Anti-human interleukin-33 monoclonal antibody and its use

Abstract

The present application provides an anti-human interleukin-33 monoclonal antibody and uses thereof, which has high affinity and neutralizing activity for human interleukin-33 and can be used for the prevention or treatment of related diseases mediated by human interleukin-33.

Description

[Technical Field]

[0001] The present invention relates to the technical field of antibody drugs. Specifically, the present invention relates to a monoclonal antibody against human interleukin-33 (hIL-33) and uses thereof. [Background technology]

[0002] Interleukin-33 (IL-33), an important member of the IL-1 family, is expressed in a variety of cells, including epithelial cells, fibroblasts, endothelial cells, smooth muscle cells, macrophages, and dendritic cells. Because the IL-33 gene lacks a signal peptide, it cannot be secreted or expressed. Upon cell or tissue injury, IL-33 is released as an alarmin, which alerts immune cells expressing the IL-33 receptor, thereby playing an important role in host defense, immunoregulation, and inflammation (Cayrol C. et al., (2014) Curr. Opin. Immunol. 31C:31-37; Liew FY et al., (2016) Nat. Rev. Immunol. 16:676-689).

[0003] The IL-33 receptor is a heterodimeric molecule composed of ST2 (also known as IL1RL1) and the IL-1R accessory protein (IL-1RAcP). ST2 is the receptor to which IL-33 binds, and IL-1RAcP is a shared component of the receptors for IL-1α, IL-1β, IL-1F6, IL1F8, and IL1F9. It is not required for binding but is important for signal transduction (Schmitz J. et al. (2005) Immunity. 23:479-490). When IL-33 binds to ST2, it recruits IL-1RAcP to form the IL-33 / ST2 / IL1RAcP ternary complex, which subsequently induces signaling via the MyD88 adaptor, IRAK1 and IRAK4 kinases, and TRAF6, ultimately activating MAPK and NFκB transcription factors (Cayrol C. et al., (2018) Immunol Rev., 281(1):154-168).

[0004] IL-33 has been demonstrated to be associated with inflammatory diseases, acting on ST2-expressing immune cells such as Th2 cells, eosinophils, and mast cells to promote the production of type 2 immune cytokines, particularly IL-5 and IL-3, thereby causing severe pathological changes in mucosal organs (Molofsky A. et al., (2015) Immunity. 42:1005-1019; Mjosberg JMet al., (2011) Nat. Immunol. 12:1055-1062). Inflammatory diseases associated with IL-33 include atopic dermatitis, asthma, and chronic obstructive pulmonary disease (Savinko T. et al., (2012) J. Invest. Dermatol. 132:1392-1400; Prefontaine D. et al., (2010) J. Allergy. Clin. Immunol. 125:752-754; Byers D. et al. (2013) J. Clin. Invest. 123:3967-3982).

[0005] Itepekimab / REGN3500, a monoclonal antibody drug targeting interleukin-33, jointly developed by Regeneron and Sanofi, is intended for use in the treatment of inflammatory diseases such as chronic obstructive pulmonary disease (Phase III) and asthma (Phase II). Etokimab / ANB020, developed by AnaptysBio, is intended for use in the treatment of diseases such as asthma and chronic sinusitis (Phase II). Summary of the Invention

[0006] The present application aims to provide a novel anti-human interleukin-33 (hIL-33) monoclonal antibody, a pharmaceutical composition containing said monoclonal antibody, and pharmaceutical uses of said monoclonal antibody.

[0007] The specific technical solutions of this application are as follows:

[0008] 1. An isolated anti-human interleukin-33 monoclonal antibody comprising three heavy chain complementarity determining regions, CDR-H1, CDR-H2, and CDR-H3, and three light chain complementarity determining regions, CDR-L1, CDR-L2, and CDR-L3, The amino acid sequence of the CDR-H1 (herein, CDR-H1 refers to heavy chain CDR1) is shown in SEQ ID NO: 1 (SYHMI); The amino acid sequence of the CDR-H2 (herein, CDR-H2 refers to heavy chain CDR2) is shown in SEQ ID NO: 2 (VIYPNSNIYYATWAKG); The amino acid sequence of the CDR-H3 (herein, CDR-H3 refers to heavy chain CDR3) is shown in SEQ ID NO: 3 (TIYVHVYSALSI); The amino acid sequence of the CDR-L1 (herein, CDR-L1 refers to light chain CDR1) is shown in SEQ ID NO: 4 (QASESVLNEVS); The amino acid sequence of the CDR-L2 (herein, CDR-L2 refers to light chain CDR2) is set forth in SEQ ID NO: 5 (FASKLAS); and The monoclonal antibody, wherein the amino acid sequence of the CDR-L3 (herein, CDR-L3 represents light chain CDR3) is set forth in SEQ ID NO: 6 (QQDWSMDNIDNA).

