Biomarkers for the efficacy of anti-CD26 antibodies

Abstract

To provide a method for selecting cancer patients having a possibility of benefitting from the therapy by anti-CD26 antibody.SOLUTION: A method includes: comparing a level of soluble CD26 in blood serum of a patient before reference dose of anti-CD26 antibody with a level of the soluble CD26 in the serum of the patient in a measurement date; and when the level of the soluble CD26 in the serum of the patient inf the measurement date is less than 85% of the level of the soluble CD26 in the serum of the patient before the reference dose, selecting the patient as a person who has a possibility of benefiting a therapy by the anti-CD26 antibody. Herein, the measurement day is the first-60th day, with the reference dose date defined as the first day and the patient has been administered the anti-CD26 antibody at least once as the reference dose and, when the measurement date falls under the dose date of the anti-CD 26 antibody, the level of the soluble CD26 in the serum of the patient in the measurement date is the level of the soluble CD26 in the serum of the patient before the administration of the anti-CD26 antibody in the measurement date.SELECTED DRAWING: None

Description

[Technical Field]

[0001] This invention relates to a biomarker for determining the efficacy of an anti-CD26 antibody. [Background technology]

[0002] CD26 is a 110 kDa type II transmembrane glycoprotein with dipeptidyl peptidase 4 (DPP4) activity in its extracellular domain, and its N-terminal dipeptide can be cleaved at the front-terminal position with L-proline or L-alanine (Non-Patent Literature 1, 2). CD26 has multiple biological functions and is expressed in various normal cell types and tumors. CD26 is also found in serum and other bodily fluids as a soluble form with DPP4 activity. In vitro and in vivo administration of anti-CD26 monoclonal antibodies inhibits tumor growth, migration, and invasion through multiple mechanisms of action and extends the survival of mouse xenograft models inoculated with various cancers, including renal cell carcinoma (RCC) and malignant mesothelioma (MM) (Non-Patent Literature 3-7).

[0003] Recently, a Phase I First-in-Human (FIH) clinical trial of YS110 was conducted in patients with CD26-expressing solid tumors (23 with MM, 9 with RCC, and 1 with urothelial carcinoma (UTC)) (Non-Patent Literature 8), demonstrating that YS110 therapy exhibits a favorable safety profile and promotes disease control in patients with advanced / refractory tumors.

[0004] In cancer treatment, determining whether a treatment is effective is crucial to the treatment strategy. For solid tumors, for example, the effectiveness of a treatment is determined by checking its efficacy four weeks after administration, based on criteria such as RECIST. However, the use of biomarkers is expected to provide a faster and simpler method for evaluating efficacy. Biomarkers in cancer management can be used for prevention, diagnosis, treatment selection, and potentially treatment monitoring. Markers such as EGFR or ALK fusion genes (lung cancer), HER2 (breast or gastric cancer), or RAS (colon cancer) are used to select the optimal treatment by identifying the chosen genetic mutation. However, serum biomarkers that predict outcomes during the course of cancer treatment have not yet been identified.

[0005] Serum levels of soluble CD26 have been evaluated as a potential biomarker. In patients with urothelial carcinoma, gastric cancer, pancreatic cancer, thyroid cancer, and lung cancer, correlations between baseline serum soluble CD26 titers and the clinical efficacy of treatment have been reported (Non-Patent Literature 9-14). Changes in serum soluble CD26 titers after colon cancer surgery have also been reported as a predictive biomarker for the risk of recurrence or metastasis (Non-Patent Literature 15-17). Furthermore, treatment with the DPP4 inhibitor sitagliptin after colorectal or lung cancer surgery in diabetic patients was associated with longer overall survival than treatment with other antidiabetic drugs (Non-Patent Literature 18), suggesting that soluble CD26 / DPP4 may play some role in regulating antitumor activity. However, there are no reports that changes in serum soluble CD26 titers during the course of treatment are a prognostic marker for treatment outcomes. [Prior art documents] [Patent Documents]

[0006] [Patent Document 1] International Publication No. WO02 / 14462 [Patent Document 2] International Publication No. WO2007 / 014169 [Patent Document 3] International Publication No. WO2008 / 114876

Non-licensed literature

[0007]

Non-licensed literature 1

Non-licensed Document 2

Non-licensed Document 4

Non-licensed Document 5

Non-licensed Document 6

Non-licensed Document 7

Non-licensed literature 9

Non-licensed literature 10

Non-licensed Document 11

Non-Patent Document 12

Non-Patent Document 13

Non-Patent Document 14

Non-Patent Document 15

Non-Patent Document 16

Non-Patent Document 17

Non-Patent Document 18

Summary of the Invention

[0008] In a phase I first-in-human (FIH) clinical trial using the humanized antibody YS110 in patients with CD26-expressing tumors, a transient decrease and subsequent recovery of serum soluble CD26 / DPP4 titer were observed during the 4 weeks of the first cycle of YS110 administration. In this study, the correlation between the fluctuations of soluble CD26 / DPP4 titer and efficacy measurement items determined by response according to the RECIST criteria or progression-free survival (PFS) was analyzed in a total of 26 evaluable cases or stratified groups to identify potential prognostic biomarkers for YS110 treatment.

Brief Description of the Drawings

[0009] [Figure 1] This figure shows the changes in serum soluble CD26 levels after YS110 administration, as analyzed by box plot analysis. Each figure shows the change in serum soluble CD26 titer from baseline (before administration on day 1, 100%) to before / after YS110 administration on days 1, 15, and 29. The analyzed data were stratified into (A) 26 total cases, (B) 18 cases administered Q2W, (C) 14 male cases administered Q2W, (D) 8 cases administered Q1W, (E) 19 MM cases, (F) 12 MM cases administered Q2W, (G) 9 male MM cases administered Q2W, and (H) 6 RCC cases. The data are shown as the mean ± standard deviation for each group. [Figure 2] This shows the correlation between serum soluble CD26 levels and DPP4 enzyme activity. (A) Shows the correlation between serum soluble CD26 levels (ng / ml) and serum DPP4 enzyme activity (μM / min). (B) Shows the correlation between the change in serum soluble CD26 titer from baseline (%) and serum DPP4 titer (%) from baseline. Both were examined using non-zero correlation. [Figure 3] This figure shows the relationship between changes in serum soluble CD26 titer and tumor volume changes, as analyzed by scatter plot analysis. The figures illustrate the changes in serum soluble CD26 titer from baseline (before day 1 administration, 100%) of 25 YS110-treated patients at (A) after day 1 administration, (B) before day 15 administration, (C) after day 15 administration, (D) before day 29 administration, and (E) after day 29 administration, as well as the change in tumor volume at day 43 according to RECIST criteria. The data were divided into SD (gray circles) and PD (white circles) cohorts. The figures show the change from baseline in serum soluble CD26 titer before YS110 administration on day 29, and the change in tumor volume on day 43 according to RECIST response criteria, for (F) 17 patients administered Q2W, (G) 14 male patients administered Q2W, (H) 18 MM patients, (I) 11 MM patients administered Q2W, (J) MM patients and 9 male patients administered Q2W, and (K) 6 RCC patients administered Q2W. [Figure 4]This bar graph analysis shows the difference in serum soluble CD26 titer changes between the SD cohort and the PD cohort. The differences in serum soluble CD26 titer changes from baseline (before day 1 administration, 100%) before YS110 administration on days 1, 15, and 29 were analyzed between the SD and PD cohorts. The analyzed data were stratified into (A) total 23 cases, (B) 17 cases administered Q2W, (C) 14 males administered Q2W, (D) 8 cases administered Q1W, (E) 17 MM cases, (F) 11 MM cases administered Q2W, (F) 9 males administered MM and Q2W, and (H) 6 RCC cases administered Q2W. Data are shown as the mean ± standard deviation for each group. [Figure 5] This paper shows the cell surface protein expression of CD26 in human tumor and non-tumor cells. The malignant mesothelioma cell line (A) or non-tumor cells (B) shown were stained with PE-labeled mouse IgG1, κ isotype control (BioLegend, clone MOPC-21(i)) or PE-labeled mouse anti-human CD26 mAb (BD Biosciences, clone M-A261(ii)). CD26 cell surface expression was analyzed by flow cytometry. A two-dimensional dot plot (horizontal axis: CD26, vertical axis: unstained) (upper panel) and a histogram of CD26 intensity (red line) and a gated isotype control for live cells (gray area) (lower panel) are shown. Representative plots and histograms from three independent experiments are shown, with similar results obtained in each experiment. Among the cell lines used in this experiment, CD26 was clearly expressed on the cell surface of MSTO-CD26, JMNctrl-shRNA, H226, TIG-1, and HDMVEC. On the other hand, CD26 was hardly expressed in the parent strain of MSTO, JMN CD26-shRNA, MCF10A, and HUVEC, but was partially expressed in MeT-5A. [Figure 6]The addition of YS110 reduced soluble CD26 production from CD26-positive tumor and non-tumor cells. (A, B) MM cell lines (MSTO parent, MSTO-CD26, JMNctrl-shRNA, JMNCD26-shRNA, or H226 cells (3.5 × 10⁴ each)) (A) or non-tumor cells (MCF10A (1.0 × 10⁵), HUVEC (9.0 × 10⁴), MeT-5A (6.0 × 10⁴), TIG-1 (5.0 × 10⁴), or HDMVEC cells (9.0 × 10⁴)) (B) were incubated with control human IgG (hIgG) or humanized anti-CD26 monoclonal antibody YS110 (10 μg / ml each) for 72 hours. (C) MSTO-CD26 or TIG-1 cells were incubated with specified concentrations of YS110 for 3 days. (D) MSTO-CD26 cells were incubated with specified concentrations of YS110 for 1, 3, or 7 days. The soluble CD26 concentration in the culture supernatant was measured by ELISA. The dashed line indicates the detection limit (0.488 ng / ml), and ND indicates "not detected" (below the detection limit). Representative data from three independent experiments are shown as the mean ± SD (standard deviation) of the four samples. When comparing the values ​​of YS110 with vehicle or control human IgG (*p<0.01), similar results were obtained in each experiment. [Modes for carrying out the invention]

[0010] As used herein, “treatment” is an approach to obtain a beneficial or desired clinical outcome. For the purposes of the present invention, beneficial or desired clinical outcomes include, but are not limited to, the reduction of one or more symptoms, the reduction of the scope of the disease, a stabilization (i.e., non-worsening) state of the disease, a delay or slowing of disease progression, recovery or remission of the disease state, and remission (partial or complete), whether detectable or undetectable. “Treatment” also means extending life expectancy compared to the expected life expectancy if no treatment is received.

