CD137 can be downregulated using gene editing techniques, including but not limited to, meganucleases, TALEN, CRISPR / Cas9, or zinc finger nucleases. For example, in some embodiments, CD7 expression is knocked out using genome editing with Cas9 / CRISPR. In other embodiments, CD5 expression is knocked out using genome editing with Cas9 / CRISPR.

[0087] As mentioned above, the downregulation of CD7 expression on effector T cells can be achieved according to various other known methods, including, for example, gene editing methods using meganucleases, TALENs, CRISPR / Cas9, and zinc finger nucleases.Therefore, in certain embodiments, genetically engineered immune cells further comprise a modified CD7 gene, and this modification makes the CD7 gene or protein non-functional.For example, the genetically engineered immune cells of the present invention further comprise a modified (e.g., non-functional) CD7 gene (e.g., modified using meganucleases, TALENs, CRISPR / Cas9, or zinc finger nucleases), which prevents or reduces the expression of CD7 and / or otherwise (e.g., structurally) prevents the CD7 protein from being recognized by anti-CD7 CAR.Methods for modifying gene expression using such methods are readily available and well known in the art.

[0088] Methods for inactivating target genes in immune cells using CRISPR / Cas6 technology are described, for example, in U.S. Patent Application Publication Nos. 2016 / 0272999, 2017 / 0204372, and 2017 / 0119820.

[0089] The CRISPR / Cas system is a system for inducing targeted genetic manipulation (genome modification). Target recognition by the Cas9 protein requires a "seed" sequence within the guide RNA (gRNA) and a conserved multinucleotide-containing protospacer adjacent motif (PAM) sequence upstream of the gRNA binding region. This allows the CRISPR / Cas system to be engineered to cleave virtually any DNA sequence by redesigning the gRNA in cell lines, primary cells, and engineered cells. The CRISPR / Cas system can simultaneously target multiple genomic loci by co-expressing a single Cas9 protein with two or more gRNAs, making the system particularly suitable for multiple gene editing or synergistic activation of target genes. Examples of CRISPR / Cas systems used to inhibit gene expression are described in U.S. Patent Application Publication No. 2014 / 0068797 and U.S. Patent Nos. 8,697,359 and 8,771,945. This system utilizes the RNA-guided Cas9 endonuclease to induce permanent gene disruption by introducing DNA double-strand breaks, which trigger error-prone repair pathways resulting in frameshift mutations. In some cases, the system utilizes a number of different endonucleases: Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cm Other endonucleases may also be used, including, but not limited to, r5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsxX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, T7, Fok1, other nucleases known in the art, their homologs, or their variants.

[0090] CRISPR / Cas gene disruption occurs when a gRNA sequence specific to a target gene and a Cas endonuclease are introduced into a cell to form a complex that allows the Cas endonuclease to introduce double-strand breaks into the target gene. In some cases, the CRISPR system comprises one or more expression vectors, which comprise a nucleic acid sequence encoding a Cas endonuclease and a guide nucleic acid sequence specific to the target gene. The guide nucleic acid sequence is specific to a gene and targets the gene for Cas endonuclease-induced double-strand breaks. The sequence of the guide nucleic acid sequence can be located within the locus of the gene. In some embodiments, the guide nucleic acid sequence is at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50 or more nucleotides in length. The guide nucleic acid sequence can be an RNA sequence, a DNA sequence, a combination thereof (RNA-DNA combination sequence), or a sequence with synthetic nucleotides such as peptide nucleic acid (PNA) or locked nucleic acid (LNA). The guide nucleic acid sequence can be a single molecule or a double molecule. In one embodiment, the guide nucleic acid sequence comprises a single guide RNA.

[0091] In some embodiments, the genetically engineered immune cells of the present invention can be modified via the CRISPR / Cas system to inactivate the human CD7 gene. Details of the genomic structure and sequence of the human CD7 gene can be found, for example, in GeneID No. 924 of the NCBI Gene database.

[0092] Commercially available kits, gRNA vectors, and donor vectors for knockout of specific target genes are available from, for example, Origene (Rockville, MD), GenScript (Atlanta, GA), Applied Biological Materials (ABM; Richmond, British Colombia), and BioCat (Hedelberg, Germany). For example, commercially available kits or kit components for CRISPR knockout of CD7 include those available under catalog numbers KN201231, KN201231G1, KN201231G2, and KN201231D, respectively, from Origene, and those available under catalog numbers sc-4072847, sc-4072847-KO-2, sc-4072847-HDR-2, sc-4072847-NIC, sc-4072847HDR-2, and sc-4072847-NIC-2, from Santa Cruz Biotechnology.

[0093] In some embodiments, the chimeric antigen receptors described herein can be introduced into the human CD7 locus using the CRISPR / Cas system.

[0094] In certain embodiments, genetically engineered immune cells are provided comprising: i) a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that specifically binds to cluster of differentiation 7 (CD7); and ii) a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain, wherein the target binding molecule is an antibody that binds to CD7, and the localization domain comprises an endoplasmic reticulum retention sequence. In certain embodiments, the antibody that binds to CD7 in the context of the CAR and in the context of the target binding molecule comprises the VH sequence set forth in SEQ ID NO: 1 and the VL sequence set forth in SEQ ID NO: 2, the VH sequence set forth in SEQ ID NO: 14 and the VL sequence set forth in SEQ ID NO: 15, or the VH sequence set forth in SEQ ID NO: 16 and the VL sequence set forth in SEQ ID NO: 17. As described herein, in certain embodiments, the antibody comprises a VH and a VL having sequences comprising at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH and VL sequences set forth in SEQ ID NOs: 1 and 2, respectively, SEQ ID NOs: 14 and 15, respectively, or SEQ ID NOs: 16 and 17, respectively. In certain embodiments, an antibody that binds to CD7 in the context of a CAR may be different from an antibody that binds to CD7 in the context of a target binding molecule (protein expression blocker or PEBL), as described herein. In certain embodiments, the intracellular signaling domain of 4-1BB comprises the sequence set forth in SEQ ID NO: 3. In certain embodiments, the intracellular signaling domain of CD3ζ comprises the sequence set forth in SEQ ID NO: 4.

[0095] In another aspect, a nucleic acid comprising a nucleotide sequence encoding a CAR, as described herein, is also provided, wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that binds to CD7.

[0096] In certain embodiments, the antibody is an scFv. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 1 and the variable light chain VL sequence set forth in SEQ ID NO: 2. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 14 and the variable light chain VL sequence set forth in SEQ ID NO: 15. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 16 and the variable light chain VL sequence set forth in SEQ ID NO: 17. As described herein, in certain embodiments, the scFv comprises a VH and a VL having sequences comprising at least 90% sequence identity, at least 91% sequence identity, at least 92% sequence identity, at least 93% sequence identity, at least 94% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, at least 99% sequence identity, or 100% sequence identity to the VH and VL sequences set forth in SEQ ID NO: 1 and SEQ ID NO: 2, respectively, SEQ ID NO: 14 and SEQ ID NO: 15, respectively, or SEQ ID NO: 16 and SEQ ID NO: 17, respectively. In certain embodiments, the CAR further comprises a hinge and a transmembrane sequence.

[0097] In certain embodiments, an isolated nucleic acid of the invention comprises a nucleotide sequence encoding a CAR according to Table 5. In some embodiments, the nucleic acid comprises a nucleotide sequence encoding a component of a CAR according to Table 5.

[0098] [Table 5]

[0099] In some embodiments, the anti-CD7 CAR comprises the amino acid sequence of SEQ ID NO: 1, the amino acid sequence of SEQ ID NO: 2, a 4-1BB intracellular signaling domain, a CD3ζ intracellular signaling domain, and a CD8 hinge and transmembrane domain. In some embodiments, the anti-CD7 CAR can also be a VH-VL linker, such as, but not limited to, a (GGGGS)n linker, where n can be in the range of 1 to 6, e.g., 1, 2, 3, 4, 5, or 6.

[0100] In one embodiment, the anti-CD7 protein expression blocker comprises the amino acid sequence of SEQ ID NO: 1, the amino acid sequence of SEQ ID NO: 2, the amino acid sequence of SEQ ID NO: 3, the amino acid sequence of SEQ ID NO: 4, and the amino acid sequence of SEQ ID NO: 10. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 2, the amino acid sequence of SEQ ID NO: 3, the amino acid sequence of SEQ ID NO: 4, and the amino acid sequence of SEQ ID NO: 10. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 2, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO: 3, the amino acid sequence of SEQ ID NO: 4, and the amino acid sequence of SEQ ID NO: 10. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:2, the amino acid sequence of SEQ ID NO:3, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:4, and the amino acid sequence of SEQ ID NO:10. In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:2, the amino acid sequence of SEQ ID NO:3, the amino acid sequence of SEQ ID NO:4, and an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:10.In some embodiments, the anti-CD7 protein expression blocker comprises an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:1, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:2, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:3, an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:4, and an amino acid sequence having at least 90% sequence identity or at least 95% sequence identity to SEQ ID NO:10.