[0009] 2. Contains a heavy chain variable region and a light chain variable region; The amino acid sequence of the heavy chain variable region is set forth in SEQ ID NO: 7 (EVQLVESGGGLVQPGGSLRLSCAASGFSLSSYHMIWVRQAPGKGLEWVGVIYPNSNIYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTIYVHVYSALSIWGQGTLVTVSS), Item 2. The monoclonal antibody according to Item 1, wherein the amino acid sequence of the light chain variable region is set forth in SEQ ID NO: 8 (AFQMTQSPSSVSASVGDRVTITCQASESVLNEVSWYQQKPGKAPKLLIYFASKLASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQDWSMDNIDNAFGGGTKVEIK).

[0010] 3. An isolated nucleic acid encoding the monoclonal antibody according to item 1 or 2.

[0011] 4. A host cell comprising the nucleic acid according to Item 3.

[0012] The nucleic acid can be present on a vector. The vector can be of any type, for example, a recombinant vector such as an expression vector. Any of several host cells can be used. In one embodiment, the host cell is a prokaryotic cell, for example, E. coli. In another embodiment, the host cell is a eukaryotic cell, for example, a mammalian cell such as a Chinese hamster ovary (CHO) cell.

[0013] 5. A method for producing a monoclonal antibody, comprising culturing the host cell according to Item 4 to produce the monoclonal antibody according to Item 1 or 2.

[0014] The method includes expressing a recombinant vector encoding the anti-human interleukin-33 (IL-33) monoclonal antibody in a suitable host cell, thereby producing the monoclonal antibody. In certain embodiments, the method includes culturing a host cell containing nucleic acid encoding the anti-human interleukin-33 (IL-33) monoclonal antibody, thereby expressing the nucleic acid. The method may further include recovering the anti-human interleukin-33 (IL-33) monoclonal antibody from the host cell culture or host cell culture medium.

[0015] 6. A pharmaceutical composition comprising the monoclonal antibody according to item 1 or 2 and a pharmaceutically acceptable carrier.

[0016] The pharmaceutical composition may further comprise an additional therapeutic agent (eg, a different anti-human interleukin-33 (IL-33) antibody).

[0017] 7. The pharmaceutical composition according to item 6, which is used to treat a disease associated with human interleukin-33-mediated signal transduction.

[0018] 8. The pharmaceutical composition according to Item 7, wherein the disease associated with human interleukin-33-mediated signaling is any one or more selected from the group consisting of asthma, chronic obstructive pulmonary disease (COPD), age-related macular degeneration (AMD), chronic sinusitis, atopic dermatitis, multiple sclerosis, arthritis, and inflammatory bowel disease.

[0019] 9. Use of the monoclonal antibody according to paragraph 1 or 2 in the preparation of a medicament for treating a disease associated with interleukin-33 mediated signaling.

[0020] 10. The use according to Item 9, wherein the disease associated with human interleukin-33-mediated signaling is any one or more selected from asthma, chronic obstructive pulmonary disease (COPD), age-related macular degeneration (AMD), chronic sinusitis, atopic dermatitis, multiple sclerosis, arthritis, and inflammatory bowel disease.

[0021] 11. A method for treating a disease associated with human interleukin-33 mediated signaling, comprising administering to a subject in need thereof a monoclonal antibody described in any one of the preceding claims or a pharmaceutical composition described in any one of the preceding claims.

[0022] 12. The method according to Item 11, wherein the disease associated with human interleukin-33-mediated signaling is any one or more selected from the group consisting of asthma, chronic obstructive pulmonary disease (COPD), age-related macular degeneration (AMD), chronic sinusitis, atopic dermatitis, multiple sclerosis, arthritis, and inflammatory bowel disease. [Effects of the Invention]

[0023] The present invention provides a novel anti-human interleukin-33 (IL-33) monoclonal antibody, which has equivalent binding affinity to human interleukin-33 and equivalent neutralizing activity at the cellular level to an existing anti-human interleukin-33 (IL-33) monoclonal antibody (etoximab / ANB020).

[0024] Sanofi's monoclonal antibody drug (Itepekimab / REGN3500) targeting interleukin-33 is intended for use in treating inflammatory diseases such as chronic obstructive pulmonary disease (Phase III) and asthma (Phase II). AnaptysBio's etokimab / ANB020 is intended for use in chronic sinusitis (Phase II).