[0011] An "effective dose" is an amount sufficient to achieve beneficial or desired clinical outcomes, including clinical results. An effective dose may be administered in one or more doses. For the purposes of the present invention, an effective dose of the pharmaceutical composition described herein is an amount sufficient to delay the progression of a condition associated with tumor growth. As is understood in the art, for example, an effective dose of the pharmaceutical composition may vary or depend on other factors, such as the patient's medical history and the type (and / or amount) of the pharmaceutical composition used.

[0012] The pharmaceutical compositions of the present invention may contain pharmaceutically acceptable carriers. As used herein, “pharmaceutically acceptable carrier” or “pharmaceutically acceptable excipient” includes any material that, when combined with the active ingredient, allows the active ingredient to maintain its biological activity, is non-reactive with the subject’s immune system upon delivery, and is non-toxic to the subject. Examples include, but are not limited to, all standard pharmaceutical carriers such as phosphate-buffered saline, water, emulsions such as oil / water emulsions, and various types of wetting agents. Preferred diluents for spray or parenteral administration are phosphate-buffered saline or physiological saline (0.9%). Compositions containing such carriers are formulated by well-known conventional methods (see, for example, Remington’s Pharmaceutical Sciences, 18th edition, edited by A. Gennaro, Mack Publishing Co., Easton, PA, 1990 and Remington, The Science and Practice of Pharmacy, 20th Ed., Mack Publishing, 2000).

[0013] In certain embodiments, the "anti-CD26 antibody" as used herein specifically binds to human CD26. In certain embodiments, the anti-CD26 antibody described herein binds to the same epitope as YS110. In certain embodiments, the anti-CD26 antibody described herein is capable of blocking the binding of YS110 to CD26 (competes with YS110) in a competition assay. The competition assay can be performed by contacting the test antibody with the immobilized epitope or antigen, removing the unbound antibody by washing, then contacting the labeled YS110 antibody with the epitope or antigen, and detecting the bound YS110 antibody after removing the unbound antibody by washing. If the binding of the YS110 antibody to the epitope or antigen when contacted with the test antibody is decreased compared to the binding of the YS110 antibody to the epitope or antigen in a control not contacted with the test antibody, it can be determined that the test antibody has the ability to block the binding of the YS110 antibody (competes with the YS110 antibody) in the competition assay.

[0014] The binding affinity of the anti-CD26 antibody used herein to human CD26 is -5 less than 10 -5 M, less than 5×10 -6 M, less than 10 0-7 M, less than 5×1 -7 M, less than 10 -8 M, less than 5×10 -8 M, less than 10 -9 M, less than 5×10 -9 M, less than 10 -10 M, less than 5×10 -10 M, less than 10 -11 M, less than or 10 -11 M, and the affinity having a dissociation constant (i.e., Kd). The dissociation constant can also be 10 -15 M or more, 5×10 -15 M or more, 10 -14 M or more, 5×10 -14 M or more, 10 -13 M or more, 5×10 -13 M or more, 10 -12 M or more, 5×10 -12M or above, 10 -11 M or more, 5×10 -11 M or above, 10 -10 M or larger or 5×10 -10 The affinity may be M or higher. Methods for determining affinity are known in the art. For example, binding affinity may be determined using BIAcore biosensors, KinExA biosensors, scintillation proximity assays, ELISA, ORIGEN immunoassay (IGEN), fluorescence quenching, fluorescence transfer, and / or yeast displays. Affinity may also be screened using appropriate bioassays.

[0015] One method for determining the binding affinity of an antibody to CD26 is to measure the affinity of the antibody's monofunctional Fab fragment. To obtain the monofunctional Fab fragment, the antibody, for example, IgG, can be cleaved with papain or expressed by recombinant technology. The affinity of the anti-CD26 Fab fragment of a monoclonal antibody can be determined by a surface plasmon resonance (SPR) system (BIAcore 3000®, BIAcore, Piscaway, NJ). The SA tip (streptavidin) is used according to the supplier's instructions. Biotinylated CD26 can be diluted in HBS-EP (100mM HEPES pH 7.4, 150mM NaCl, 3mM EDTA, 0.005% P20) and injected onto the tip at a concentration of 0.005 mg / mL. Two ranges of antigen density are achieved using variable flow times across individual tip channels: 10–20 response units (RU) for detailed kinetic testing and 500–600 RU for concentration. A mixture of Pierce elution buffer and 4M NaCl (2:1) efficiently removes bound Fab while maintaining CD26 activity on the tip for more than 200 injections. HBS-EP buffer can be used as the running buffer for all BIAcore assays. Step dilutions of purified Fab samples (0.1–10 × estimated KD) are injected at 100 μL / min for 2 minutes, with dissociation times up to 30 minutes usually acceptable. Fab protein concentrations can be determined by ELISA and / or SDS-PAGE electrophoresis using standard Fab at known concentrations (determined by amino acid analysis). The reaction rates of binding (kon) and dissociation (koff) are obtained simultaneously by fitting the data to a 1:1 Langmuir binding model using the BIAevaluation program (Lofas & Johnsson, 1990). The equilibrium dissociation constant (KD) value is calculated as koff / kon.

[0016] The compositions of the present invention are useful for treating conditions (diseases or disorders, etc.) associated with CD26 expression, such as malignant mesothelioma. In some embodiments, the compositions of the present invention may have one or more of the following characteristics: (a) binding to CD26, (b) regulating CD26 activity, (c) arresting the cell cycle of CD26+ cells at the G1 / S checkpoint, (d) inhibiting the proliferation of CD26-expressing cells (e.g., malignant mesothelioma), (e) inhibiting the binding of CD26 to the extracellular matrix, and / or (f) being useful for treating conditions associated with CD26 expression. In some embodiments, the condition associated with CD26 expression is a disease or disorder associated with the overexpression of CD26. In some embodiments, the condition associated with CD26 expression is at least partially mediated by CD26. In some embodiments, the condition associated with CD26 expression is a condition associated with the proliferation of cells expressing CD26. In some embodiments, the disease or disorder is cancer (e.g., malignant mesothelioma, lung cancer, kidney cancer, liver cancer, or other malignant tumors with CD26 expression).

[0017] In one embodiment, the anti-CD26 antibody includes both a heavy chain variable region containing an amino acid sequence having at least about 80% identity with an amino acid sequence selected from the group consisting of SEQ ID NOs: 8-14, and a light chain variable region containing an amino acid sequence having at least about 80% identity with an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-7. In one embodiment, the anti-CD26 antibody contained in the pharmaceutical composition of the present invention includes a light chain variable region containing an amino acid sequence having at least about 80% identity with an amino acid sequence selected from the group consisting of SEQ ID NOs: 8-14, and a heavy chain variable region containing an amino acid sequence having at least about 80% identity with an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-7.

[0018] In one embodiment, the anti-CD26 antibody contains at least five consecutive amino acids, at least eight consecutive amino acids, at least about ten consecutive amino acids, at least about fifteen consecutive amino acids, at least about twenty consecutive amino acids, at least about thirty consecutive amino acids, or at least about fifty consecutive amino acids from any one of the amino acid sequences of SEQ ID NOs: 1-14.

[0019] The anti-CD26 antibody may be a fragment of an antibody sequence as described herein, and may include a fragment having a length of at least about 50 amino acids, at least about 75 amino acids, or at least about 100 amino acids.

[0020] Sequence ID: 15 EVQLVX1SGX2X3X4X5QPGX6X7LRLX8CX9ASGX10X11LX11LX12TYGVHWVRQAPGKGLEWX13GVIWGX14GRTDYDX15X16FMSRVTISX17DX18SKX19TX20YLQX21NSLRAEDTAVYYCX22RX23RHDWFDYWGQGTTVTVSS

[0021] In the above sequence, X1 is E or Q, X2 is A or G, X3 is G or E, X4 is L or V, X5 is V, K, or E, X6 is G or E, X7 is T or S, X8 is T or S, X9 is T or K, X10 is F or Y, X11 is S or T, X12 is T, N, or S, X13 is V or M, X14 is G or D, X15 is A or S, X16 is A or S, X17 is K or R, X18 is N or T, X19 is S or N, X20 is V or A, X21 is M or L, X22 is V, M, or T, and X23 is N or S.

[0022] Sequence ID 16 XIIX2X3TQSPSSLSX4X5X6GX7RX8TIX9CX10ASQX11IRNX12LNWYQQKPGQAPRLLIYYSSNLXI3X14GVPX15RFSGSGGTDFTLTISRLX16X17EDX18AX19YYCQQSX20KLPX21TFGSGTKVEIK

[0023] In the above sequence, X1 is D or E, X2 is L or E, X3 is M or L, X4 is A or V, X5 is S or T, X6 is L, P, or A, X7 is D or E, X8 is V or A, X9 is T or S, X10 is S or R, X11 is G or D, X12 is S or N, X13 is H or Q, X14 is S or T, X15 is S, D, or A, X16 is E or Q, X17 is P or A, X18 is F or V, X19 is T, A, or I, X20 is I or N, and X21 is F or L.