[0101] In certain embodiments, an isolated nucleic acid of the invention comprises one or more nucleotide sequences of Table 6. In some embodiments, the nucleic acid comprises the nucleotide sequence of a component of a CAR listed in Table 6.

[0102] [Table 6-1] [Table 6-2]

[0103] In certain embodiments, the nucleic acid further comprises a nucleotide sequence encoding a target-binding molecule linked to the localization domain, as described herein. In certain embodiments, the target-binding molecule is an antibody that binds to CD7. In certain embodiments, the antibody is an scFv. In some embodiments, the scFv comprises a VH sequence having at least 90% sequence identity (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity) to the sequence of SEQ ID NO: 1 and a VL sequence having at least 90% sequence identity (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) to the sequence of SEQ ID NO: 2. In certain embodiments, the scFv comprises the VH sequence set forth in SEQ ID NO: 1 and the VL sequence set forth in SEQ ID NO: 2. In some embodiments, the VH domain of the anti-CD7 scFv comprises the nucleotide sequence of SEQ ID NO:23 and the VL domain of the anti-CD7 scFv comprises the nucleotide sequence of SEQ ID NO:24.

[0104] In other aspects, methods of treating cancer in a subject in need of treatment are also provided, comprising administering to the subject a therapeutic amount of engineered immune cells having any of the embodiments described herein, thereby treating cancer in the subject in need of treatment.

[0105] In certain embodiments, as described herein, the methods include administering a therapeutic amount of engineered immune cells comprising a nucleic acid comprising a nucleotide sequence encoding a CAR, wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that binds to CD7.

[0106] In certain embodiments, the methods include administering a therapeutic amount of genetically engineered immune cells, as described herein, that further comprise a nucleic acid having a nucleotide sequence encoding a target binding molecule (e.g., an anti-CD7 protein expression blocker) linked to a localization domain.

[0107] In certain embodiments, the cancer is a T-cell malignancy, e.g., a T-cell leukemia or T-cell lymphoma, such as T-cell acute lymphoblastic leukemia, T-cell prolymphocytic leukemia, T-cell large granular lymphocytic leukemia, enteropathy-type T-cell lymphoma, hepatosplenic T-cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, mycosis fungoides, Sézary syndrome, primary cutaneous gamma delta T-cell lymphoma, peripheral T-cell lymphoma not otherwise specified, angioimmunoblastic T-cell lymphoma, anaplastic large cell lymphoma, etc. In certain embodiments, the T-cell malignancy is early T-cell precursor acute lymphoblastic leukemia (ETP-ALL).

[0108] As used herein, the terms "treat," "treating," or "treatment" refer to alleviating a medical condition (e.g., a condition associated with a T-cell malignancy) to the extent that the condition is improved according to clinically acceptable criteria.

[0109] As used herein, "subject" refers to a mammal (e.g., a human, non-human primate, cow, sheep, goat, horse, dog, cat, rabbit, guinea pig, rat, mouse). In certain embodiments, the subject is a human. "Subject in need of treatment" refers to a subject (e.g., a patient) having or at risk of developing a disease or condition that can be treated (e.g., improved, ameliorated, prevented) by inducing T cells to exert specific cytotoxicity against malignant T cells.

[0110] As defined herein, a "therapeutic amount" refers to an amount sufficient, when administered to a subject, to achieve the desired therapeutic effect in the subject (treat a condition associated with a T-cell malignancy) under the conditions of administration. The effective amount of an agent to be administered can be determined by one of skill in the art using the guidance provided herein and other methods known in the art, and will depend on several factors, including, for example, the particular agent selected, the subject's age, sensitivity, tolerance to the drug, and general health.

[0111] In some embodiments, the engineered immune cells are autologous to the subject in need of treatment, e.g., cancer treatment. In other embodiments, the engineered immune cells are allogeneic to the subject in need of treatment.

[0112] In certain embodiments, the genetically engineered immune cells are administered to a subject by intravenous infusion, intra-arterial infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, intrathecal administration, and intraocular administration.

[0113] In certain embodiments, the genetically engineered immune cells are administered by infusion to a subject. Methods for injecting immune cells (e.g., allogeneic or autologous immune cells) are known in the art. A sufficient number of cells are administered to the recipient to ameliorate the symptoms of the disease. Typically, 10 7 ~10 10 The cell dose is a single setting, e.g., 10 9 The cells are injected in a single dose of 10 9 cell dose or several 10 9 The cells are administered in either a divided dose. The frequency of infusions can be daily, every 2 to 30 days, or at longer intervals as needed or indicated. The volume of infusions is generally at least one infusion per subject, preferably at least three, as tolerated or until disease symptoms improve. Cells can be infused intravenously at a rate of 50 to 250 mL / hour. Other suitable modes of administration include intra-arterial infusion, intraperitoneal infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, and intrathecal administration. Methods for adapting the present invention to such delivery modes are readily available to those skilled in the art.

[0114] In certain embodiments, the methods of treating cancer according to the present invention are combined with at least one other known cancer therapy, such as radiation therapy, chemotherapy, or other immunotherapy.

[0115] In another aspect, there is also provided a use of genetically engineered immune cells having any of the embodiments described herein for treating cancer, comprising administering a therapeutic amount of the genetically engineered immune cells to a subject in need of treatment. In certain embodiments, the cancer is a T-cell malignancy. In certain embodiments, the T-cell malignancy is early T-cell precursor acute lymphoblastic leukemia (ETP-ALL).

[0116] In certain embodiments, the genetically engineered immune cells are administered to a subject by intravenous infusion, intra-arterial infusion, intraperitoneal infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, and intrathecal administration.

[0117] In another aspect, a method of producing an engineered immune cell having any of the embodiments described herein is also provided, the method comprising introducing into an immune cell a nucleic acid comprising a nucleotide sequence encoding a CAR, wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ, and an antibody that binds to CD7.

[0118] In certain embodiments, the method further comprises introducing into the immune cell a nucleic acid comprising a nucleotide sequence encoding a target binding molecule (e.g., an anti-CD7 protein expression blocker or anti-CD7 PEBL) linked to a localization domain. In certain embodiments, the nucleotide sequence encoding the CAR and the nucleotide sequence encoding anti-CD7 PEBL are introduced into a single plasmid.

[0119] In various aspects, kits for producing the genetically engineered immune cells described herein are also provided. The current kits can be used, for example, to produce allogeneic or autologous T cells with anti-CD7 CAR-mediated cytotoxic activity. In some embodiments, the kits are useful for producing allogeneic effector T cells with anti-CD7 CAR-mediated cytotoxic activity. In certain embodiments, the kits are useful for producing autologous effector T cells with anti-CD7 CAR-mediated cytotoxic activity.

[0120] Thus, provided herein is a kit comprising a nucleic acid comprising a nucleotide sequence encoding a CAR, wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that binds to CD7. The nucleotide sequence encoding the anti-CD7 CAR can be designed according to any of the embodiments described herein. In certain embodiments, the nucleotide sequence encodes an anti-CD7 CAR according to the schematic diagram in Figure 1A ("anti-CD7-41BB-CD3ζ construct").

[0121] In certain embodiments, the kit further comprises a nucleic acid having a nucleotide sequence encoding a target binding molecule (e.g., an anti-CD7 PEBL molecule described herein) linked to a localization domain, as described herein. The nucleotide sequence encoding the target binding molecule linked to a localization domain can be designed according to any of the embodiments described herein.

[0122] In certain embodiments, the nucleotide sequence encoding the anti-CD7 CAR and / or the nucleotide sequence encoding the anti-CD7 PEBL further comprises, for example, a sequence that enables cloning and / or expression (e.g., a plasmid sequence or a vector sequence). For example, the nucleotide sequence can be provided as part of a plasmid to facilitate cloning into other plasmids and / or vectors (expression vectors or viral expression vectors), for example, for transfection, transduction, or electroporation into cells (e.g., immune cells). In certain embodiments, the nucleotide sequence encoding the anti-CD7 CAR and the nucleotide sequence encoding the anti-CD7 PEBL are provided on a single plasmid or vector (e.g., a single construct comprising the anti-CD7 CAR and anti-CD7 PEBL). In certain embodiments, the nucleotide sequences are provided on separate plasmids or vectors (expression vectors or viral expression vectors).

[0123] Generally, the kits are compartmentalized for ease of use and may include one or more containers with reagents. In certain embodiments, all of the kit components are packaged together. Alternatively, one or more individual components of the kit may be provided in a separate package from the other kit components. The kit may also include instructions for using the kit components.