[0025] The monoclonal antibody of the present application is expected to exhibit neutralizing activity at the cellular level equivalent to that of etokimab / ANB020 (expressed and prepared according to the sequence disclosed in the patent) and to show good clinical efficacy in the prevention and treatment of related diseases. [Brief explanation of the drawings]

[0026] [Figure 1] Figure 1 shows the results of nucleic acid electrophoresis for constructing the QX007N (HZD78-70) transient expression plasmid, where M is a marker; band 1 is the PCR product 78VH-Hu25; band 2 is pQX2.1, HindIII / NheI; band 3 is the PCR product 78VK-Hu3-CK; and band 4 is pQX1, HindIII / BamHI. [Figure 2] FIG. 2 is a flow chart of transient expression. [Figure 3] FIG. 3 is an electrophoretic detection diagram of QX007N (HZD78-70). [Figure 4]FIG. 4 shows the activity of QX007N (HZD78-70) and etoximab / ANB020 to neutralize NF-κB / AP-1 signaling in HEK Blue™ IL-33 cells induced by recombinant human interleukin-33. [Figure 5] FIG. 5 shows the activity of QX007N (HZD78-70) and etoximab / ANB020 to neutralize NF-κB / AP-1 signaling in HEK Blue™ IL-33 cells induced by native human interleukin-33. [Figure 6] FIG. 6 shows the activity of QX007N (HZD78-70) and etoximab / ANB020 to neutralize recombinant human interleukin-33-induced IL-5 release from KU812 cells. [Figure 7] FIG. 7 shows the activity of QX007N (HZD78-70) and etokimab / ANB020 to neutralize recombinant human interleukin-33-induced release of IFN-γ from human whole blood. Details of the invention

[0027] Scientific and technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art, except that in case of conflict, the definitions used herein shall control.

[0028] Generally speaking, the terms used herein have the following meanings:

[0029] As used herein, an "isolated" antibody refers to an antibody that has been separated from the components of its natural environment. In some embodiments, the antibody is purified to greater than 95% or 99% purity, and the purity is determined, for example, by electrophoresis (e.g., SDS-PAGE isoelectric focusing (IEF), capillary electrophoresis) or chromatography (e.g., ion exchange or reverse-phase HPLC). For a review of methods for assessing antibody purity, see, for example, Flatman et al., J. Chromatogr. B848:79-87 (2007).

[0030] As used herein, a "monoclonal antibody" refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., each antibody in the population is identical and / or binds to the same epitope. Except for possible variant antibodies (e.g., those containing naturally occurring mutations or those arising during the preparation of a monoclonal antibody), such variants are generally present in minor amounts. Unlike a typical polyclonal antibody preparation, which contains different antibodies directed against different determinants (epitopes), each monoclonal antibody in a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier "monoclonal" indicates the character of being obtained from a population of substantially homogeneous antibodies and should not be construed as an antibody requiring preparation by any particular method. For example, monoclonal antibodies according to the present application can be produced by several techniques, including, but not limited to, hybridoma technology, recombinant DNA technology, phage display technology, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci. This document describes such methods, as well as other exemplary methods for preparing monoclonal antibodies.

[0031] As used herein, "affinity" refers to the strength of the sum of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless otherwise stated, "binding affinity," as used herein, refers to the intrinsic binding affinity that reflects a 1:1 interaction between binding partner members (e.g., an antibody and an antigen). The affinity of molecule X for partner Y can generally be expressed as an equilibrium dissociation constant (KD). Affinity can be measured by routine methods known in the art.

[0032] As used herein, human interleukin-33 (hIL-33) refers to hIL-33 present in the cell nucleus that is hydrolyzed by a protease to form mature hIL-33, which is secreted extracellularly to exert the biological activity of hIL-33, and has the amino acid sequence set forth in SEQ ID NO: 9. SEQ ID NO:9: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

[0033] As used herein, "anti-human interleukin-33 (hIL-33) monoclonal antibody" refers to a monoclonal antibody that can bind to human interleukin-33 with sufficient affinity so that it can be used as a diagnostic and / or therapeutic agent targeting human interleukin-33.

[0034] The anti-human interleukin-33 monoclonal antibody of the present application does not bind to a target, unrelated protein. Here, "unrelated protein" refers to a protein other than the target human interleukin-33, and "does not bind" here means that, when the binding ability of the anti-human interleukin-33 (hIL-33) monoclonal antibody of the present invention to its target human interleukin-33 is taken as 100%, the binding ability of the anti-human interleukin-33 (hIL-33) monoclonal antibody of the present invention to the unrelated protein is less than 10%, for example, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0.

[0035] The anti-human interleukin-33 (hIL-33) monoclonal antibody of the present invention can bind to interleukin-33 from humans and cynomolgus monkeys, but may not bind to interferon-33 from other animal species. Here, "other animal species" refers to animal species other than humans and cynomolgus monkeys, such as pigs, dogs, rabbits, rats, mice, and guinea pigs. When determining the species specificity of the anti-human interleukin-33 (hIL-33) monoclonal antibody of the present application, "does not bind" refers to a binding ability of the anti-human interleukin-33 (hIL-33) monoclonal antibody of the present application to interleukin-33 from other animal species that is less than 5%, e.g., 4%, 3%, 2%, 1%, or 0, when the binding ability of the anti-human interleukin-33 (hIL-33) of the present application to its target human interleukin-33 (hIL-33) is taken as 100%.

[0036] The human interleukin-33 monoclonal antibody of the present invention has an equilibrium dissociation constant (K D )

[0037] The experimental results show that the anti-human interleukin-33 (hIL-33) monoclonal antibody of the present application can specifically bind to human interleukin-33 (hIL-33).