[0024] Table 1 shows the amino acid sequences of the humanized VL variants X376 (SEQ ID NO: 1), X377 (SEQ ID NO: 2), X378 (SEQ ID NO: 3), X379 (SEQ ID NO: 4), X380 (SEQ ID NO: 5), X381 (SEQ ID NO: 6), and X394 (SEQ ID NO: 7). The schemes labeled with Kabat numbers and SEQ ID NOs correspond to the light chain variable regions.

[0025] Table 2 shows the amino acid sequences of the humanized VH variants X384 (SEQ ID NO: 8), X385 (SEQ ID NO: 9), X386 (SEQ ID NO: 10), X387 (SEQ ID NO: 11), and X388 (SEQ ID NO: 12), X399 (SEQ ID NO: 13), and X420 (SEQ ID NO: 14). Both the SEQ ID NOs and the Kabat number scheme are shown. The Kabat number scheme includes 82a, 82b, and 82c.

[0026] [Table 1]

[0027] [Table 2]

[0028] The anti-CD26 antibody may further comprise SEQ ID NO: 17 or fragments or variants thereof. In one embodiment, the anti-CD26 antibody comprises SEQ ID NO: 17. In one embodiment, the anti-CD26 antibody comprises SEQ ID NO: 17 excluding the signal sequence (those skilled in the art will readily understand that in one embodiment, the signal sequence of the antibody is cleaved from the antibody). In one embodiment, the anti-CD26 antibody comprises the variable region of SEQ ID NO: 17. In one embodiment, the anti-CD26 antibody comprises an antibody (or fragment thereof) having at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 98% identity with respect to SEQ ID NO: 17. In one embodiment, the anti-CD26 antibody comprises a fragment of SEQ ID NO: 17, comprising fragments of at least about 10 amino acids, at least about 25 amino acids, at least about 50 amino acids, at least about 75 amino acids, or at least about 100 amino acids in length. In one embodiment, the anti-CD26 antibody binds to human CD26.

[0029] Heavy chain (SEQ ID NO: 17) MEWSWVFLFFLSVTTGVHSEVQLVESGAGVKQPGTLRTCTASGFSLTTYGVHWVRQAPGKGLEWVGVIWGDGRTDYDAAFMSRVTISKDTSKSTVYLQMNSLRAEDTAVYYCMRNRHDWFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

[0030] The anti-CD26 antibody further comprises SEQ ID NO: 18, or a fragment or variant thereof. In one embodiment, the anti-CD26 antibody comprises SEQ ID NO: 18. In one embodiment, the anti-CD26 antibody comprises SEQ ID NO: 18 excluding the signal sequence. (Those skilled in the art will readily understand that in one embodiment, the signal sequence of the antibody is cleaved from the antibody.) In one embodiment, the anti-CD26 antibody comprises the variable region of SEQ ID NO: 18. In one embodiment, the anti-CD26 antibody comprises an antibody (or a fragment thereof) having at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 98% identity with respect to SEQ ID NO: 18. In one embodiment, the anti-CD26 antibody comprises a fragment of SEQ ID NO: 18, comprising a fragment of at least about 10 amino acids, at least about 25 amino acids, at least about 50 amino acids, at least about 75 amino acids, or at least about 100 amino acids in length. In one embodiment, the anti-CD26 antibody further comprises SEQ ID NO: 18, or a fragment or variant thereof. In one embodiment, the anti-CD26 antibody binds to human CD26. For example, in one embodiment, the anti-CD26 antibody is an antibody comprising at least one heavy chain (e.g., two heavy chains) each containing sequence number 17 without a signal sequence, and at least one light chain (e.g., two light chains) each containing sequence number 18 without a signal sequence.

[0031] Light chain (Sequence number 18) MSVPTQVLGLLLLWLTDARCDILLTQSPSSLSATPGERATITCRASQGIRNNLNWYQQKPGQAPRLLIYYSSNLQSGVPSRFSGSGSGTDFTLTISRLQPEDVAAYYCQQSIKLPFT FGSGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

[0032] In this specification, "YS110," a humanized anti-CD26 antibody, refers to an antibody in which the heavy chain constant region consists of the amino acid sequence described in SEQ ID NO: 17, and the light chain constant region consists of the amino acid sequence described in SEQ ID NO: 18. It has been reported that YS110, upon binding to CD26 on the membrane of malignant tumor cells, is taken up into the cell and further translocated into the nucleus (Yamada K et al, Plos One, 2013 Apr 29;8(4):e62304). More specifically, it is thought that YS110 is taken up into the cytoplasm by Caveolin-dependent endocytosis and transported into the nucleus by early endocytic vesicles. That is, the anti-CD26 antibody of the present invention may be an antibody that, upon binding to CD26 on the membrane of malignant tumor cells, is taken up into the cell and further translocated into the nucleus. Whether an antibody binds to CD26 on the cell membrane of a malignant tumor cell, is taken up into the cell, and whether it translocates further into the nucleus can be determined by contacting the labeled antibody with the cell, detecting the antibody's location based on the label using a microscope, and determining the positional relationship between that location and the tissue within the cell.

[0033] In another aspect, the anti-CD26 antibody binds to one or more peptides selected from the group consisting of YSLRWISDHEYLY (SEQ ID NO: 19; peptide 6), LEYNYVKQWRHSY (SEQ ID NO: 20; peptide 35), TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55), LWWSPNGTFLAYA (SEQ ID NO: 22; peptide 84), RISLQWLRRIQNY (SEQ ID NO: 23; peptide 132), YVKQWRHSYTASY (SEQ ID NO: 24; peptide 37), EEEVFSAYSALWW (SEQ ID NO: 25; peptide 79), DYSISPDGQFILL (SEQ ID NO: 26; peptide 29), SISPDGQFILLEY (SEQ ID NO: 27; peptide 30), and IYVKIEPNLPSYR (SEQ ID NO: 28; peptide 63). In one embodiment, the anti-CD26 antibody specifically binds to one or more of the aforementioned peptides. These peptides are regions of human CD26. In one embodiment, the anti-CD26 antibody specifically binds to one or more peptides selected from the group consisting of YSLRWISDHEYLY (SEQ ID NO: 19; peptide 6), LEYNYVKQWRHSY (SEQ ID NO: 20; peptide 35), TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55), LWWSPNGTFLAYA (SEQ ID NO: 22; peptide 84), RISLQWLRRIQNY (SEQ ID NO: 23; peptide 132), YVKQWRHSYTASY (SEQ ID NO: 24; peptide 37), EEEVFSAYSALWW (SEQ ID NO: 25; peptide 79), DYSISPDGQFILL (SEQ ID NO: 26; peptide 29), SISPDGQFILLEY (SEQ ID NO: 27; peptide 30), and IYVKIEPNLPSYR (SEQ ID NO: 28; peptide 63), compared to one or more peptides corresponding to other regions of human CD26.

[0034] In one embodiment, the anti-CD26 antibody binds to each of the following peptides: YSLRWISDHEYLY (SEQ ID NO: 19; Peptide 6); LEYNYVKQWRHSY (SEQ ID NO: 20; Peptide 35); TWSPVGHKLAYVW (SEQ ID NO: 21; Peptide 55); LWWSPNGTFLAYA (SEQ ID NO: 22; Peptide 84); and RISLQWLRRIQNY (SEQ ID NO: 23; Peptide 132). In another embodiment, the anti-CD26 antibody binds to each of the following peptides: YSLRWISDHEYLY (SEQ ID NO: 19; Peptide 6); TWSPVGHKLAYVW (SEQ ID NO: 21; Peptide 55); RISLQWLRRIQNY (SEQ ID NO: 23; Peptide 132); YVKQWRHSYTASY (SEQ ID NO: 24; Peptide 37); and EEEVFSAYSALWW (SEQ ID NO: 25; Peptide 79). In one embodiment, the anti-CD26 antibody binds to each of the following peptides: DYSISPDGQFILL (SEQ ID NO: 26; Peptide 29); SISPDGQFILLEY (SEQ ID NO: 27; Peptide 30); and TWSPVGHKLAYVW (SEQ ID NO: 21; Peptide 55). In another embodiment, the anti-CD26 antibody binds to each of the following peptides: DYSISPDGQFILL (SEQ ID NO: 26; Peptide 29); SISPDGQFILLEY (SEQ ID NO: 27; Peptide 30); TWSPVGHKLAYVW (SEQ ID NO: 21; Peptide 55); and IYVKIEPNLPSYR (SEQ ID NO: 28; Peptide 63).

[0035] Competitive assays can be used to determine whether two antibodies bind to the same epitope by recognizing the same or sterically overlapping epitopes. Typically, the antigen is immobilized on a multiwell plate, and the ability of an unlabeled antibody to block the binding of a labeled antibody is measured. Common labels for such competitive assays are radiolabeling or enzymatic labeling. Furthermore, epitopes to which antibodies bind can be determined by using epitope mapping techniques known to those skilled in the art.

[0036] In one embodiment, the anti-CD26 antibody includes one or more constant regions. In one embodiment, the anti-CD26 antibody includes a human constant region. In one embodiment, the constant region is a heavy chain constant region. In another embodiment, the constant region is a light chain constant region. In one embodiment, the anti-CD26 antibody includes a constant region having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or 100% identity with a human constant region. In one embodiment, the anti-CD26 antibody includes an Fc region. In one embodiment, the anti-CD26 antibody includes a human Fc region. In one embodiment, the anti-CD26 antibody includes an Fc region having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or 100% identity with a human Fc region.