[0124] In some embodiments, provided herein are genetically engineered immune cells comprising a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that binds to cluster of differentiation 7 (CD7). In certain embodiments, the antibody is a single-chain variable fragment (scFv). In some cases, the scFv comprises a heavy chain variable domain (VH) sequence set forth in SEQ ID NO: 1 and a light chain variable domain (VL) sequence set forth in SEQ ID NO: 2.

[0125] In some embodiments, the CAR further comprises a hinge and transmembrane sequence, such as, but not limited to, a hinge and transmembrane domain comprising the amino acid sequence of SEQ ID NO:10.

[0126] In some embodiments, the engineered immune cells are engineered T cells, engineered natural killer (NK) cells, engineered NK / T cells, engineered monocytes, engineered macrophages, or engineered dendritic cells.

[0127] In some embodiments, the engineered immune cell further comprises a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to the localization domain. In certain embodiments, the target binding molecule is an antibody that binds to CD7. In certain embodiments, the antibody is an scFv. In some embodiments, the scFv comprises a VH sequence set forth in SEQ ID NO: 1 and a VL sequence set forth in SEQ ID NO: 2. In some embodiments, the localization domain comprises an endoplasmic reticulum (ER) or Golgi apparatus retention sequence, a proteasome localization sequence, and a transmembrane domain sequence derived from CD8α, CD8β, 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, or FGFR2B.

[0128] In some embodiments, provided herein are genetically engineered immune cells comprising: (i) a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an intracellular signaling domain of 4-1BB and CD3ζ and an antibody that binds to cluster of differentiation 7 (CD7), and (ii) a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain, wherein the target binding molecule is an antibody that binds to CD7, the localization domain comprises an endoplasmic reticulum retention sequence, and the antibody that binds to CD7 comprises the variable heavy chain (VH) sequence set forth in SEQ ID NO: 1 and the variable light chain (VL) sequence set forth in SEQ ID NO: 2. In some embodiments, the intracellular signaling domain of 4-1BB comprises the sequence set forth in SEQ ID NO: 3, and the intracellular signaling domain of CD3ζ comprises the sequence set forth in SEQ ID NO: 4.

[0129] In some embodiments, provided herein are methods for treating cancer in a subject in need of treatment, comprising administering to the subject a therapeutic amount of genetically engineered immune cells described herein, thereby treating the cancer in the subject in need of treatment. In some embodiments, the cancer is a T-cell malignancy. In certain embodiments, the T-cell malignancy is early T-cell precursor acute lymphoblastic leukemia (ETP-ALL). In certain embodiments, the genetically engineered immune cells are administered to the subject by intravenous infusion, intra-arterial infusion, intraperitoneal infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, or intrathecal administration.

[0130] In some embodiments, provided herein is a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ, and an antibody that binds to cluster of differentiation 7 (CD7).

[0131] In other embodiments, provided herein are methods of treating cancer, comprising administering a therapeutic amount of the genetically engineered immune cells described herein to a subject in need thereof. In some embodiments, the cancer is a T-cell malignancy. In certain embodiments, the T-cell malignancy is early T-cell precursor acute lymphoblastic leukemia (ETP-ALL). In certain embodiments, the genetically engineered immune cells are administered to the subject by intravenous infusion, intra-arterial infusion, intraperitoneal infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, or intrathecal administration.

[0132] In some embodiments, provided herein are methods for producing the genetically engineered immune cells described herein. The method can include introducing into an immune cell a nucleic acid comprising a nucleotide sequence encoding a CAR, wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that binds to CD7, thereby producing the genetically engineered immune cell. The method can further include introducing into the immune cell a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain.

[0133] The present invention provides a chimeric antigen receptor (CAR) against CD7. As demonstrated herein, expression of an anti-CD7 CAR in immune cells, such as effector T cells, induces the T cells to exert specific cytotoxicity against T cell malignancies. This cytotoxic effect has been shown to be enhanced when CD7 expression on effector T cells is downregulated using an antibody-based molecule (protein expression blocker or PEBL) that targets CD7 for downregulation. Thus, the present invention provides an immunotherapeutic method for treating cancer, e.g., T cell malignancies.

[0134] In some aspects, the present invention provides engineered immune cells comprising a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that binds to cluster of differentiation 7 (CD7). In some embodiments, the engineered immune cells outlined herein also comprise a nucleic acid comprising a nucleotide sequence encoding a target binding molecule (e.g., protein expression blocker or PEBL) linked to a localization domain. Methods and kits for producing such engineered immune cells are also outlined herein.

[0135] In some aspects, the present invention provides a genetically engineered immune cell (e.g., a T cell, a natural killer (NK) cell, an NK / T cell, a monocyte, a macrophage, or a dendritic cell) comprising: (i) a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ and an antibody that specifically binds to CD7; and (ii) a nucleic acid comprising a nucleotide sequence encoding a target binding molecule linked to a localization domain, wherein the target binding molecule is an antibody that binds to CD7, the localization domain comprises an endoplasmic reticulum retention sequence, and the antibody that binds to CD7 comprises the variable heavy chain (VH) sequence set forth in SEQ ID NO: 1 and the variable light chain (VL) sequence set forth in SEQ ID NO: 2.

[0136] In another aspect, the present invention provides a method of treating cancer (e.g., T-cell malignancies) in a subject in need of treatment. The method comprises administering to the subject a therapeutic amount of any of the genetically engineered immune cells described herein, thereby treating the cancer in the subject in need of treatment. The present disclosure also describes the use of any of the genetically engineered immune cells outlined herein to treat cancer.

[0137] In another aspect, the present invention provides a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises the intracellular signaling domains of 4-1BB and CD3ζ, and an antibody that specifically binds to CD7. [Example]

[0138] Example 1: Blockade of CD7 expression on T cells for effective chimeric antigen receptor targeting of T cell malignancies This example demonstrates a novel approach to block CD7 expression in combination with second-generation CARs, resulting in highly potent anti-CD7 CAR T cells. This practical strategy offers a new treatment option for patients with high-risk T-cell malignancies, including ETP-ALL. overview

[0139] Effective immunotherapies for T-cell malignancies are lacking. A novel approach based on chimeric antigen receptor (CAR)-transformed T lymphocytes was devised. CD7 was selected as a target due to its consistent expression in T-cell acute lymphoblastic leukemia (T-ALL), including the most aggressive subtype, early T-cell precursor (ETP)-ALL. In 49 diagnostic T-ALL samples (including 14 ETP-ALL), the median CD7 expression was >99%, and CD7 expression remained high at relapse (n=14) and during chemotherapy (n=54). CD7 was targeted with a second-generation CAR (anti-CD7-41BB-CD3ζ), but due to the presence of CD7 on T cells themselves, CAR expression in T lymphocytes triggered allogeneic killing. To downregulate CD7 and control allogeneic killing, a novel method based on an anti-CD7 single-chain variable fragment coupled with an intracellular retention domain (protein expression blocker, PEBL) was applied. Transduction of anti-CD7 PEBL resulted in virtually immediate suppression of surface CD7 expression in all transduced T cells; 2.0% ± 1.7% were CD7+ compared with 98.1% ± 1.5% of mock-transduced T cells (n = 5, P < 0.0001). PEBL expression did not impair T cell proliferation, IFNγ and TNFα secretion, or cytotoxicity, nor did it abrogate CAR-mediated allogeneic killing. PEBL-CAR-T cells were highly cytotoxic to CD7+ leukemia cells in vitro and were consistently more potent than CD7+ T cells that escaped allogeneic killing. They also demonstrated robust anti-leukemia activity in cell line-derived and patient-derived T-ALL xenografts. The strategy described here is well-suited to existing clinical-grade cell manufacturing processes and can be rapidly implemented for the treatment of patients with high-risk T-cell malignancies. Introduction

[0140] T lymphocytes can be induced to specifically recognize and kill tumor cells through the expression of chimeric antigen receptors (CARs) 1-5Central to the effective application of this technology is the identification of a suitable target for CAR. The target must be highly expressed by tumor cells and should be absent from normal cells, or expressed only by normal cells whose temporary absence is clinically manageable. 6 Therefore, B-cell derived leukemias and lymphomas are usually expressed exclusively by B lymphoid cells. 9,10 , CD19 5,7 or CD22 8 Infusion of autologous T cells expressing anti-CD19 CARs in patients with B-cell refractory leukemia and lymphoma resulted in major clinical responses. 11-18 These exciting results provide clear evidence of the power of this technology and suggest the possibility of broader applications in oncology.

[0141] The development of CAR-T cell therapies for T-cell malignancies has lagged far behind their B-cell counterparts. The need for effective treatments in this field is particularly urgent due to the poor prognosis associated with several T-cell leukemia and lymphoma subtypes. For example, children and adolescents with early-stage T-cell precursor acute lymphoblastic leukemia (ETP-ALL) have the poorest response to initial therapy among all ALL patients. 19-21 Intensive chemotherapy and / or allogeneic hematopoietic stem cell transplantation often do not prevent refractory relapse, leaving these patients, and those with other high-risk features such as adult age, with a lack of treatment options. 19,22-25 .