[0038] The anti-human interleukin-33 (hIL-33) monoclonal antibody of the present application has many biological activities equivalent to or superior to those of similar commercially available monoclonal antibody products, such as the activity of neutralizing NF-κB / AP-1 signaling in cells induced by recombinant / native human interleukin-33, the activity of neutralizing interleukin-33-induced release of IL-5 from KU812 cells, and the activity of neutralizing interleukin-33-induced release of IFN-γ from human whole blood.

[0039] In one embodiment, the amino acid sequence of the heavy chain of the anti-human interleukin-33 (hIL-33) monoclonal antibody of the present application is set forth in SEQ ID NO:10, and the amino acid sequence of the light chain is set forth in SEQ ID NO:11. SEQ ID NO: 10 EVQLVESGGGLVQPGGSLRLSCAASGFSLSSYHMIWVRQAPGKGLEWVGVIYPNSNIYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTIYVHVYSALSIWGQ GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 11 AFQMTQSPSSVSASVGDRVTITCQASESVLNEVSWYQQKPGKAPKLLIYFASKLASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQDWSMDNIDNAFGGGTKVE IKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Among them, SEQ ID NOs: 10 and 11 are both humanized sequences.

[0040] As used herein, an "isolated" nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. Isolated nucleic acid includes a nucleic acid molecule that is contained in cells that ordinarily contain the nucleic acid molecule, but where the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.

[0041] As used herein, "an isolated nucleic acid encoding an anti-human interleukin-33 monoclonal antibody" refers to one or more nucleic acid molecules encoding the heavy and light chains of the antibody, including such nucleic acid molecules in a single vector or separate vectors, and including such nucleic acid molecules present in one or more locations in a host cell.

[0042] As used herein, "vector" refers to a nucleic acid molecule capable of amplifying another nucleic acid to which it is linked. The term includes vectors that are self-replicating nucleic acid structures and vectors that integrate into the genome of a host cell into which they are introduced. Some vectors are capable of directing the expression of nucleic acids that are operably linked to them. Such vectors are referred to herein as "expression vectors."

[0043] As used herein, the terms "host cell," "host cell line," and "host cell culture" are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include "transformants" and "transformed cells," and include the primary transformed cell and its progeny (regardless of the number of passages). Progeny may not be entirely identical in nucleic acid content to the parent cell and may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.

[0044] As used herein, "pharmaceutical composition" refers to a composition-like product that is in a form that enables the biological activity of the active ingredient contained therein and that does not contain additional ingredients that are unacceptably toxic to the subject to whom the formulation is administered.

[0045] As used herein, the term "pharmaceutically acceptable carrier" refers to any component, other than an active ingredient, in a pharmaceutical composition that is non-toxic to a subject. Pharmaceutically acceptable carriers include, but are not limited to, buffers, excipients, stabilizers, or preservatives.

[0046] As used herein, a "monoclonal antibody" is generally a human antibody and can be prepared using techniques well known to those skilled in the art. For example, human antibodies are generally described in van Dijk, MA and van de Winkel, JG, Curr. Opin. Pharmacol. 5:368-374 (2001) and Lonberg, N., Curr. Opin. Immunol. 20:450-459 (2008).

[0047] Antibodies can be prepared by administering an immunogen to a transgenic animal that has been modified to stimulate the production of fully human antibodies or intact antibodies with human variable regions in response to antigen challenge. These animals typically contain some or all of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci and are present extrachromosomally or randomly integrated into the animal. In such transgenic animals, the endogenous immunoglobulin loci are generally inactivated; for a review of methods for obtaining human antibodies from transgenic animals, see Lonberg, N., Nat. Biotech. 23:1117-1125 (2005). See also, e.g., the XENOMOUSE™ technology described in U.S. Patent Nos. 6,075,181 and 6,150,584, the HUMAB® technology described in U.S. Patent No. 5,770,429, the K-MMOUSE® technology described in U.S. Patent No. 7,041,870, and the VELOCIMOUSE® technology described in U.S. Patent Application Publication No. US2007 / 0061900. The human variable regions of intact antibodies generated from such animals can be further modified, for example, by combination with different human constant regions.

[0048] Human antibodies can also be produced by hybridoma-based methods. Human myeloma cells and mouse-human hybrid myeloma cells used to produce human monoclonal antibodies have been described (see, e.g., Kozbor, D., J. Immunol. 133:3001-3005 (1984); Brodeur, B. R. et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York (1987), pp. 51-63; Boerner, P. et al., Immunol. 147:86-95 (1991)). Human antibodies produced by human B cell hybridoma technology are also described in Li, J. et al., Proc. Natl. Acad. Sci. USA 103:3557-3562 (2006). Other methods include those described, for example, in U.S. Patent No. 7,189,826 (which describes the production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4); 265-268 (which describes human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers, HP and Brandlein, S., Histology and Histopathology 20:927-937 (2005); Vollmers, HP and Brandlein, S., Methods and Findings in Experimental and Clinical Pharmacology 27:185-191 (2005).