[0037] In one embodiment, the anti-CD26 antibody is an IgG antibody. In another embodiment, the anti-CD26 antibody is an IgG1 antibody. In yet another embodiment, the anti-CD26 antibody is an IgG2 antibody. In yet another embodiment, the anti-CD26 antibody is a human IgG antibody.

[0038] Anti-CD26 antibodies may be monomeric, dimeric, or multimeric antibodies. For example, bispecific antibodies, monoclonal antibodies having binding specificity to at least two different antigens, can be prepared using the antibodies disclosed herein (see, e.g., Suresh et al., Methods in Enzymology, 1986, 121, 210). Conventionally, recombinant production of bispecific antibodies has been based on the co-expression of two sets of heavy-light chain pairs of immunoglobulins, each containing two heavy chains with different specificities (Millstein, Cuello, Nature, 1983, 305, 537-539).

[0039] According to one approach for producing bispecific antibodies, the antibody variable region (antibody-antigen binding site) having the desired binding specificity is fused to the constant region of the immunoglobulin. Preferably, the fusion portion includes the heavy chain constant region of the immunoglobulin, including at least the hinge region, CH2, and CH3 regions. It is preferable that at least one fusion portion has a first heavy chain constant region (CH1) containing a site essential for light chain binding. The DNA encoding the immunoglobulin heavy chain fusion and, if desired, the DNA encoding the immunoglobulin light chain are inserted into separate expression vectors and simultaneously transfected into a suitable host organism. In embodiments where the unequal ratio of the three antibody chains used in construction provides the optimal yield, the mutual proportions of these three antibodies can be prepared with high flexibility. If equal ratio expression of at least two antibodies yields a high yield, or if the ratio is not particularly important, the coding sequences of two or all three antibodies may be inserted into a single expression vector.

[0040] One approach involves a bispecific antibody composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm and a hybrid heavy-light chain pair (with a second binding specificity) in the other arm. This asymmetric structure (having an immunoglobulin light chain in only half of the bispecific antibody molecule) facilitates the separation of the desired bispecific compound from undesirable immunoglobulin chain combinations. This approach is described in International Publication No. 94 / 04690, published on March 3, 1994.

[0041] Heteroconjugated antibodies, containing two covalently bound antibodies, are also within the range of anti-CD26 antibodies. Such antibodies are used to enable immune system cells to target unwanted cells (U.S. Patent No. 4,676,980) or for the treatment of HIV infection (International Publication Nos. 91 / 00,360 and 92 / 200,373; European Patent No. 03089). Heteroconjugated antibodies may be prepared using any convenient crosslinking method. Suitable crosslinking agents and techniques are well known in the art and are described in U.S. Patent No. 4,676,980.

[0042] The term "anti-CD26 antibody" may include antigen-binding fragments of an anti-CD26 antibody. For example, in one embodiment, the antibody is selected from the group consisting of Fab, Fab', Fab'-SH, Fv, scFv, and F(ab')2. In one embodiment, the antibody is Fab. Various techniques have been developed for the production of antibody fragments. These fragments can be obtained via protein digestion of a complete antibody (see, e.g., Morimoto et al., 1992, J. Biochem. Biophys. Methods 24:107-117 and Brennan et al., 1985, Science 229:81), or they can be produced directly by recombinant host cells. For example, the Fab'-SH fragment can be directly recovered from E. coli and chemically conjugated to form the F(ab')2 fragment (Carter et al., 1992, Bio / Technology 10:163-167). In another embodiment, F(ab')2 is formed using the leucine zipper GCN4, which facilitates the assembly of the F(ab')2 molecule. According to other approaches, fragments of Fv, Fab, or F(ab')2 are isolated directly from recombinant host cell cultures.

[0043] In one embodiment, the anti-CD26 antibody is an immunoglobulin molecule with a single-chain (ScFv), variant, fusion protein containing the antibody moiety, humanized antibody, chimeric antibody, diabody, linear antibody, single-chain antibody, and any other modified conformation.

[0044] Single-stranded variable region fragments are constructed by linking light and / or heavy chain variable regions using short linking peptides. Bird et al. (1988) Science 242:423-426. An example of a linking peptide is (GGGGS)3 (SEQ ID NO: 29), which bridges approximately 3.5 nm between the carboxyl terminus of one variable region and the amino terminus of the other variable region. Linkers of other sequences have also been designed and used. Bird et al. (1988). Linkers can then be modified for additional functions such as drug immobilization or immobilization onto a solid carrier. Single-stranded variants can be produced by either recombinant or synthetic techniques. When scFv is produced synthetically, automated synthesizers can be used. When scFv is produced recombinantly, a suitable plasmid containing the polynucleotide encoding scFv can be introduced into a suitable host cell, such as a eukaryote like yeast cells, plant cells, insect cells, or mammalian cells, or a prokaryote like Escherichia coli. The polynucleotide encoding the target scFv can be prepared by routine operations such as polynucleotide ligation. The resulting scFv can then be isolated using standard protein purification techniques known in the art.

[0045] Other forms of single-chain antibodies, such as diabody antibodies, are also included in the category of anti-CD26 antibodies. Diabody antibodies are bivalent, bispecific antibodies in which the VH and VL domains are expressed on a single antibody chain. However, they use a linker that is too short for these two domains to pair on the same chain. Therefore, these domains are forced to pair with complementary domains on another chain, creating two antigen-binding sites (see, for example, Holliger, P. et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, RJ et al. (1994) Structure 2:1121-1123).

[0046] Anti-CD26 antibodies encompass modifications to antibodies described herein, examples of which include functionally equivalent antibodies and variants with enhanced or reduced activity that do not significantly affect the properties of the antibody. Antibody modification is a routine procedure in the art and does not need to be described in detail herein. Examples of modified antibodies include antibodies involving conservative substitution of amino acid residues, deletion or addition of one or more amino acids that do not significantly impair functional activity, or the use of chemical analogues.

[0047] Amino acid sequence insertions or additions include fusions at the amino and / or carboxyl terminals of antibodies ranging in length from one residue to 100 or more residues, as well as insertions of single or multiple amino acid residues within a sequence. Examples of terminal insertions include antibodies with an N-terminal methionyl residue or antibodies fused to an epitope tag. Other insertion variants of antibody molecules include fusions of enzymes or antibodies to the N-terminus or C-terminus of an antibody that extend the serum half-life of the antibody.

[0048] Substantial modification of the biological properties of antibodies is achieved by selecting substitutions that significantly alter the effect of the modification on (a) the structure of the antibody backbone in the substitution region, such as sheet or helix conformation, (b) the molecular charge or hydrophobicity at the target site, or (c) the maintenance of side chain volume. Residues present in nature are classified into the following groups based on their general side chain properties: (1) Hydrophobic: norleucine, Met, Ala, Val, Leu, Ile; (2) Neutral hydrophilic: Cys, Ser, Thr; (3) Acidic: Asp, Glu; (4) Basicity: Asn, Gln, His, Lys, Arg; (5) Residues that affect chain orientation: Gly, Pro; and (6) Aromatic: Trp, Tyr, Phe.

[0049] By substituting any cysteine ​​residue that does not contribute to maintaining the proper three-dimensional structure of the antibody (usually by substituting serine), the oxidative stability of the molecule can be improved and abnormal crosslinking can be prevented. Conversely, especially when the antibody is an antibody fragment such as an Fv fragment, the stability of the antibody can be improved by adding cysteine ​​bonds to the antibody.

[0050] Amino acid modifications range from changes or modifications of one or more amino acids to complete redesign of regions such as variable regions. Changes in variable regions can alter binding affinity and / or specificity. In one embodiment, 1 to 5 or fewer conservative amino acid substitutions are made within the CDR domain. In another embodiment, 1 to 3 or fewer conservative amino acid substitutions are made within the CDR3 domain. In yet another embodiment, the CDR domain is CDRH3 and / or CDR L3.

[0051] Monoclonal antibodies may be prepared using a hybridoma method, as described by Kohler and Milstein, 1975, Nature 256:495. In the hybridoma method, mice, hamsters, or other suitable host animals are typically immunized with an immunizer to produce antibodies that specifically bind to the immunizer, or to induce lymphocytes capable of producing such antibodies. Alternatively, lymphocytes may be immunized in vitro.

[0052] Monoclonal antibodies (and other antibodies) may also be produced by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567. The DNA encoding the monoclonal antibody is isolated and sequenced using conventional methods, such as the use of oligonucleotide probes that can specifically bind to the gene encoding the heavy or light chain of the monoclonal antibody. After isolation, the DNA is incorporated into an expression vector and transfected into host cells, such as Escherichia coli cells, monkey COS cells, Chinese hamster ovary cells (CHO), or myeloma cells that do not produce immunoglobulin proteins unless the expression vector is introduced, thereby achieving the synthesis of the monoclonal antibody in the recombinant host cells.

[0053] Various protein expression systems, vectors, and cell media useful for antibody production are known to those skilled in the art. See, for example, International Publication Nos. 03 / 054172, 04 / 009823, and 03 / 064630 (the full texts of which are incorporated herein by reference). In one embodiment, a glutamine synthase (GS) expression system is used for the expression of an anti-CD26 antibody.