[0142] A major obstacle to the development of effective CAR-T cells for T-cell malignancies is that the surface marker profile of malignant T cells (which generally lack CD19 or CD22 expression) largely overlaps with that of activated T lymphocytes. 19-26 CARs directed against such targets are likely to lead to self-elimination of CAR-T cells. 27,28The development and application of practical technology for CAR-T cell therapy of ETP-ALL and other T-ALL cell subtypes is described herein. First, a CAR directed against CD7 was created. As is recognized, CD7 is a 40 kDa type I transmembrane glycoprotein that is a primary marker of T-cell malignancies. 29-32 , highly expressed in all cases of T-cell ALL, including ETP-ALL 19 Second, a method was developed to rapidly and effectively downregulate CD7 expression on T cells. This method was selected because it avoids the allocative killing effect of CAR-T cell therapy, does not involve gene editing, and can be readily translated into clinical applications. material and method

[0143] Cells and culture conditions

[0144] The leukemia cell lines Jurkat, CCRF-CEM, Loucy, MOLT4, and KG1a were obtained from the American Type Culture Collection (ATCC; Rockville, MD). The B-lineage ALL cell line OP-1 was developed in the applicant's laboratory. 33 CCRF-CEM cells were transduced with a murine stem cell virus (MSCV)-internal ribosome entry site (IRES)-green fluorescent protein (GFP) retroviral vector containing the firefly luciferase gene (obtained from St. Jude Children's Research Hospital's Vector Development and Production Shared Resource, Memphis, TN). The same vector was used to transduce CCRF-CEM and Jurkat cells with the CD19 gene cloned from the cDNA of the RS4;11 B cell line (ATCC). Cell lines were maintained in RPMI-1640 medium (ThermoFisher Scientific, Waltham, MA) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin-streptomycin.

[0145] Peripheral blood samples were obtained from discarded anonymous by-products of platelet donations from healthy adult donors at the National University Hospital Blood Bank, Singapore. Bone marrow aspirates were collected from ALL patients for diagnostic immunophenotyping and treatment response monitoring. 19,26 In some experiments, surplus material stored with approval from the Institutional Review Board of the National University of Singapore was used. Mononuclear cells were isolated by centrifugation on a Lymphoprep density stage (Axis-Shield, Oslo, Norway) and washed twice in RPMI-1640. T cells were enriched with Dynabeads human T activator CD3 / CD28 (ThermoFisher) and cultured in RPMI-1640, 10% FBS, 1% penicillin-streptomycin, and interleukin-2 (IL-2; 120 IU / mL; Proleukin, Novartis, Basel, Switzerland).

[0146] Gene cloning and retroviral transduction

[0147] Single-chain variable fragment (scFv) of the anti-CD7 monoclonal antibody TH69 34 was linked to the CD8α signal peptide, the CD8α hinge and transmembrane domain, and the intracellular domains of 4-1BB and CD3ζ of the anti-CD19-41BB-CD3ζ CAR previously developed in Applicant's laboratory. 5 The same scFvs were also linked to sequences encoding the CD8α hinge and transmembrane domains followed by the CD8α signal peptide and the endoplasmic reticulum (ER) / Golgi retention peptides EQKLISEEDLKDEL (SEQ ID NO: 8), (GGGGS)4AEKDEL (SEQ ID NO: 9), or the localization sequence (SEQ ID NO: 13), and subcloned into the MSCV vector in the presence or absence of GFP or mCherry.

[0148] Retroviral supernatant preparation and transduction were performed as previously described 5,35Briefly, pMSCV retroviral vector-conditioned medium was added to a polypropylene tube coated with RetroNectin (Takara, Otsu, Japan). After centrifugation and removal of the supernatant, T cells were added to the tube and incubated at 37°C for 12 hours. Fresh viral supernatant was then added for two consecutive days. T lymphocytes were maintained in RPMI-1640 containing FBS, antibiotics, and 200 IU / mL IL-2.

[0149] For transient CAR expression, anti-CD7 and anti-CD19 CAR constructs were subcloned into the EcoRI and Xhol sites of the pVAXI vector (ThermoFisher Scientific) and transcribed into mRNA using T7 mScript (CellScript, Madison, WI). 36 For mRNA electroporation, cells were suspended in electroporation buffer (Amaxa Cell Line Nucleofector Kit V; Lonza, Basel, Switzerland) containing 200 μg of CAR mRNA and electroporated with an Amaxa Nucleofector 2b (Lonza) using program X-001. 36,37 Cells electroporated in the absence of mRNA were used as a control.

[0150] Detection of CAR, PEBL, and surface markers

[0151] CAR was detected with biotin-conjugated goat anti-mouse F(ab')2 antibody (Jackson ImmunoResearch, West Grove, PA) followed by allophycocyanin (APC)-conjugated streptavidin (Jackson ImmunoResearch). Phycoerythrin (PE)- or APC-conjugated anti-CD7 (M-T701), CD4 (RPA-T4), CD8 (RPA-T8), CD3 (SK7), and non-reactive isotype-matched antibodies were obtained from BD Biosciences (San Jose, CA), and CD19 (LT19) was obtained from Miltenyi Biotech. Cell staining was analyzed using Diva (BD Biosciences) or FlowJo software (FlowJo, Ashland, OR) on an Accuri C6, Fortessa, or LSRII flow cytometer (BD Biosciences).

[0152] Western blotting was performed as previously described. 35 Briefly, cell lysates were extracted using CelLytic M cell lysis reagent (Sigma-Aldrich, Saint Louis, MO) prior to protein quantification using the Pierce BCA Protein Assay Kit (ThermoFisher). Cell lysates were diluted with 4x Laemmli sample buffer (Bio-Rad, Hercules, CA) and separated on a 10% polyacrylamide gel by electrophoresis under reducing or non-reducing conditions. Blotted membranes were probed with mouse anti-human CO3 antibody (8D3; BD Biosciences), goat anti-mouse IgG horseradish peroxidase conjugate (R&D Systems, Minneapolis, MN), and Clarity Western ECL substrate (Bio-Rad). Staining was visualized using a ChemiDoc Touch Imager (Bio-Rad).

[0153] Cell aggregation assay, cytotoxicity assay and cytokine production

[0154] To measure cell-cell aggregation, Jurkat cells were cocultured with CD7+ or CD7- cells labeled with calcein red orange AM (ThermoFisher) for 30 min, and cell doublets were counted by flow cytometry. In some experiments, target cells were preincubated for 10 min before coculture with soluble anti-CD7 scFv obtained from the supernatant of Jurkat or 293T cells transduced with constructs consisting of scFvs without transmembrane or signaling sequences.

[0155] To test cytotoxicity, target cells were labeled with calcein red-orange AM and placed in a 96-well round-bottom plate (Corning Costar, Corning, NY). T cells were added with target cells at different effector:target (E:T) ratios and cultured for 4 hours at 37°C and 5% CO2. Viable target cells were counted by flow cytometry. To measure exocytosis of lytic granules, anti-human CD107a-PE (H4A3; BD Biosciences) was added to the coculture. After 1 hour, monensin (BD GolgiStop) was added, and the culture was continued for another 3 hours before flow cytometry analysis.

[0156] To assess cell proliferation, T cells were cultured alone or in the presence of MOLT-4 cells in a 1:1 E:T mixture in RPMI-1640 containing FBS and 120 IU / mL IL-2 at 37°C and 5% CO2. To inhibit proliferation, irradiated or Streck cell preservative (Streck Laboratories, Omaha, NE)-treated target cells were added to the cultures every 7 days. Viable GFP+ or mCherry+ T cells were counted by flow cytometry. For IFNγ and TNFα production, target and effector cells were plated as described above in a 1:1 E:T mixture. After 1 hour, Brefeldin A (BD GolgiPlug) was added to the cultures, and the cultures were continued for an additional 5 hours. Subsequently, intracellular staining with anti-IFNγ-PE (clone 25723.11; BD Biosciences) or anti-TNFα-PE (6401.1111; BD Biosciences) was performed before flow cytometry analysis.

[0157] Xenograft model

[0158] CCRF-CEM cells transduced with luciferase were transduced with NOD.Cg-Prkdc scid IL2rg tm1Wjl / SzJ (NOD / scid IL2RGnull) mice (Jackson Laboratory, Bar Harbor, ME) were injected with 1 × 10 6 Three and / or seven days later, mice were intravenously (iv) injected with 2 × 10 cells per mouse. 7T cells with downregulated CD7 and anti-CD7 CAR expression were received. Other mice received GFP alone or transduced T cells in RPMI-1640 containing 10% FBS instead of T cells. All mice received 20,000 IU of IL-2 intraperitoneally (ip) every 2 days. Tumor burden was determined using a Xenoge IVIS-200 system (Caliper Life Sciences, Waltham, MA) after intraperitoneal injection (2 mg per mouse) of aqueous D-luciferin potassium salt (Perkin Elmer, Waltham, MA). Luminescence was analyzed using Living Image 3.0 software. Luminescence was measured at a rate of 1 × 10 per second. 10 Mice were euthanized when photons were reached or earlier if physical signs justifying euthanasia appeared.