[0049] Human antibodies can also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries, and then combining such variable domain sequences with desired human constant domains.

[0050] Human antibodies can also be selected based on an autoantibody library. That is, human antibodies can be isolated by screening a combinatorial library of antibodies with one or more desired activities. For example, various methods are known in the art for creating phage display libraries and screening such libraries for antibodies with desired binding properties. This method is reviewed, for example, in Hoogenboom, H.R. et al., Methods in Molecular Biology 178:1-37 (2001), and further described, for example, in McCafferty, J. et al., Nature 348:552-554 (1990); Clackson, T. et al., Nature 352:624-628 (1991); Marks, J.D. et al., J.Mol.Biol. 222:581-597 (1992); Marks, J.D. and Bradbury, A., Methods in Molecular Biology 248:161-175 (2003); Sidhu, S.S. et al., J.Mol.Biol. 338:299-310 (2004); Lee, C.V. et al. al., J. Mol. Biol. 340:1073-1093 (2004); Fellouse, FA, Proc. Natl. Acad. Sci. USA 101:12467-12472 (2004); and Lee, CV et al., J. Immunol. Methods 284:119-132 (2004).

[0051] In some phage display methods, complete sets of VH and VL genes are cloned by polymerase chain reaction (PCR) and randomly recombined into a phage library, which is then screened for antigen-binding phages, as described in Winter, G. et al., Ann. Rev. Immunol. 12:433-455 (1994). Phages typically display antibody fragments as single-chain Fv (scFv) fragments or Fab fragments. Libraries from immunized sources provide high-affinity antibodies to immunogens without the need for hybridoma construction. Alternatively, unimmunized repertoires (e.g., from humans) can be cloned to provide a single source of antibodies against multiple non-self and self antigens in the absence of immunization, as described in Griffiths, AD et al., EMBO J, 12:725-734 (1993). Finally, non-immunized libraries can also be generated synthetically by cloning unrearranged V gene segments from stem cells, encoding highly variable CDR3 regions using PCR primers containing random sequences, and rearranging them in vitro, as described by Hoogenboom, H.R. and Winter, G., J. Mol. Biol. 227:381-388 (1992). Patent publications describing human antibody phage libraries include, for example, U.S. Patent No. 5,750,373 and U.S. Patent Publication Nos. 2005 / 0079574, 2005 / 0119455, 2005 / 0266000, 2007 / 0117126, 2007 / 0160598, 2007 / 0237764, 2007 / 0292936, and 2009 / 0002360.

[0052] The antibody may also be a multispecific antibody, such as a bispecific antibody. Bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites. Techniques for producing multispecific antibodies include, but are not limited to, recombinant coexpression of two immunoglobulin heavy chain-light chain pairs with different specificities (see Milstein, C. and Cuello, A.C., Nature 305:537-540 (1983); WO93 / 08829; and Traunecker, A. et al., EMBO J. 10:3655-3659 (1991)) and "protuberance-into-cavity" engineering (see, e.g., U.S. Pat. No. 5,731,168). Multispecific antibodies can also be produced by various techniques, including engineered electrostatic steering to generate antibody Fc heterodimeric molecules (WO 2009 / 089004), cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No. 4,676,980 and Brennan, M. et al., Science 229:81-83 (1985)), using leucine zippers to generate bispecific antibodies (see, e.g., Kostelny, S.A. et al., J. Immunol. 148:1547-1553 (1992)), using "double antibody" technology to generate bispecific antibody fragments (see, e.g., Holliger, P. et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993)), and using single-chain Fv (scFv) dimers (see, e.g., Gruber, M. et al., J. Immunol. 148:1547-1553 (1992)). al., J. Immunol. 152:5368-5374 (1994)), and preparation of trispecific antibodies (see, for example, Tutt, A. et al., J. Immunol. 147:60-69 (1991)).

[0053] The monoclonal antibodies described herein also include engineered modified antibodies with three or more functional antigen binding sites, including "octopus antibodies" (see, e.g., US 2006 / 0025576).

[0054] The antibodies herein can also include multispecific antibodies described in WO2009 / 080251, WO2009 / 080252, WO2009 / 080253, WO2009 / 080254, WO2010 / 112193, WO2010 / 115589, WO2010 / 136172, WO2010 / 145792, and WO2010 / 145793, WO2011 / 117330, WO2012 / 025525, WO2012 / 025530, WO2013 / 026835, WO2013 / 026831, WO2013 / 164325, or WO2013 / 174873.