[0054] Anti-CD26 antibodies are preferably humanized antibodies. Therapeutic antibodies often induce side effects, partly due to the induction of an immune response to the administered antibody. This can result in decreased efficacy, a reduction in cells with the target antigen, and undesirable inflammatory responses. To avoid the above, recombinant anti-CD26 humanized antibodies may be produced. The general principle of antibody humanization includes maintaining the basic sequence of the antigen-binding portion of the antibody, while replacing at least a portion of the non-human remainder of the antibody with a human antibody sequence. Four conventional common steps for humanizing a monoclonal antibody include, but are not limited to, (1) determining the nucleotide and putative amino acid sequences of the light chain variable domain and heavy chain variable domain of the starting antibody; (2) designing the humanized antibody, i.e., determining which antibody framework regions or residues and / or CDR residues to use in the humanization process; (3) the actual humanization methodology / technique; and (4) transfection and expression of the humanized antibody. When antibodies are used in clinical trials and treatments in humans, the constant region can also be made more closely resembling the human constant region through recombinant technology to avoid an immune response. See, for example, U.S. Patents 5,997,867 and 5,866,692.

[0055] In recombinant humanized antibodies, interaction with the Fcγ receptor and the complement immune system can be avoided by modifying the Fcγ moiety. The technique for preparing such antibodies is described in International Publication No. 99 / 58572.

[0056] Many "humanized" antibody molecules containing antigen-binding sites derived from non-human immunoglobulins have been reported. Examples include the fusion of rodent V regions and their associated complementarity-determining regions (CDRs) with human constant domains. See, for example, Winter et al., Nature 349:293-299 (1991); Lobuglio et al., Proc. Nat. Acad. ScI USA 86:4220-4224 (1989); Shaw et al., J Immunol. 138:4534-4538 (1987); and Brown et al., Cancer Res. 47:3577-3583 (1987). Other references describe rodent CDRs incorporated into human support framework regions (FRs) before fusion with appropriate human antibody constant domains. See, for example, Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988); and Jones et al., Nature 321:522-525 (1986). Another reference describes rodent CDRs supported by recombinant veneered rodent framework regions. See, for example, European Patent Publications 519 and 596. These types of “humanized” molecules are designed to minimize unwanted immunological responses to rodent anti-human antibody molecules that limit the duration and effectiveness of therapeutic application of their portions in human transplant patients. Other available methods for humanizing antibodies are disclosed in Daugherty et al., Nucl. Acids Res., 19:2471-2476 (1991), and in U.S. Patents No. 6, 180, 377; No. 6, 054, 297; No. 5, 997, 867; No. 5, 866, 692; No. 6, 210, 671; No. 6, 350, 861; and International Publication No. 01 / 27160.

[0057] Further exemplary methods for humanizing antibodies are described in International Publication No. 02 / 084277 and U.S. Patent Publication No. 2004 / 0,133,357, both of which are incorporated herein by reference in their entirety.

[0058] Furthermore, the anti-CD26 antibody may be conjugated to a water-soluble polymer moiety. The anti-CD26 antibody may be conjugated to polyethylene glycol (PEG), monomethoxy-PEG, ethylene glycol / propylene glycol copolymer, carboxymethylcellulose, dextran, polyvinyl alcohol, etc. The anti-CD26 antibody may be modified at random or predetermined positions on the molecule and may contain one, two, or three or more binding sites. The polymer may have any molecular weight and may be branched or unbranched. In one embodiment, the moiety is conjugated to the antibody via a linker. In one embodiment, the binding site increases the circulating half-life of the antibody in the animal body. Methods for conjugating polymers such as PEG to antibodies are well known in the art. In one embodiment, the anti-CD26 antibody is a PEGylated antibody, such as a PEGylated antibody. The anti-CD26 antibody may also be conjugated to other drugs such as different chemotherapeutic agents, radionuclides, immunotherapeutic agents, cytokines, chemokines, contrast agents, toxins, biological agents, enzyme inhibitors, or antibodies.

[0059] The pharmaceutical composition described herein is a pharmaceutical composition for the treatment of malignant mesothelioma containing the above-mentioned anti-CD26 antibody as an active ingredient. The pharmaceutical composition of the present invention is a pharmaceutical composition for the treatment of cancer containing an anti-CD26 antibody as an active ingredient, for administration to patients in whom the level of soluble CD26 in the serum of a malignant mesothelioma patient 1 to 60 days after a reference administration (with the reference administration day of the anti-CD26 antibody as day 1) is less than 85% of the level of soluble CD26 in the serum of the patient before the reference administration. The pharmaceutical composition according to claim 29 is for administration to patients in whom the level of soluble CD26 in the serum of the patient 1 to 30 days after a reference administration of the anti-CD26 antibody is less than 60% of the level of soluble CD26 in the serum of the patient before the reference administration. The pharmaceutical compositions of the present invention are: a pharmaceutical composition for administration to a patient whose serum soluble CD26 level 22 to 30 days after baseline administration of anti-CD26 antibody is less than 60% of the serum soluble CD26 level before baseline administration; a pharmaceutical composition for administration to a patient whose serum soluble CD26 level 2 to 8 days after baseline administration of anti-CD26 antibody is less than 50% of the serum soluble CD26 level before baseline administration; and a pharmaceutical composition for administration once every two weeks, and 22 days after baseline administration. A pharmaceutical composition for administration to a patient whose serum soluble CD26 level on day 30 is 65% or less of the serum soluble CD26 level before the reference dose; a pharmaceutical composition for administration once every two weeks, and for administration to a patient whose serum soluble CD26 level on day 29 from the reference dose is 62.3% or less of the serum soluble CD26 level before the reference dose; a pharmaceutical composition for administration to a male; a pharmaceutical composition for administration once a week, and A pharmaceutical composition for administration to a patient in whom the level of soluble CD26 in the patient's serum 2 to 8 days after the reference dose is 50% or less of the level of soluble CD26 in the patient's serum before the reference dose; a pharmaceutical composition for administration to a patient in whom the level of soluble CD26 in the patient's serum 2 to 8 days after the reference dose is 49% or less of the level of soluble CD26 in the patient's serum before the reference dose; and a pharmaceutical composition for administration to a patient in whom the level of soluble CD26 in the patient's serum 15 days or more after the reference dose is 30% or less of the level of soluble CD26 in the patient's serum before the reference dose. A pharmaceutical composition for administration to a patient who is [description of the patient's condition]; a pharmaceutical composition for administration to a patient whose serum soluble CD26 level 15 days after the reference dose is 26% or less of the serum soluble CD26 level before the reference dose; a pharmaceutical composition for administration at a dose of 6 mg / kg of anti-CD26 antibody; a pharmaceutical composition in which the reference dose is the first dose; a pharmaceutical composition for administration at a dose of 0.1 to 6 mg / kg of anti-CD26 antibody; a pharmaceutical composition for administration once every two weeks or once a week; in which the anti-CD26 antibody is YS110 It can be used as a pharmaceutical composition.

[0060] In this specification, “cancer” may mean, for example, malignant mesothelioma, lung cancer, kidney cancer, liver cancer, or other malignant tumors that express CD26.

[0061] The methods described herein (including therapeutic methods) may be administered by a single direct injection at one or more sites at one or more time points. Administration may also be performed at multiple sites substantially simultaneously. The frequency of administration will be determined and adjusted during the course of treatment, based on the desired outcome. In some cases, the pharmaceutical compositions of the present invention, and sustained-release formulations of the pharmaceutical compositions, may be appropriate. Various formulations and devices for achieving sustained release are well known in the art.

[0062] The target of treatment or prevention is humans.

[0063] The pharmaceutical composition is preferably administered to a mammal in a carrier (preferably a pharmaceutically acceptable carrier). Suitable carriers and their formulations are described in Remington's Pharmaceutical Sciences, 18th edition, edited by A. Gennaro, Mack Publishing Co., Easton, PA, 1990, and Remington, The Science and Practice of Pharmacy, 20th edition, Mack Publishing, 2000. Typically, the formulation becomes isotonic by the use of an appropriate amount of a pharmaceutically acceptable salt. Examples of carriers include physiological saline, Ringer's solution, and dextrose solution. The pH of these solutions is preferably about 5 to about 8, more preferably about 7 to about 7.5. Furthermore, carriers include sustained-release formulations such as a semipermeable matrix made of a solid hydrophobic polymer containing the antibody, the matrix being in the form of a shaped product such as a film, liposome, or microparticle. For example, it will be apparent to those skilled in the art that certain heterologous carriers may be more preferred depending on the administration route and concentration of the antibody being administered.

[0064] The pharmaceutical composition may be administered to mammals by injection (e.g., systemically, intravenously, intraperitoneally, subcutaneously, intramuscularly, or intraportally) or by other means that ensure delivery to the bloodstream in an effective form (e.g., infusion). The pharmaceutical composition may also be administered by isolation perfusion methods, such as intratissue isolation perfusion, to obtain a local therapeutic effect. Intravenous injection is preferred.

[0065] The effective dose and schedule for administering the pharmaceutical composition of the present invention are determined empirically, and such determination methods are within the realm of common technical knowledge in the art. For example, it may be administered once a week for five weeks, or once every two weeks for three weeks. Those skilled in the art will understand that the dose of the pharmaceutical composition to be administered will vary depending, for example, on the mammal to which the pharmaceutical composition is administered, the route of administration, the specific type of antibody used, and other drugs administered to the mammal. A typical daily dose of the pharmaceutical composition when used alone may range from about 1 μg / kg body weight to 100 mg / kg body weight or more, depending on the factors mentioned above, as the amount of active ingredient per day. Generally, any of the following dosages may be used: at least about 50 mg / kg body weight; at least about 10 mg / kg body weight; at least about 3 mg / kg body weight; at least about 1 mg / kg body weight; at least about 750 μg / kg body weight; at least about 500 μg / kg body weight; at least about 250 μg / kg body weight; at least about 100 μg / kg body weight; at least about 50 μg / kg body weight; at least about 10 μg / kg body weight; or at least about 1 μg / kg body weight, or a dosage higher than these. Preferably, the amount of anti-CD26 antibody is 0.1 to 2 mg / kg administered once every two weeks for three times, or 2 to 6 mg / kg administered once a week for five times.