[0159] For the patient-derived xenograft (PDX) model, primary ETP-ALL cells were intravenously injected into NOD / scid IL2RGnull mice and expanded for the next 7–8 generations. ETP-ALL cells were then re-infused into NOD / scid IL2RGnull mice treated with PEBL-CAR-T cells or left untreated. Peripheral blood and tissues were monitored for the presence of ALL cells by flow cytometry. 19,26 After erythrocyte lysis with lysis buffer (Sigma-Aldrich), cells were stained with anti-mouse CD45-PE-Cyanine 7 (30-F11, Biolegend), and anti-human CD45-APC-H7 (2D1), CD7-PE (M-T701), CD3-APC (SK7), CD34-Peridinin Chlorophyll Protein (8G12) (all from BD Biosciences), and CD33-Brilliant Violet 421 (WM53, Biolegend). Cells were analyzed on a Fortessa flow cytometer using Diva and FlowJo software.

[0160] result

[0161] Validating CD7 as a target for CAR-T cell therapy in leukemia

[0162] In leukemic cells from diagnostic bone marrow samples obtained from 49 T-ALL patients (including 14 with ETP-ALL), the median percentage of CD7 expression was >99% (range, 79% to >99%). In only three cases (6.1%), CD7 expression was <99%, 98% in two, and 79% in one (Figure 1A). High CD7 expression was also observed in samples collected from 14 relapsed T-ALL patients (Figure 1A). The mean fluorescence intensity (MFI) of CD7 in leukemic cells at diagnosis or relapse always exceeded the MFI measured in residual normal T cells in the same samples. The median (range) MFI was 20,617 (4,105–66,674) in T-ALL cells versus 3,032 (1,301–9,582) in normal T cells (n=19, P<0.0001) (Fig. 1B).

[0163] To determine whether chemotherapy affects CD7 expression, we examined bone marrow samples containing minimal residual disease (MRD) collected during treatment. In all 54 samples (from 21 patients), >99% of residual leukemia cells were CD7+ (Figure 1A). In 18 patients, CD7 levels were monitored throughout the course of disease. As shown in Figures 1C and 1D, CD7 remained elevated during treatment. These results demonstrate that CD7 is a valid target for CAR-T cell therapy in T-ALL.

[0164] Anti-CD7 CAR design and expression

[0165] To target CD7, we designed an anti-CD7 CAR (Figure 2A) consisting of the scFv of the anti-CD7 antibody TH69 conjugated to the signaling domains of 4-1BB (CD137) and CD3ζ via the hinge and transmembrane domains of CD8α. Retroviral transduction of this construct in Jurkat cells resulted in high expression of the anti-CD7 CAR (Figure 2B), which appeared as monomers, dimers, and oligomers by Western blotting (Figure 2C).

[0166] To confirm that TH69 scFv can bind CD7, it was produced in soluble form and tested on CD7+ MOLT-4 cells and CD7- OP-1 cells. It labeled MOLT-4 cells but not OP-1 (Figure 8A). Furthermore, when MOLT-4 cells were preincubated with anti-CD7 scFv supernatant, staining with anti-CD7 monoclonal antibodies was significantly reduced, with the CD7 MFI (±SD) changing from 31,730 ± 1,144 to 5,987 ± 241 (n = 3). Jurkat cells expressing anti-CD7 CAR formed aggregates with CD7+ MOLT-4 cells, whereas cells transduced with GFP alone or anti-CD19 CAR did not. Conversely, anti-CD19 CAR induced cell aggregation with CD19+ OP-1 cells, whereas anti-CD7 CAR did not (Figure 8B). Preincubation of MOLT-4 or CCRF-CEM with soluble anti-CD7 scFv prevented aggregate formation (Fig. 8C).

[0167] To determine whether the anti-CD7 CAR was functional, the levels of the activation markers CD25 and CD69 were measured in Jurkat cells after 24 hours of coculture with MOLT4. There was a clear upregulation of both activation markers in cells expressing the anti-CD7 CAR (Figure 2D and Figure 2E). In summary, the anti-CD7-41BB-CD3ζ CAR can bind to its cognate antigen and transmit an activation signal upon ligation.

[0168] Expression of anti-CD7 CAR in T cells triggers cognate killing

[0169] To determine the effect of the anti-CD7-41BB-CD3ζ CAR in peripheral blood T lymphocytes, we used two different methods to express it: retroviral transduction (Figure 9A) and mRNA electroporation. However, it significantly reduced T cell viability. The mean (±SD) T cell recovery rate 24 h after mRNA electroporation was 39.8% ± 13.0% (n = 7) after electroporation in the absence of mRNA (Figure 3A). When the CAR was introduced by viral transduction, the cell recovery rate was 25.1% ± 16.2% (n = 10) of mock-transduced T cells (Figure 3B). Overall, CAR expression reduced cell recovery to 31.1% ± 16.3% (n = 17) after 24 h. Long-term cell culture further increased the overall difference in numbers between CAR-transduced and mock-transduced cells (Figure 3C). CAR expression in the absence of target cells induced the exocytosis of lytic granules, revealed by CD107a expression (Figure 3D), suggesting that the impairment of cell recovery was caused by cognate killing.

[0170] Downregulation of CD7 prevents T cell cognate killing without affecting T cell function

[0171] If poor T cell recovery was caused by cognate killing mediated by CAR binding to CD7 expressed by T cells, it should be improved by downregulating CD7 before CAR expression. To test this prediction, we applied a recently developed rapid and practical method based on the expression of an anti-CD7 scFv linked to an amino acid sequence containing the ER retention domains KDEL or KKMP [anti-CD7 protein expression blocker (PEBL)] (Figure 3E). These anchor the construct to the ER / Golgi apparatus and prevent secretion or membrane expression of the target protein. 39,40Three anti-CD7 PEBL constructs were tested, and PEBL-1 was the PEBL-1 of choice for subsequent experiments (Figures 3E and 3F). CD7 surface expression was essentially abolished in all T cells transduced with this construct, but CD7 mRNA expression was retained (Figures 3F, 10A, and 10B). In five experiments, 98.1% ± 1.5% of mock-transduced T cells were CD7+, compared with 2.0% ± 1.7% of T cells transduced with anti-CD7 PEBL (P < 0.0001) (Figure 3G). When anti-CD7 CAR was expressed by electroporation in cells with downregulated CD7, its expression was clearly detectable by flow cytometry (Figure 3H). By expressing CAR in cells with CD7 knockdown, T cell viability was significantly improved (Figure 3I), and in six paired experiments, viable cell recovery after CAR mRNA electroporation was consistently superior in T cells pre-transduced with anti-CD7 PEBL (P=0.008).

[0172] After anti-CD7 PEBL transduction, the ratio of CD4 to CD8 cells was similar to that of mock-transduced cells (Figure 4A). The absence of CD7 expression on the surface membrane did not affect T cell survival in culture (Figure 4B). To further investigate the functional capabilities of anti-CD7 PEBL-transduced T cells, the cells were genetically engineered to express anti-CD19 CAR (Figures A and C). Their ability to exert cytotoxicity, release cytotoxic granules, and secrete IFNγ in the presence of CD19+ ALL cells was tested. As shown in Figures 4D, 4E, and 4F, PEBL transduction and the absence of surface CD7 did not alter CAR-mediated cell function.

[0173] Anti-CD7-41BB-CD3ζ CAR induces potent cytotoxicity against CD7+ leukemia cells

[0174] CD7-negative T cells were prepared using anti-CD7 PEBL and electroporated with anti-CD7-41BB-CD3ζ CAR mRNA. Their anti-leukemia potential was assessed in coculture with the CD7+ leukemia cell lines MOLT-4, CCRF-CEM, Jurkat, Loucy, or KG1a. As shown in Figure 5A, cytotoxicity was dramatically increased by CAR expression. PEBL-CAR T cells were also highly effective against primary T-ALL cells obtained from patients (Figure 5B).