[0055] The monoclonal antibodies described herein may be antibody variants, for example, if it is desired to improve the binding affinity and / or other biological properties of the antibody. Amino acid sequence variants of antibodies can be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody or by peptide synthesis. Such modifications include, for example, deletion, insertion, and / or substitution of residues within the amino acid sequence of the antibody. Any combination of deletion, insertion, and substitution can be performed to obtain the final construct, as long as the final construct possesses the desired properties, such as antigen binding. Thus, in certain embodiments, antibody variants with one or more amino acid substitutions are provided. Target sites for substitution mutations include HVRs and FRs. For example, amino acid substitutions can be introduced into a target antibody and products with the desired activity, such as retained / improved antigen binding, reduced immunogenicity, or improved ADCC or CDC, can be screened. [Example]

[0056] The present application will be described in more detail below through examples, but it should be understood that the present application is not limited to these examples.

[0057] Example 1 Preparation of anti-human interleukin-33 monoclonal antibody QX007N Human interleukin-33 (hIL-33) for immunization of New Zealand rabbits was purchased from Shanghai Jin'an Technology Co., Ltd., and antigen-binding specific antibody clones were obtained using B cell cloning technology. Monoclonal antibodies binding to human interleukin-33 and possessing human interleukin-33 inhibitory activity were then screened. Cell supernatants were first detected using binding ELISA to select clones that bound to human interleukin-33. Then, HEK Blue™ IL-33 reporter gene cell assays were used to select clones with human interleukin-33 inhibitory activity. The above immunization and screening processes were completed by a commercial company.

[0058] Twelve clones were selected for recombinant expression and sequenced. Measurement revealed that 78# had the best cell-neutralizing activity. 78# was humanized. NCBI IgBlast was used to perform identity alignment of human IgG germline sequences (Germline). IgGHV3-66*01 was selected as the heavy chain CDR-grafting template, and the CDR regions of the 78# clone heavy chain (i.e., CDR-H1 (SEQ ID NO: 1), CDR-H2 (SEQ ID NO: 2), and CDR-H3 (SEQ ID NO: 3)) were grafted into the IgGHV3-66*01 framework region. IGKV1-12*01 was selected as the light chain CDR-grafting template, and the CDR regions of the 78# clone light chain (i.e., CDR-L1 (SEQ ID NO: 4), CDR-L2 (SEQ ID NO: 5), and CDR-L3 (SEQ ID NO: 6)) were grafted into the IGKV1-12*01 framework region. Backmutations were performed at specific sites in the framework regions to obtain the variable regions of monoclonal antibody QX007N of the present application. Finally, the amino acid sequences of the humanized heavy chain variable regions are shown in SEQ ID NO:7, and the amino acid sequences of the humanized light chain variable regions are shown in SEQ ID NO:8.

[0059] The heavy chain variable region gene (SEQ ID NO: 7) and full-length light chain gene (SEQ ID NO: 11) were obtained by PCR amplification. The heavy chain expression plasmid pQX2.1 was double-digested with HindIII and NheI, and the transient expression plasmid pQX1 was double-digested with HindIII and BamHI. The PCR-amplified genes were then inserted into the corresponding expression plasmids using infusion recombinase to construct the heavy chain expression plasmid pQX2.1-78VH-Hu25 and the light chain expression plasmid pQX2.2-78VK-Hu3. Here, pQX2.2 refers to the pQX1 plasmid expressing the light chain.

[0060] The results of detecting the double digestion of the plasmids by nucleic acid electrophoresis are shown in Figure 1. As can be seen from the results in Figure 1, the PCR amplification of the antibody heavy chain variable region and full-length light chain, and the double digestion of the heavy and light chain expression plasmids, show that the sizes of the heavy and light chain plasmids are approximately 5,000 bp, the heavy chain variable region is approximately 480 bp, and the full-length light chain is approximately 781 bp.

[0061] ExpiCHO-S cells were co-transfected with the sequence-correct heavy chain expression plasmid pQX2.1-78VH-Hu25 (the amino acid sequence of the full-length heavy chain expressed thereby is shown in SEQ ID NO: 10) and the sequence-correct light chain expression plasmid pQX2.2-78VK-Hu3 (the amino acid sequence of the full-length light chain expressed thereby is shown in SEQ ID NO: 11). The day before transfection, 3 × 10 ExpiCHO-S cells were cultured for pre-transfection passage. 6 On the day of transfection, the cell density was adjusted to 6 × 10 6 The cells were diluted to 125 ml / ml and 25 ml of cells were placed in a 125 ml shake flask for transfection. The transfection and expression process is shown in Figure 2.

[0062] Five days after transfection, the culture supernatant was collected and purified in one step using Protein A. The purified antibody was detected by SDS-PAGE electrophoresis and designated QX007N (HZD78-70). The results of protein electrophoresis of this antibody are shown in Figure 3. Protein electrophoresis was performed on a denaturing, reducing gel. As can be seen from the results shown in Figure 3, two bands were observed, with sizes of approximately 50 kDa and 25 kDa, respectively, consistent with the theoretical molecular weights of the heavy chain (49.3 kDa) and light chain (23.4 kDa).