[0066] The method of the present invention is based on the observation that patients with higher levels of soluble CD26 in their serum after administration of anti-CD26 antibody exhibit a greater antitumor effect. Specifically, the method utilizes the fact that the efficacy of anti-CD26 antibody can be predicted by comparing the level of soluble CD26 in the serum of a cancer patient before administration with the level of soluble CD26 in the serum of the same patient one day or more after administration. In other words, the method of the present invention requires at least one administration of anti-CD26 antibody to the subject. Such an administration of anti-CD26 antibody that serves as a baseline for comparing serum levels of soluble CD26 before and after administration is called a baseline administration. The baseline administration is preferably the first administration to the patient, but it does not necessarily have to be the first administration received by the patient. For example, if a patient who has previously received anti-CD26 antibody is administered anti-CD26 antibody again after a period of time following the most recent administration, that administration may be used as a baseline administration. The level of soluble CD26 in the serum of a cancer patient before administration of the anti-CD26 antibody that will serve as the baseline (100%) is measured before the baseline administration. In the method of the present invention, the level of soluble CD26 in the serum of the patient measured before administration of the baseline anti-CD26 antibody (the baseline level) is referred to as the "level of soluble CD26 in the serum of the patient before the baseline administration." The level of soluble CD26 in the serum of the patient from day 1 after the baseline administration, which will be used as a comparison to the baseline level (100%), is referred to as the "level of soluble CD26 in the serum of the patient on the measurement day." Here, "from day 1 after the baseline administration" refers to the number of days calculated with the baseline administration as day 1. The day on which such a comparative level of soluble CD26 in the serum of the patient is measured is called the measurement day. The administration of anti-CD26 antibody up to the measurement day may be only once (the baseline administration) or multiple times. For example, if anti-CD26 antibody is administered once a week, it will be administered on days 8, 15, 22, 29, and so on. If the measurement date is between days 1 and 8 (before administration), only the standard dose will be administered, but from day 8 (after administration) onwards, the patient will have received two or more doses. If the measurement date is the day of administration, the level of soluble CD26 in the patient's serum can be measured before or after administration.Furthermore, the anti-CD26 antibody is administered as a pharmaceutical composition containing the anti-CD26 antibody as an active ingredient, in accordance with the administration of the pharmaceutical composition described above.

[0067] Therefore, in one embodiment, the present invention relates to a method for selecting cancer patients who may be able to obtain a therapeutic effect with an anti-CD26 antibody, comprising comparing the level of soluble CD26 in the patient's serum before a baseline administration of the anti-CD26 antibody with the level of soluble CD26 in the patient's serum on the measurement day, and selecting the patient as potentially able to obtain a therapeutic effect with the anti-CD26 antibody if the level of soluble CD26 in the patient's serum on the measurement day is less than 85% of the level of soluble CD26 in the patient's serum before the baseline administration, wherein the measurement day is from day 1 to day 60 with the baseline administration day as day 1, the patient is a patient who has received anti-CD26 antibody at least once as a baseline administration, and if the measurement day corresponds to the day of administration of the anti-CD26 antibody, the level of soluble CD26 in the patient's serum on the measurement day is the level of soluble CD26 in the patient's serum before the administration of the anti-CD26 antibody on the measurement day.

[0068] In this specification, "reference dose" means an administration performed to determine whether the level of soluble CD26 in the patient's serum decreased after administration, based on the level of soluble CD26 in the patient's serum before administration, and it does not necessarily have to be the first dose for the patient. However, since the drug's effectiveness is usually determined early in the course of treatment, the reference dose is preferably the first dose.

[0069] Throughout this specification, "level" means an index relating to a quantified abundance, including, for example, concentration, quantity, or an index that can be used in place of it. Therefore, a level may be the measured value itself, such as fluorescence intensity, or it may be a value converted to concentration, etc. Furthermore, a level may be an absolute numerical value (abundance, abundance per unit area, etc.) or a relative numerical value (percentage (%), multiple, etc.) compared to a comparison control set as necessary.

[0070] In another embodiment, the present invention relates to a method for predicting the therapeutic effect of an anti-CD26 antibody in a cancer patient, comprising comparing the level of soluble CD26 in the patient's serum before a baseline dose of the anti-CD26 antibody with the level of soluble CD26 in the patient's serum on a measurement day, and predicting that the anti-CD26 antibody may be therapeutically effective in the patient if the level of soluble CD26 in the patient's serum on the measurement day is less than 85% of the level of soluble CD26 in the patient's serum before the baseline dose, wherein the measurement day is 1 to 60 days after the baseline dose, with the baseline dose day being day 1, the patient is a patient who has received anti-CD26 antibody at least once as a baseline dose, and if the measurement day corresponds to the day of administration of the anti-CD26 antibody, then the level of soluble CD26 in the patient's serum on the measurement day is the level of soluble CD26 in the patient's serum before the administration of the anti-CD26 antibody on that measurement day.

[0071] In the above method, the "measurement day" can be days 1 to 60, with the reference administration day being day 1. For example, it can be days 1 to 30, days 2 to 8, days 2 to 15, days 2 to 21, days 2 to 29, days 8 to 15, days 8 to 21, days 8 to 29, days 15 to 22, days 15 to 29, or days 22 to 29, or days 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, or any day within the period between any two of these points.

[0072] In the method of the present invention, a case in which it is determined that a therapeutic effect can be obtained by an anti-CD26 antibody, or that an anti-CD26 antibody may have a therapeutic effect in the patient, is when the level of soluble CD26 in the patient's serum on the day of measurement is less than 85%, 80%, 75%, 70%, 65%, 62.3%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 26%, or 25% of the level of soluble CD26 in the patient's serum before reference administration.

[0073] Preferably, when 6 mg / kg of anti-CD26 antibody is administered once a week, and the measurement date is 2 to 8 days after the baseline administration, and the level of soluble CD26 in the patient's serum on the measurement date is less than 50% (or less than 49%) of the level of soluble CD26 in the patient's serum before the baseline administration, it is determined that there is a possibility of obtaining a therapeutic effect with the anti-CD26 antibody, or that the anti-CD26 antibody may have a therapeutic effect in the patient.

[0074] Alternatively, preferably, if 6 mg / kg of anti-CD26 antibody is administered once a week, and the measurement date is 15 days or later from the baseline administration (for example, 15-22 days, 15-29 days, or 22-29 days), and the level of soluble CD26 in the patient's serum on the measurement date is less than 30% (or less than 26%) of the level of soluble CD26 in the patient's serum before the baseline administration, then it is determined that there is a possibility of obtaining a therapeutic effect with the anti-CD26 antibody, or that the anti-CD26 antibody may have a therapeutic effect in the patient.

[0075] The methods described above may further include any step selected from administering an anti-CD26 antibody to a patient, collecting serum from the patient before a baseline dose, collecting serum from the patient after a period specified above following the baseline dose, measuring soluble CD26 in the patient's serum before a baseline dose, and measuring soluble CD26 in the patient's serum after a baseline dose. Soluble CD26 can be measured using a commercially available kit such as an ELISA kit, or by a method well known to those skilled in the art.

[0076] In one embodiment, the present invention relates to a method for measuring the level of soluble CD26 in the serum of a cancer patient before administration of an anti-CD26 antibody, and the level of soluble CD26 in the serum of the same patient 1 to 60 days after the administration (preferably 5 to 45 days, 15 to 30 days, and 25 to 30 days).

[0077] Furthermore, in the methods described herein, the level of soluble CD26 (or its measurement) may be replaced with DPPIV activity (or its measurement). DPPIV activity can be measured using commercially available kits.

[0078] Furthermore, the method of the present invention may also include administering a pharmaceutical composition for the treatment of malignant mesothelioma containing an anti-CD26 antibody as an active ingredient to patients selected by the above method as potentially capable of obtaining a therapeutic effect with an anti-CD26 antibody, or to patients for whom an anti-CD26 antibody is predicted to potentially be effective.

[0079] Examples are shown below to illustrate the present invention in more detail, but the present invention is not limited thereto. All references cited throughout this application are incorporated herein by reference.

[0080] (1) Human subjects In the FIH Phase I clinical trial, 33 patients (23 MMs, 9 RCCs, and 1 UTC) treated with YS110 were included in the safety analysis, and treatment efficacy was evaluated in 26 of these 33 patients (19 MMs, 6 RCCs, and 1 UTC) (Angevin E, et al., Br J Cancer. 2017;116(9):1126-34.). To determine the maximum tolerated dose, patients initially received three YS110 infusions at doses of 0.1, 0.4, 1, and 2 mg / kg on days 1, 15, and 29 (every two weeks, Q2W). Based on preliminary pharmacokinetic data, the protocol was subsequently revised to allow patients to receive a total of five YS110 infusions (once a week, Q1W) at doses of 2, 4, and 6 mg / kg on days 1, 8, 15, 22, and 29. Of the 33 patients, 26 (18 in the Q2W cohort and 8 in the Q1W cohort) were evaluable for YS110-mediated antitumor activity using RECIST criteria or PFS monitoring. Tumor volume change from baseline was assessed at 43±4.2 days, two weeks after completion of the first cycle of YS110 administration on day 29, using modified RECIST criteria for MM or RECIST 1.0 criteria for RCC or UTC (Angevin E, et al. (2017) cited above). Serum soluble CD26 / DPP4 titers were measured immediately before and after YS110 administration on days 1, 15, and 29.