[0175] The cytotoxicity of PEBL-CAR T cells was compared with that of residual T cells recovered after CAR electroporation in cells not transduced with PEBL. In 45 experiments using cells from three donors, the cytotoxicity of PEBL-CAR cells consistently exceeded that of non-PEBL T cells (Figure 5C). Superior activity of PEBL-CAR cells was also observed when comparing the expression of CD107a (Figure 5D), IFNγ (Figure 11A), and TNFα (Figure 11B). Expression of PEBL and CAR by sequential retroviral transduction also resulted in potent cytotoxicity against patient-derived T-ALL cells (Figure 5E) and cell lines (Figure 12). Proliferation of anti-CD7 PEBL-CAR-T cells in the presence of CD7+ target cells was significantly higher than that of CAR-T cells without CD7 downregulation by PEBL (P<0.01) (Figure 5F). Finally, we compared the cytotoxicity exerted by anti-CD7 PEBL-CAR T cells with that exerted by anti-CD19-41BB-CD3ζ CAR T cells against the same target cells. 5The cytotoxicity of T cells expressing CD19 was compared with that of T cells expressing CD19. To this end, CCRF-CEM cells and Jurkat cells were transduced with CD19, and both CARs were also expressed in cells pre-transduced with anti-CD7 PEBL (Figures 13A and 13B). Anti-CD7 and anti-CD19 CAR T cells had similar short-term and long-term cytotoxicity (Figures 13C and 13D), and the long-term proliferative capacity in the presence of CD19+ CD7+ target cells was slightly lower for anti-CD7 CAR-T cells (Figure 13E), which could be explained by the lower expression of CD7 on target cells relative to CD19 (Figure 13B).

[0176] Anti-leukemic activity of anti-CD7 PEBL-CAR T cells in a mouse model of T-ALL

[0177] To further evaluate the anti-tumor potential of anti-CD7 PEBL-CAR T cells, CCRF-CEM cells were transplanted into NOD / scid IL2RGnull mice. Retrovirally transduced T cells with anti-CD7 PEBL and anti-CD7 CAR produced a significant anti-leukemia effect, with a marked reduction in leukemia cell burden and decreased leukemia cell proliferation (Figures 6A-C, 14A, and 14B). Three weeks after leukemia cell infusion, the median percentage of CCRF-CEM cells in peripheral blood by flow cytometry was 68% (n = 5) in control mice and 67% (n = 5) in mice receiving GFP-only T cells, but was undetectable in mice treated with anti-CD7 PEBL-CAR T cells (Figure 15A). Relapses occurring after anti-CD7 PEBL-CAR T cell treatment were not due to a CD7-deficient CCRF-CEM cell subset; leukemic cells continued to express high levels of CD7 and remained highly sensitive to anti-CD7CAR cytotoxicity, regardless of whether CCRF-CEM cells were derived from the liver or spleen of relapsed mice or directly from the original cell culture (Figure 15B).

[0178] To test PEBL-CAR T cells against primary leukemia cells in vivo, we used a PDX model of ETP-ALL. The PDX model allows for the expansion of leukemia cells derived from patients with ETP-ALL at diagnosis in NOD / scid IL2RGnull mice. The leukemia cells expressed CD7, CD34, and CD33, and were absent from surface CD3, CD1a, CD8, and CD5, retaining the immunophenotype determined at diagnosis (Figure 16). The cells were unable to survive or expand ex vivo and required injection into mice for expansion. All mice had ETP-ALL in their peripheral blood at the time of CAR-T treatment (Figure 7A). As shown in Figure 7B, ETP-ALL cells accounted for the majority of leukocytes in the bone marrow, spleen, liver, and lungs. After PEBL-CAR T cell administration (2 x 10 in one mouse), 7 pcs, and the remaining 4 are 2 x 10 6 After 2 × 10 transplantation, the number of leukemia cells in the peripheral blood dramatically decreased, while PEBL-CAR-T cells became detectable in all mice (Figure 7A). Blood smears showed prominent smear cells, suggesting leukemia cell lysis (Figure 7C). Leukemia progressed in all five control mice, which were euthanized when ETP-ALL accounted for >80% of peripheral blood mononuclear cells. 7 Mice treated with 2 × 10 PEBL-CAR-T cells died of apparent graft-versus-host disease (GvHD) 23 days after PEBL-CAR-T cell infusion. ETP-ALL was not detected in the blood, bone marrow, liver, spleen, lung, or brain, but PEBL-CAR T cells were detectable in all tissues (Figure 7D and Figure 7E). 6 Four mice treated with PEBL-CAR T cells are alive and free of signs of GvHD from day 25 (n=1) to day 39 (n=3) post-infusion. Consideration

[0179] While remissions for patients with B-cell leukemia and lymphoma can be achieved with CAR-T cells, effective options are lacking for patients with T-cell malignancies. To fill this gap, a CAR-T cell approach that could be rapidly translated into clinical intervention was developed and described herein. CD7, a widely expressed surface T-cell marker that is highly stable even on T-ALL cells exposed to chemotherapy, was targeted. A second-generation anti-CD7 CAR was designed. Suppression of CD7 surface expression on T cells was determined to be essential; without this suppression, the CAR would have caused severe T-cell depletion and prevented the CAR-T cells from achieving their full functional potential. Transduction of anti-CD7 PEBL resulted in virtually immediate suppression of CD7 expression. Expression of the anti-CD7 CAR on such cells resulted in potent anti-leukemic activity in vitro and in xenograft and PDX models of T-ALL. Thus, using this strategy, large numbers of CAR-T cells were rapidly generated and used to exert stable and specific cytotoxicity against T-cell malignancies, including one of the most aggressive forms, ETP-ALL.

[0180] The PEBL technique described herein for downregulating endogenous CD7 is based on the use of scFvs against target antigens coupled with ER / Golgi retention motifs. In this way, any newly synthesized CD7 remains anchored to the ER and / or Golgi, and its surface expression is prevented. This method was remarkably effective in downregulating CD7 and suppressing CAR-mediated allogeneic killing. Importantly, intracellular retention of CD7 did not alter T cell function, allowing normal proliferation, cytokine secretion, and cytotoxicity. This is consistent with the results of studies using CD7-deficient mice, which displayed normal lymphocyte populations in lymphoid tissues. 41,42 Another approach to downregulating CD7 would be to apply gene editing methods such as meganucleases, TALENs, or CRISPR / Cas9. 43To this end, a recent study reported an anti-CD7 CAR expressed in T cells with CRISPR / Cas-mediated CD7 gene deletion. 9,44 In addition to differences in costimulatory molecules (the CARs described herein have 4-1BB instead of CD28) that may have clinical impact, 45,46 The high specificity and practical nature of the PEBL strategy make it particularly attractive for current clinical applications. The method requires simple transduction with the same viral vector carrying the CAR, either as two sequential transductions or as a single transduction with a bicistronic vector carrying both constructs. The transduction is well-suited to established clinical-grade cell manufacturing processes and does not raise possible regulatory concerns related to off-target activity. 47,48 .

[0181] CD7 is a molecule characteristic of early T cell differentiation and is nearly ubiquitously expressed in T-ALL, whereas in normal cells its expression is restricted to T cells. 19,29-32 In clinical trials using anti-CD7-ricin A-chain immunotoxin in patients with T-cell lymphoma, the dose-limiting toxicity was vascular leak syndrome, a side effect seen with other toxin conjugates, and anti-CD7 binding was not observed on endothelial cells in various tissues. 49 Nevertheless, transient expression of CARs by mRNA electroporation may be considered in early studies to evaluate the potential for acute toxicity of anti-CD7 PEBL-CAR T cells. A concern with anti-CD7 CAR therapy is the depletion of normal T cells by the infused cells, which can lead to immunodeficiency. The initial application of this technology can be envisioned as a means to reduce MRD in high-risk T-ALL patients, thus maximizing the success of allogeneic hematopoietic stem cell transplantation. 50 In such cases, anti-CD7 CAR T cells would be eliminated by the transplant-conditioned and donor stem cell-reconstituted T cell compartment. Outside the transplant setting, they can activate "suicide genes" once leukemia eradication is achieved. 51Finally, infused anti-CD7 T cells (which retain their endogenous CD3 / TCR complexes) may reconstitute a sufficiently broad T cell repertoire that this may not be an issue. To this end, subsets of CD4 memory T cells and CD8 effector T cells in human blood lymphocytes that do not express CD7 have been described. 52,53 It should be noted that T-ALL cells express CD7 at higher levels than normal T cells, and therefore the CD7-dim subset may be instrumental in reconstituting the T-cell repertoire even after CD7-targeted therapy.

[0182] Standard treatment for T-ALL relies primarily on intensive chemotherapy plus hematopoietic stem cell transplantation for patients with high-risk disease. Results are unsatisfactory and involve significant morbidity and mortality. 54,55 The findings presented herein suggest that infusion of anti-CD7 PEBL-CAR T cells could significantly enhance or possibly replace existing chemotherapy- and transplantation-based strategies. Conceivably, CAR expression accompanied by downregulation of target antigens in T cells should also be applicable to other T cell markers, such as CD3, CD2, and CD5, whose expression is predominant in T cell lymphoproliferative neoplasms. Because a proportion of high-risk acute myeloid leukemias express CD7, 19,30,56 , it is also necessary to test the potential of anti-CD7 CAR-T cells for this leukemia subtype. References

[0183] 1.Eshhar Z,Waks T,Gross G,Schindler DG.「Specific activation and targeting of cytotoxic lymphocytes through chimeric single chains consisting of antibody-binding domains and the gamma or zeta subunits of the immunoglobulin and T-cell receptors.」Proc Natl Acad Sci USA 1993;90(2):720-724.