[0063] Example 2 Equilibrium dissociation constant (K D ) measurement The affinity of QX007N (HZD78-70) to human interleukin-33 was detected using a Biacore T200, and all processes were performed at 25°C. A commercially available Protein A chip was used, and an appropriate amount of antibody was immobilized by the capture method to achieve an Rmax of approximately 50 RU and a capture flow rate of 10 μl / min. The antigen was serially diluted, and the instrument flow rate was switched to 30 μl / min. The reference channel and antibody-immobilized channel were run in order of low to high concentration, with buffer running as a negative control. After each binding and dissociation, the chip was regenerated with pH 1.5 glycine. Using the instrument's software, fitting was performed according to a 1:1 binding model in the kinetics section to determine the antibody binding rate constant, k a , dissociation rate constant k d , and the equilibrium dissociation constant K D The value of was calculated.

[0064] We also compared the affinity of QX007N (HZD78-70) with that of etoximab / ANB020, a human interleukin-33 monoclonal antibody developed by AnaptysBio. The detection method for the known antibody was the same as that for QX007N. The results are shown in Table 1. Here, etoximab / ANB020 was generated by the inventors by constructing an expression plasmid based on the APE4909 sequence provided by patent WO2015106080A2 and transiently transfecting ExpiCHO-S cells.

[0065] [Table 1]

[0066] Furthermore, based on the same detection method as above, it was found that etokimab / ANB020 can bind to interleukin-33 in cynomolgus monkeys and rhesus monkeys, and that QX007N (HZD78-70) can bind to interleukin-33 in cynomolgus monkeys but not in rhesus monkeys.

[0067] Example 3 Detection of Neutralizing Activity of NF-κB / AP-1 Signaling in HEK Blue™ IL-33 Cells Induced by Human Interleukin-33 HEK Blue™ IL-33 cells are generated by stably transfecting human embryonic kidney cells (HEK293) with the human IL1RL1 gene, blocking responses to TNF-α and IL-1β, thereby specifically responding to IL-33. Interleukin-33 binds to cell surface IL-1RL1 / IL-1RAcP, triggering a signaling cascade that leads to NF-κB / AP-1 signaling and the production of secreted alkaline phosphatase (SEAP), allowing for detection of interleukin-33 biological activity or antibody screening.

[0068] The neutralizing activity of QX007N (HZD78-70) against human interleukin-33 was measured using HEK Blue™ IL-33 cells. HEK Blue™ IL-33 cells were cultured at 4 x 10 per well. 4 Cells were seeded onto a 96-well plate and cultured overnight at 37°C and 5% CO2. The antibodies were diluted to a concentration range of 0 to 500 ng / ml, and the diluted solutions were uniformly mixed with 2 ng / ml recombinant human interleukin-33 and incubated for 1 hour. After incubation, the mixture was added to the cells and cultured for 24 hours at 37°C and 5% CO2. The cell culture supernatant was collected, and QUANTI-Blue™ detection reagent (InvivoGen, rep-qbs2) was added at a ratio of 1:10. The mixture was incubated at 37°C for 1 hour, and the OD was measured using a Varioskan LUX multifunction microplate reader. 630nm The values ​​were detected and the analyzed data was fitted using a four-parameter curve using softMaxPro software (Figure 4) to further analyze the antagonistic activity of the antibodies.

[0069] As can be seen from the results shown in Figure 4, QX007N (HZD78-70) can inhibit NF-κB / AP-1 signaling in HEK Blue™ IL-33 cells induced by recombinant human interleukin-33, and its IC 50 The IC measured using the same method for etokimab / ANB020 was 6.67 ng / ml. 50 was 6.05ng / ml.

[0070] Example 4 Detection of the activity of neutralizing NF-κB / AP-1 signaling in HEK Blue™ IL-33 cells induced by native human interleukin-33 Native human interleukin-33 was prepared and the neutralizing activity of QX007N (HZD78-70) against native human interleukin-33 was examined. HFL-1 cells were cultured and induced with 200 ng / ml TNF-α for 24 hours. After incubation, the cells were harvested and lysed by repeated freeze-thawing. The supernatant contained human interleukin-33, and its activity was examined using HEK Blue™ IL-33 cells.

[0071] 4 x 10 HEK Blue™ IL-33 cells per well 4 Cells were seeded into a 96-well plate and cultured overnight at 37°C and 5% CO2. The antibody was diluted to a concentration range of 0-1000 ng / ml, and the dilution solution and native human interleukin-33 were added. After uniform mixing, the cells were added and cultured for 24 hours at 37°C and 5% CO2. The cell culture supernatant was collected, and QUANTI-Blue™ detection reagent was added at a ratio of 1:10. The reaction was allowed to proceed at 37°C for 1 hour, and the OD was measured using a Varioskan LUX multifunction microplate reader. 630nm The values ​​were detected, and the analysis data was fitted using a four-parameter curve using softMax Pro software (Figure 5), to further analyze the neutralizing activity of the antibodies.

[0072] As can be seen from the results shown in Figure 5, QX007N (HZD78-70) can inhibit NF-κB / AP-1 signaling in HEK Blue™ IL-33 cells induced by native human interleukin-33, and its IC 50 The IC measured using the same method for etoximab / ANB020 was 3.91 ng / ml. 50 was 2.5ng / ml.