[0081] (2) Statistical analysis Box plot analysis was used to observe changes in serum soluble CD26 / DPP4 titers before and after YS110 administration on days 1, 15, and 29. Scatter plot analysis, stratified for stable disease (SD) and progressive disease (PD) cases, was used to observe the relationship between changes in serum soluble CD26 titers before and after YS110 administration on days 1, 15, and 29, and tumor volume changes from baseline on day 43. For these two observational analyses, PPMC or SRDC analysis was used to statistically investigate the potential correlation between changes in serum soluble CD26 titers before and after YS110 administration on days 1 and 29 from baseline and tumor volume changes according to RECIST criteria on day 43. Based on Pearson's product-moment correlation / Spearman's rank-difference correlation (PPMC / SRDC) analysis, bar graph analysis of serum soluble CD26 / DPP4 titer changes stratified by SD and PD cases before YS110 administration on day 1 (baseline, 100%), day 15, and day 29 was performed. The correlation between serum soluble CD26 / DPP4 changes and the incidence of SD or PD cases according to RECIST criteria on day 43 was examined using Wilcoxon's rank-sum test. Based on the results of PPMC / SRDC and bar graph analysis, ROC analysis was used to examine the index (cutoff value) of serum soluble CD26 titer changes from baseline for SD results according to RECIST criteria and PFS ≥ 90 days or ≥ 180 days using Fisher's exact test. Differences in background factors between SD and PD cases were examined using Fisher's exact test or Wilcoxon's rank-sum test before ROC analysis.

[0082] (3) Cell lines and cultures Human MM cell lines MSTO-211H (MSTO parent) and NCI-H226 were obtained from the American Type Culture Collection (ATCC, Rockville, Maryland). MSTO parent cells were stably transfected with full-length human CD26 (MSTO-CD26) (Yamamoto J, et al., Br J Cancer. 2014;110(9):2232-45.). Human MM cell line JMN cells were transduced with short hairpin RNA (shRNA) expressing lentivirus to generate stable cell lines JMNCD26-shRNA and JMNctrl-shRNA (Yamazaki H, et al., Biochem Biophys Res Commun. 2012;419(3):529-36.). Non-tumor human cells used included the immortalized pleural mesothelial cell line MeT-5A, the mammary epithelial cell line MCF10A, the fetal lung fibroblast cell line TIG-1, human umbilical vein endothelial cells (HUVEC), and human cutaneous microvascular endothelial cells (HDMVEC). MeT-5A and MCF10A were obtained from ATCC, and TIG-1 was obtained from the JCRB Cell Bank (Osaka, Japan). Culture media for HUVEC, HDMVEC, and MCF10A (MEGM, EGM-2, and EGM-2MV, respectively) were purchased from LONZA (Walkersville, Maryland). MSTO parent, MSTO-CD26, JMNctrl-shRNA, JMNCD26-shRNA, H226, and MeT-5A were grown in RPMI1640 medium supplemented with 10% FBS. TIG-1 was grown in DMEM medium supplemented with 10% FBS. All cells were cultured in a humidified 5% CO2 incubator at 37°C.

[0083] (4) Antibodies and reagents The humanized anti-CD26 monoclonal antibody YS110 was provided by Y's AC Co., Ltd. (Tokyo, Japan). A human IgG1 isotype control monoclonal antibody (clone QA16A12), purchased from BioLegend (San Diego, California), was used as a control.

[0084] (5) Preparation of culture supernatant Cells were cultured for 3 days at 37°C in 500 μl of culture medium in a 24-well plate (Corning), in or without control human IgG or YS110. For time-course analysis, MSTO-CD26 (1.5 × 10⁶) was used. 5 , 4×10 4 , or 4×10 3 The cultures were incubated in 500 μl of RPMI1640 medium in a 24-well plate at 37°C for 1, 3, or 7 days in the presence or absence of YS110 (1, 3, or 10 μg / mL), respectively. After incubation, the supernatant was collected from the confluent culture.

[0085] (6) Quantification of soluble CD26 and DPP4 enzyme activity We developed assays for soluble CD26 and DPP4 activity in our laboratory using mouse anti-human CD26 monoclonal antibodies (clones 5F8 and 9C11) that do not cross-react with the therapeutic humanized anti-CD26 monoclonal antibody YS110. The relevant experimental methods have been previously described in detail (Ohnuma K, et al., J Clin Lab Anal. 2015;29(2):106-11). Data were analyzed by Tukey's one-way ANOVA test for multiple comparison studies. Significance was analyzed using GraphPad Prism 6 (GraphPadSoftware, San Diego, California). Values ​​of p<0.01 were considered significant and are shown in the corresponding figures and figure captions.

[0086] (7) Changes in serum soluble CD26 / DPP4 titers before and after YS110 administration (shown in box plot) This Phase I trial included several important parameters, including: 1) Tumor histological type: 19 cases of MM, 6 cases of RCC, and 1 case of UTC; 2) YS110 dosage: 0.1–6 mg / kg; 3) Dosage frequency: 3 doses every 2 weeks (Q2W) in 18 cases, and 5 doses once a week (Q1W) in 8 cases. In addition, a study of background factors between SD and PD cases showed no bias in age, BMI, absolute tumor volume, or serum soluble CD26 / DPP4 titer before YS110 administration, except for sex (data not shown). As shown in Tables 3 and 4, YS110 appeared to be more effective in female patients (6 SD and 2 PD in MM, 1 SD in RCC, and 1 PD in UTC) in contrast to male patients (4 SD and 7 PD in MM, and 2 SD and 3 PD in RCC).

[0087] [Table 3]

[0088] [Table 4]

[0089] Because the number of cases in each antibody dose cohort was insufficient for statistical analysis, this study further classified a total of 26 cases according to 1) tumor tissue and 2) frequency of drug administration, and investigated whether serum soluble CD26 titer changes could serve as a prognostic biomarker for YS110 treatment (see Table 3 for detailed information on these 26 cases).

[0090] First, box plot analysis was used to examine changes in serum soluble CD26 titer during YS110 treatment in each group. Serum soluble CD26 titer consistently decreased immediately after YS110 administration on days 1, 15, and 29, and gradually recovered until the next YS110 infusion, but did not return to the previous pre-administration level (Figure 1A). This pattern was similarly observed in 18 patients treated on a Q2W drug administration schedule (Figure 1B). In contrast, a clear difference was observed in 8 patients treated on a Q1W schedule. As shown in Table 3, Q1W patients received relatively higher doses of antibody (2-6 mg / kg) compared to Q2W patients (0.1-2 mg / kg). These differences in antibody dose and administration frequency significantly affected pre-administration serum soluble CD26 titers on days 15 and 29 (Figure 1D). Recovery of serum soluble CD26 titer after YS110 administration was not clear in Q1W cases with a higher frequency of drug administration. Q2W administration included 14 males and 4 females, while Q1W administration included 2 males and 6 females (Table 4). Distribution bias was significant between male cases in Q2W and Q1W administration, and between female cases in Q2W and Q1W administration (p=0.026 by Fisher's exact test). Furthermore, the number of cases in the Q1W cohort (8 cases) was insufficient for additional statistical analysis. Therefore, we primarily focused on Q2W cases and male cases for additional analysis. The initial decrease and subsequent recovery of serum soluble CD26 titer was similarly observed in both 19 MMs and 6 RCCs, including further stratification of the above cohorts to include 14 males in Q2W administration, 12 MMs in Q2W administration, and 9 male MMs in Q2W administration (Figures 1C, F, and G) (Figures 1E and H). As shown in Figure 2, the absolute value or titer change of serum soluble CD26 titer was strongly correlated with the level of serum DPP4 enzyme activity (r=0.908, p<0.001 or r=0.974, p<0.001). Since YS110 does not directly inhibit DPP4 enzyme activity (Y's Therapeutics Inc. USA IND. 2008;100657:Section 8, 8.2.1.5:289), the decrease in serum DPP4 enzyme activity after YS110 administration is due to a decrease in serum soluble CD26 protein levels.

[0091] (8) Differences in serum soluble CD26 / DPP4 titer changes before administration on day 29 and tumor volume changes on day 43 between the SD cohort and PD cohort, as determined by scatter plot analysis. Next, a scatter plot analysis after the start of YS110 administration was performed to investigate the potential relationship between pre- and post-administration serum soluble CD26 titer changes on days 1, 15, and 29 and tumor volume changes on day 43 in a total of 25 patients stratified into SD and PD cohorts. Tumor volume changes in the SD group were naturally expected to be lower than in the PD group. Serum soluble CD26 titer decreased significantly in both the SD and PD cohorts immediately after YS110 infusion on days 1, 15, and 29 (Figures 3A, C, and E). On the other hand, a significant difference in serum soluble CD26 titer changes between the SD and PD groups was observed before infusion on day 29. Serum soluble CD26 titer changes before infusion on day 29 in the SD cohort were at a lower level compared to the PD group (Figure 3D). Furthermore, this phenomenon was clearly observed in each stratified group, including 17 patients administered Q2W, 14 male patients administered Q2W, 18 MM patients, 11 MM patients administered Q2W, 9 male MM patients administered Q2W, and 6 RCC patients (Figures 3Ff~K, respectively). As these scatter plot analyses show, when measured before YS110 administration, the serum soluble CD26 titer change in the SD cohort was lower than in the PD patients, and this difference was particularly clear before administration on day 29 of Q2W.