[0184] 2.Geiger TL,Leitenberg D,Flavell RA.「The TCR zeta-chain immunoreceptor tyrosine-based activation motifs are sufficient for the activation and differentiation of primary T lymphocytes.」J Immunol 1999;162(10):5931-5939.

[0185] 3.Brentjens RJ,Latouche JB,Santos E,et al.「Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15.」Nat Med 2003;9(3):279-286.

[0186] 4.Cooper LJ,Topp MS,Serrano LM,et al.「T-cell clones can be rendered specific for CD19:toward the selective augmentation of the graft-versus-B-lineage leukemia effect.」Blood 2003;101(4):1637-1644.

[0187] 5.Imai C,Mihara K,Andreansky M,Nicholson IC,Pui CH,Campana D.「Chimeric receptors with 4-1BB signaling capacity provoke potent cytotoxicity against acute lymphoblastic leukemia.」Leukemia 2004;18:676-684.

[0188] 6.Rosenberg SA,Restifo NP.「Adoptive cell transfer as personalized immunotherapy for human cancer.」Science 2015;348(6230):62-68.

[0189] 7.Brentjens RJ,Santos E,Nikhamin Y,et al.「Genetically targeted T cells eradicate systemic acute lymphoblastic leukemia xenografts.」Clin Cancer Res 2007;13(18 Pt 1):5426-5435.

[0190] 8.Haso W,Lee DW,Shah NN,et al.「Anti-CD22-chimeric antigen receptors targeting B-cell precursor acute lymphoblastic leukemia.」Blood 2013;121(7):1165-1174.

[0191] 9.Nadler LM,Anderson KC,Marti G,et al.「B4,a human B lymphocyte-associated antigen expressed on normal,mitogen-activated,and malignant B lymphocytes.」J Immunol 1983;131(1):244-250.

[0192] 10.Campana D,Janossy G,Bofill M,et al.「Human B cell development.I.Phenotypic differences of B lymphocytes in the bone marrow and peripheral lymphoid tissue.」J Immunol 1985;134(3):1524-1530.

[0193] 11.Porter DL,Levine BL,Kalos M,Bagg A,June CH.「Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia.」N Engl J Med 2011;365(8):725-733.

[0194] 12.Grupp SA,Kalos M,Barrett D,et al.「Chimeric antigen receptor-modified T cells for acute lymphoid leukemia.」N Engl J Med 2013;368(16):1509-1518.

[0195] 13.Till BG,Jensen MC,Wang J,et al.「CD20-specific adoptive immunotherapy for lymphoma using a chimeric antigen receptor with both CD28 and 4-1BB domains:pilot clinical trial results.」Blood 2012;119(17):3940-3950.

[0196] 14.Kochenderfer JN,Dudley ME,Feldman SA,et al.「B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigen-receptor-transduced T cells.」Blood 2012;119(12):2709-2720.

[0197] 15.Davila ML,Riviere I,Wang X,et al.「Efficacy and Toxicity Management of 19-28z CAR T Cell Therapy in B Cell Acute Lymphoblastic Leukemia.」Sci Transl Med 2014;6(224):224ra225.

[0198] 16.Maude SL,Frey N,Shaw PA,et al.「Chimeric antigen receptor T cells for sustained remissions in leukemia.」N Engl J Med 2014;371(16):1507-1517.

[0199] 17.Lee DW,Kochenderfer IN,Stetler-Stevenson M,et al.「T cells expressing CD19 chimeric antigen receptors for acute lymphoblastic leukaemia in children and young adults:a phase 1 dose-escalation trial.」Lancet 2015;385(9967):517-528.

[0200] 18.Turtle CJ,Hanafi LA,Berger C,et al.「CD19 CAR-T cells of defined CD4+:CD8+ composition in adult B cell ALL patients.」J Clin Invest 2016;126(6):2123-2138.

[0201] 19.Coustan-Smith E,Mullighan CG,Onciu M,et al.「Early T-cell precursor leukaemia:a subtype of very high-risk acute lymphoblastic leukaemia.」Lancet Oncol 2009;10(2):147-156.

[0202] 20.Zhang J,Ding L,Holmfeldt L,et al.「The genetic basis of early T-cell precursor acute lymphoblastic leukaemia.」Nature 2012;481(7380):157-163.

[0203] 21.Inukai T,Kiyokawa N,Campana D,et al.「Clinical significance of early T-cell precursor acute lymphoblastic leukaemia:results of the Tokyo Children‘s Cancer Study Group Study L99-15.」Br J Haematol 2012;156(3):358-365.

[0204] 22.Neumann M,Heesch S,Gokbuget N,et al.「Clinical and molecular characterization of early T-cell precursor leukemia:a high-risk subgroup in adult T-ALL with a high frequency of FLT3 mutations.」Blood Cancer J 2012;2(1):e55.

[0205] 23.Jain N,Lamb AV,O‘Brien S,et al.「Early T-cell precursor acute lymphoblastic leukemia / lymphoma(ETP-ALL / LBL)in adolescents and adults:a high-risk subtype.」Blood 2016;127(15):1863-1869.

[0206] 24.Marks DI,Rowntree C.「Management of adults with T-cell lymphoblastic leukemia.」Blood 2017;129(9):1134-1142.

[0207] 25.Campana D,Pui CH.「Minimal residual disease-guided therapy in childhood acute lymphoblastic leukemia.」Blood 2017;129(14):1913-1918.

[0208] 26.Coustan-Smith E,Sancho J,Hancock ML,et al.「Use of peripheral blood instead of bone marrow to monitor residual disease in children with acute lymphoblastic leukemia.」Blood 2002;100:2399-2402.

[0209] 27.Mihara K,Yanagihara K,Takigahira M,et al.「Activated T-cell-mediated immunotherapy with a chimeric receptor against CD38 in B-cell non-Hodgkin lymphoma.」J Immunother 2009;32(7):737-743.

[0210] 28.Mamonkin M,Rouce RH,Tashiro H,Brenner MK.「A T-cell-directed chimeric antigen receptor for the selective treatment of T-cell malignancies.」Blood 2015;126(8):983-992.

[0211] 29.Haynes BF,Eisenbarth GS,Fauci AS.「Human lymphocyte antigens:production of a monoclonal antibody that defines functional thymus-derived lymphocyte subsets.」Proc Natl Acad Sci USA 1979;76(11):5829-5833.

[0212] 30.Vodinelich L,Tax W,Bai Y,Pegram S,Capel P,Greaves MF.「A monoclonal antibody(WT1)for detecting leukemias of T-cell precursors(T-ALL).」Blood 1983;62(5):1108-1113.

[0213] 31.Janossy G,Coustan-Smith E,Campana D.「The reliability of cytoplasmic CD3 and CD22 antigen expression in the immunodiagnosis of acute leukemia:a study of 500 cases.」Leukemia 1989;3(3):170-181.

[0214] 32.Yeoh EJ,Ross ME,Shurtleff SA,et al.「Classification,subtype discovery,and prediction of outcome in pediatric acute lymphoblastic leukemia by gene expression profiling.」Cancer Cell 2002;1:133-143.

[0215] 33.Manabe A,Coustan-Smith E,Kumagai M,et al.「Interleukin-4 induces programmed cell death(apoptosis)in cases of high-risk acute lymphoblastic leukemia.」Blood 1994;83(7):1731-1737.

[0216] 34.Peipp M,Kupers H,Saul D,et al.「A recombinant CD7-specific single-chain immunotoxin is a potent inducer of apoptosis in acute leukemic T cells.」Cancer Res 2002;62(10):2848-2855.

[0217] 35.Kudo K,Imai C,Lorenzini P,et al.「T lymphocytes expressing a CD 16 signaling receptor exert antibody-dependent cancer cell killing.」Cancer Res 2014;74(1):93-103.

[0218] 36.Shimasaki N,Fujisaki H,Cho D,et al.「A clinically adaptable method to enhance the cytotoxicity of natural killer cells against B-cell malignancies.」Cytotherapy.2012;14(7):830-40.

[0219] 37.Shimasaki N,Campana D.「Natural killer cell reprogramming with chimeric immune receptors.」Methods Mol Biol 2013;969:203-220.

[0220] 38.Chang YH,Connolly J,Shimasaki N,Mimura K,Kono K,Campana D.「A Chimeric Receptor with NKG2D Specificity Enhances Natural Killer Cell Activation and Killing of Tumor Cells.」Cancer Res 2013;73(6):1777-1786.