[0073] Example 5 Detection of the activity of neutralizing IL-5 release from KU812 (human peripheral blood basophilic leukemia cells) induced by human interleukin-33 The human interleukin-33 neutralizing activity of QX007N (HZD78-70) was evaluated using human interleukin-33 (IL-33)-inducing IL-5 release from KU812 (human peripheral blood basophilic leukemia cells). 5 The cells (cells / well) were seeded into a 96-well plate, and antibodies and recombinant human interleukin-33 (final concentration 4 ng / ml) were added. The cells were cultured at 37°C and 5% CO for 24 hours. The cell culture supernatant was collected and the expression level of IL-5 in the supernatant was detected using Human IL-5 DuoSet ELISA (R&D, DY205). The OD was measured using a Varioskan LUX multifunction microplate reader. 450nm The values ​​were detected and the analyzed data was fitted using a four-parameter curve using SoftMax Pro software (Figure 6), and the neutralizing activity of the antibodies was further analyzed.

[0074] As can be seen from the results shown in Figure 6, QX007N (HZD78-70) was able to neutralize the IL-5 release activity from KU812 (human peripheral blood basophilic leukemia cells) induced by human interleukin-33, and its IC 50 The IC measured using the same method for etoximab / ANB020 was 5.87 ng / ml. 50 was 44ng / ml.

[0075] Example 6 Detection of the activity of neutralizing the release of IFN-γ from human whole blood induced by human interleukin-33 The neutralizing activity of QX007N (HZD78-70) was further characterized using human whole blood monocytes as a metric and IFN-γ as a metric. Whole blood from healthy volunteers was plated (100 μL / well), and the antibody and recombinant human interleukin-33 (final concentration 4 ng / ml) were added. The antibody and recombinant human interleukin-33 were incubated at 37°C and 5% CO for 24 hours. OD measurements were measured using a Varioskan LUX multifunction microplate reader. 450nmThe values ​​were detected and the analyzed data was fitted using a four-parameter curve using SoftMax Pro software (Figure 7), and the neutralizing activity of the antibodies was further analyzed.

[0076] As can be seen from the results shown in Figure 7, QX007N (HZD78-70) was able to neutralize the IFN-γ release activity from human whole blood induced by human interleukin-33, and its IC 50 The IC was 16 ng / ml, whereas for etokimab / ANB020, the IC was 16 ng / ml, measured using the same method. 50 was 31.9ng / ml.

Claims

1. An isolated anti-human interleukin-33 monoclonal antibody comprising three heavy chain complementarity determining regions, CDR-H1, CDR-H2, and CDR-H3, and three light chain complementarity determining regions, CDR-L1, CDR-L2, and CDR-L3, The amino acid sequence of the CDR-H1 is shown in SEQ ID NO: 1; The amino acid sequence of the CDR-H2 is shown in SEQ ID NO:2; The amino acid sequence of the CDR-H3 is shown in SEQ ID NO:3; The amino acid sequence of the CDR-L1 is shown in SEQ ID NO:4; The amino acid sequence of said CDR-L2 is set forth in SEQ ID NO:5; and The monoclonal antibody, wherein the amino acid sequence of the CDR-L3 is set forth in SEQ ID NO:

6.

2. comprising a heavy chain variable region and a light chain variable region, the amino acid sequence of the heavy chain variable region is set forth in SEQ ID NO:7; and The monoclonal antibody of claim 1, wherein the amino acid sequence of the light chain variable region is set forth in SEQ ID NO:

8.

3. An isolated nucleic acid encoding the monoclonal antibody of claim 1 or 2.

4. A host cell comprising the nucleic acid of claim 3.

5. A method for producing a monoclonal antibody, comprising culturing the host cell of claim 4 to produce the monoclonal antibody of claim 1 or 2.

6. A pharmaceutical composition comprising the monoclonal antibody of claim 1 or 2 and a pharmaceutically acceptable carrier.

7. The pharmaceutical composition according to claim 6, which is used for the treatment of diseases associated with human interleukin-33 mediated signal transduction.

8. The pharmaceutical composition according to claim 7, wherein the disease associated with human interleukin-33-mediated signaling is any one or more selected from the group consisting of asthma, chronic obstructive pulmonary disease, age-related macular degeneration, chronic sinusitis, atopic dermatitis, multiple sclerosis, arthritis, and inflammatory bowel disease.

9. Use of the monoclonal antibody of claim 1 or 2 in the preparation of a medicament for treating a disease associated with interleukin-33 mediated signaling.

10. 10. The use according to claim 9, wherein the disease associated with human interleukin-33-mediated signaling is any one or more selected from the group consisting of asthma, chronic obstructive pulmonary disease, age-related macular degeneration, chronic sinusitis, atopic dermatitis, multiple sclerosis, arthritis, and inflammatory bowel disease.

Images