[0221] 39.Munro S,Pelham HR.「A C-terminal signal prevents secretion of luminal ER proteins.」Cell 1987;48(5):899-907.

[0222] 40.Jackson MR,Nilsson T,Peterson PA.「Identification of a consensus motif for retention of transmembrane proteins in the endoplasmic reticulum.」EMBO J 1990;9(10):3153-3162.

[0223] 41.Bonilla FA,Kokron CM,Swinton P,Geha RS.「Targeted gene disruption of murine CD7.」Int Immunol 1997;9(12):1875-1883.

[0224] 42.Lee DM,Staats HF,Sundy JS,et al.「Immunologic characterization of CD7-deficient mice.」J Immunol 1998;160(12):5749-5756.

[0225] 43.Boettcher M,McManus MT.「Choosing the right tool for the job:RNAi,TALEN,or CRISPR.」Mol Cell 2015;58(4):575-585.

[0226] 44.Gomes-Silva D,Srinivasan M,Sharma S,et al.「CD7-edited T cells expressing a CD7-specific CAR for the therapy of T-cell malignancies.」Blood.2017 May 24.pii:blood-2017-01-761320.

[0227] 45.Campana D,Schwarz H,Imai C.「4-1BB chimeric antigen receptors.」Cancer J 2014;20(2):134-140.

[0228] 46.Zhao Z,Condomines M,van der Stegen SJ,et al.「Structural Design of Engineered Costimulation Determines Tumor Rejection Kinetics and Persistence of CAR T Cells.」Cancer Cell 2015;28(4):415-428.

[0229] 47.Tsai SQ,Joung JK.「Defining and improving the genome-wide specificities of CRISPR-Cas9 nucleases.」Nat Rev Genet 2016;17(5):300-312.

[0230] 48.Cameron P,Fuller CK,Donohoue PD,et al.「Mapping the genomic landscape of CRISPR-Cas9 cleavage.」Nat Methods 2017;14(6):600-606.

[0231] 49.Frankel AE,Laver JH,Willingham MC,Burns LJ,Kersey JH,Vallera DA.「Therapy of patients with T-cell lymphomas and leukemias using an anti-CD7 monoclonal antibody-ricin A chain immunotoxin.」Leuk Lymphoma 1997;26(3-4):287-298.

[0232] 50.Leung W,Pui CH,Coustan-Smith E,et al.「Detectable minimal residual disease before hematopoietic cell transplantation is prognostic but does not preclude cure for children with very-high-risk leukemia.」Blood 2012;120(2):468-72.

[0233] 51.Straathof KC,Spencer DM,Sutton RE,Rooney CM.「Suicide genes as safety switches in T lymphocytes.」Cytotherapy 2003;5(3):227-230.

[0234] 52.Reinhold U,Abken H,Kukel S,et al.「CD7- T cells represent a subset of normal human blood lymphocytes.」J Immunol 1993;150(5):2081-2089.

[0235] 53. Aandahl EM, Sandberg JK, Beckerman KP, Tasken K, Moretto WJ, Nixon DF. “CD7 is a differentiation marker that identifies multiple CD8 T cell effector subsets.” J Immunol 2003;170(5):2349-2355.

[0236] 54. Raetz EA, Teachey DT. “T-cell acute lymphoblastic leukemia.” Hematology Am Soc Hematol Educ Program 2016;2016(1):580-588.

[0237] 55. Jabbour E, O'Brien S, Konopleva M, Kantarjian H. "New insights into the pathophysiology and therapy of adult acute lymphoblastic leukemia." Cancer 2015;121(15):2517-2528.

[0238] 56.Kita K, Miwa H, Nakase K, et al. “Clinical importance of CD7 expression in acute myelocytic leukemia.” The Japan Cooperative Group of Leukemia / Lymphoma.Blood 1993;81(9):2399-2405.

[0239] The teachings of all patents, published applications and references cited herein are incorporated by reference in their entirety.

[0240] While the present invention has been particularly shown and described with reference to exemplary embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention as encompassed by the appended claims.

Claims

1. A pharmaceutical composition for treating T-cell acute lymphoblastic leukemia (T-ALL) or early T-cell precursor acute lymphoblastic leukemia (ETP-ALL) in a subject in need thereof, comprising genetically engineered immune cells administered to said subject in a therapeutic amount, thereby treating said subject; the genetically engineered immune cells i) a nucleic acid comprising a first nucleotide sequence encoding a target binding molecule linked to a localization domain, wherein the target binding molecule is a first antibody or fragment thereof that specifically binds to CD7; ii) a second nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises a 4-1BB intracellular signaling domain, a CD3ζ intracellular signaling domain, and a second antibody or fragment thereof that specifically binds to CD7; Including, introduction of the first nucleic acid and the second nucleic acid into the immune cells prevents homologous killing, and the genetically engineered immune cells maintain immune cell function and exhibit increased cytotoxicity against CD7-positive leukemia cell lines compared to otherwise identical immune cells that do not contain the first nucleic acid; the localization domain comprises the amino acid sequence of SEQ ID NO: 8, 9, or 13; and The first antibody or fragment thereof and the second antibody or fragment thereof comprise the same single chain variable fragment (scFv), wherein the scFv comprises: a heavy chain variable region (VH) comprising a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of SEQ ID NO: 1, and a light chain variable region (VL) comprising a light chain (LC) CDR1, LC CDR2 and LC CDR3 of SEQ ID NO: 2; a VH comprising HC CDR1, HC CDR2 and HC CDR3 of SEQ ID NO: 14, and a VL comprising LC CDR1, LC CDR2 and LC CDR3 of SEQ ID NO: 15; or VH comprising HC CDR1, HC CDR2 and HC CDR3 of SEQ ID NO: 16, and VL comprising LC CDR1, LC CDR2 and LC CDR3 of SEQ ID NO: 17; Pharmaceutical compositions.

2. 2. The pharmaceutical composition of claim 1, wherein the VH comprises HC CDR1, HC CDR2, HC CDR3 of SEQ ID NO: 1 and an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1, and the VL comprises LC CDR1, LC CDR2, LC CDR3 of SEQ ID NO: 2 and an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:

2.

3. 2. The pharmaceutical composition of claim 1, wherein the VH comprises HC CDR1, HC CDR2, HC CDR3 of SEQ ID NO: 14 and an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 14, and the VL comprises LC CDR1, LC CDR2, LC CDR3 of SEQ ID NO: 15 and an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:

15.

4. 2. The pharmaceutical composition of claim 1, wherein the VH comprises HC CDR1, HC CDR2, HC CDR3 of SEQ ID NO: 16 and an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 16, and the VL comprises LC CDR1, LC CDR2, LC CDR3 of SEQ ID NO: 17 and an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:

17.

5. The pharmaceutical composition of any one of claims 1 to 4, wherein the localization domain comprises the amino acid sequence of SEQ ID NO:8 or SEQ ID NO:

9.

6. The pharmaceutical composition of any one of claims 1 to 4, wherein the localization domain comprises the amino acid sequence of SEQ ID NO:

13.

7. The pharmaceutical composition of any one of claims 1 to 6, wherein the 4-1BB intracellular signaling domain comprises the amino acid sequence of SEQ ID NO: 3 and the CD3ζ intracellular signaling domain comprises the amino acid sequence of SEQ ID NO:

4.

8. The pharmaceutical composition according to any one of claims 1 to 7, wherein the CAR further comprises a hinge and a transmembrane domain.

9. 9. The pharmaceutical composition of claim 8, wherein the hinge and transmembrane domain comprises the amino acid sequence of SEQ ID NO:

10.

10. 2. The pharmaceutical composition of claim 1, wherein the VH comprises the amino acid sequence of SEQ ID NO: 1 and the VL comprises the amino acid sequence of SEQ ID NO:

2.

11. The pharmaceutical composition of claim 1, wherein the VH comprises the amino acid sequence of SEQ ID NO: 14 and the VL comprises the amino acid sequence of SEQ ID NO:

15.

12. The pharmaceutical composition of claim 1, wherein the VH comprises the amino acid sequence of SEQ ID NO: 16 and the VL comprises the amino acid sequence of SEQ ID NO:

17.

13. 13. The pharmaceutical composition of any one of claims 1 to 12, wherein the genetically engineered immune cells are genetically engineered T cells, genetically engineered natural killer (NK) cells, genetically engineered NK / T cells, genetically engineered monocytes, genetically engineered macrophages, or genetically engineered dendritic cells.

14. 14. The pharmaceutical composition of any one of claims 1 to 13, wherein the pharmaceutical composition is administered to the subject by intravenous infusion, intra-arterial infusion, intraperitoneal infusion, direct injection into the tumor and / or perfusion of the tumor bed after surgery, implantation at the tumor site in an artificial scaffold, or intrathecal administration.

Images