[0092] (9) Correlation between changes in serum soluble CD26 / DPP4 titer before / after administration on day 29 and changes in tumor volume and / or PFS, as determined by PPMC / SRDC analysis. PPMC and SRDC analyses were performed to investigate the correlation between changes in serum soluble CD26 antibody titers before and after administration on days 1, 15, and 29, and tumor volume changes or PFS as determined by RECIST criteria on day 43 after YS110 administration. In the FIH Phase I clinical trial, 13 patients were classified as SD and 13 as PD by RECIST. Of the 13 SD cases, YS110 was particularly effective in 7 patients, with PFS exceeding 180 days (Table 5).

[0093] [Table 5]

[0094] In a total of 25 cases, a statistically significant correlation was observed between the change in serum soluble CD26 titer before administration on day 29 and the change in tumor volume on day 43 (PPMC / SRDC, p=0.006 or p=0.009 (Table 5)). A statistically significant correlation was also observed between the change in serum soluble CD26 titer and PFS (26 cases in total, p=0.011 after administration on day 29 by PPMC (Table 5)). In addition, a statistically significant correlation was also found between the change in serum titer of DPP4 enzyme activity and tumor volume or PFS, similar to the case of serum soluble CD26 titer (Table 5). Statistically significant correlations were observed between pre-administration serum soluble CD26 / DPP4 titer on day 29 and tumor volume, and between pre-administration and / or post-administration serum soluble CD26 / DPP4 titer on day 29 and PFS in 18 patients with a Q2W administration frequency and 14 male patients with a Q2W administration frequency (Tables 6 and 7).

[0095] [Table 6]

[0096] [Table 7]

[0097] In MM19 cases, SRDC analysis revealed a statistically significant correlation between pre- and post-administration serum DPP4 titer changes and tumor volume on day 29. PPMC analysis showed a nearly statistically significant correlation between pre-administration serum soluble CD26 titer and tumor volume on day 29 (p=0.065). PPMC analysis also showed a statistically significant correlation between post-administration serum soluble CD26 titer and PFS on day 29, and a nearly statistically significant correlation between post-administration serum DPP4 titer and PFS (p=0.056 in PPMC analysis, p=0.069 in SRDC analysis) (Table 8).

[0098] [Table 8]

[0099] In 12 MM cases administered Q2W, no statistically significant correlation was found between changes in serum soluble CD26 / DPP4 titer and tumor volume. However, the correlation between post-administration serum soluble CD26 / DPP4 titer on day 29 and PFS was statistically significant (Table 9).

[0100] [Table 9]

[0101] In nine male MM patients treated with Q2W administration, no significant difference was observed in the change between serum soluble CD26 / DPP4 titer and tumor volume. However, there was a tendency for correlation between serum soluble CD26 / DPP4 titer before and after administration on day 29 and PFS (Table 10).

[0102] [Table 10]

[0103] In the 6 and 8 RCC cases treated with Q2W and Q1W administrations, the number of cases was insufficient for PPMC / SRDC statistical analysis. Therefore, a correlation was observed between changes in serum soluble CD26 / DPP4 titers (before and after the third YS110 administration) and tumor volume or PFS before and after administration on day 29. Although the number of cases in each stratified cohort was limited, the statistically significant differences observed, particularly in 18 cases and 14 male cases treated with Q2W administration, are considered important.

[0104] (10) Pre-administration serum soluble CD26 / DPP4 titer on day 29 of the SD cohort, as determined by bar graph analysis (significantly lower than that of the PD cohort). Based on scatter plots and PPMC / SRDC testing, bar graph analysis was performed on pre-administration serum soluble CD26 titer changes on days 1, 15, and 29 in SD and PD cases. In all 23 cases (12 SD and 11 PD), serum soluble CD26 titers decreased from day 1 to day 29 pre-administration in both the SD and PD cohorts. Notably, the pre-administration serum soluble CD26 titer change on day 29 in SD cases was significantly lower than in PD cases (p=0.016) (Figure 4A). Similar results were observed in each stratified group, including 17 cases treated with Q2W (p=0.007), 17 cases of MM (p=0.068), 11 cases of MM treated with Q2W (p=0.068), 9 male MM treated with Q2W (p=0.020), or 6 cases of RCC (p=0.049) (Figures 4B and E-H). The statistically significant difference between the SD cohort and the PD cohort with the lowest p-value was observed in 14 male cases treated with Q2W (p=0.003) (Figure 4C). In the 8 cases treated with Q1W, serum soluble CD26 titer changes were lower in SD cases than in PD cases, and this trended to statistical significance before the third YS110 administration on day 15 (p=0.053). This timing corresponds to the same sample collection timing used to evaluate pre-administration serum soluble CD26 titer on day 29 of the Q2W treatment schedule (Figure 4D).

[0105] (11) Predictive ability of serum soluble CD26 / DPP4 titer changes on SD or PFS outcomes by ROC analysis in stratified groups ROC analysis was employed to examine the cutoff titer (index) of serum soluble CD26 / DPP4 titer change before and after YS110 administration on day 29 for SD and PFS ≥ 90 days or ≥ 180 days. Probabilities were evaluated using Fisher's exact test (Table 11).

[0106] [Table 11]

[0107] A total of 23 cases were investigated, and the indices for SD and PFS ≥ 90 days or ≥ 180 days (46.4% or 18.2%) were examined. Statistically significant results were observed (p=0.003 for SD, 0.005 or 0.003 for PFS, and area under the curve (AUC) of 0.795, 0.697, or 0.759, respectively) (Table 11; sum of columns). For the columns Q2W (17 or 18 cases), Q2W, male (14 cases), MM (17 or 18 cases), MM, Q2W (11 or 12 cases), and MM, Q2W, male (9 cases), the index for each column of the results was judged to be statistically significant or to show a significant trend. In particular, in the Q2W, male (14 cases) column, the index of 37.7% prior to YS110 administration on day 29 for outcome SD was statistically significant (p<0.001, AUC 1.000). Similarly, the index of 37.7% for outcome PFS ≥90 days or ≥180 days was statistically significant (p<0.001 or p=0.027, AUC 0.950 or 0.879, respectively). Overall, our analysis of serum soluble CD26 / DPP4 titer changes during the YS110 treatment course demonstrated that serum soluble CD26 / DPP4 titer changes are a potential prognostic biomarker for YS110 antitumor therapy, particularly immediately before / after the third YS110 infusion on day 29 of the Q2W administration schedule.

[0108] (12) Decreased levels of soluble CD26 in the culture supernatant of CD26-expressing MM cell lines and non-tumor cells upon addition of humanized anti-CD26 monoclonal antibody. In a Phase I trial, serum concentrations of soluble CD26 were significantly reduced after YS110 treatment in patients with CD26-expressing tumors (Figure 1). Therefore, we investigated the in vitro effects of YS110 on soluble CD26 production from MM cell lines. For this purpose, we selected various human CD26-positive and negative MM cell lines. Although the MSTO parent was an endogenous human CD26-deficient cell line, MSTO-CD26 stably expressed full-length human CD26. Stable shRNA knockdown of CD26 in JMN, an endogenous human CD26-positive cell line, significantly reduced CD26 expression compared to JMNctrl-shRNA cells (Yamazaki H, et al., Biochem Biophys Res Commun. 2012;419(3):529-36). Cell surface expression of CD26 in MM cell lines is shown in Figure 5. First, the amount of soluble CD26 in the culture supernatant from 3-day cultures of CD26-positive or CD26-negative cells was measured. Soluble CD26 could be quantified in the culture supernatant of CD26-positive MSTO-CD26, JMNctrl-shRNA, and H226 cells, but soluble CD26 could not be detected in the culture supernatant of CD26-negative MSTO parent and JMNCD26-shRNA cells, regardless of YS110 treatment (Figure 6A). Treatment with YS110 significantly reduced the amount of soluble CD26 in the culture supernatant of MSTO-CD26, JMNctrl-shRNA, and H226 cells compared to cells incubated with vehicle or control human IgG (Figure 6A). Next, the production of soluble CD26 from non-tumor (normal) cells was examined. CD26 was clearly expressed on the cell surface of HDMVEC and TIG-1 cells, but was hardly expressed in HUVEC and MCF10A cells, and partially expressed in MeT-5A cells (Figure 5B). Soluble CD26 could be quantified in the culture supernatant of CD26-positive TIG-1 and HDMVEC cells, but was undetectable in the culture supernatant of CD26-negative or low-MCF10A, HUVEC, and MeT-5A cells (Figure 6B). Similar to the results shown in Figure 6A, YS110 treatment significantly reduced the amount of soluble CD26 in the culture supernatant of TIG-1 and HDMVEC cells compared to cells incubated with vehicle or control human IgG (Figure 6B).Treatment with YS110 dose-dependently reduced soluble CD26 production from both MSTO-CD26 and TIG-1 cells (Figure 6C). Subsequent time-course analysis showed a slight increase in soluble CD26 levels in the supernatant of 3-day cultures of MSTO-CD26 cells compared to 1-day cultures, and the increased soluble CD26 levels were observed in the supernatant of 7-day cultures of MSTO-CD26 cells (Figure 6D). The decrease in soluble CD26 levels after YS110 treatment was consistently observed across all culture periods. In summary, these data indicate that soluble CD26 is produced by both CD26-positive tumor cells and non-tumor cells, and that the addition of YS110 reduced soluble CD26 production from these cells in an antibody dose-dependent manner. We believe these in vitro effects are reflected in the significant decrease in serum soluble CD26 levels in CD26-expressing tumor patients after YS110 administration.

[0109] A similar experiment was conducted by administering 6 mg / kg once a week. As a result, at Day 2, the serum soluble CD26 / DPP4 titer before and after YS110 administration was 48.64% SD and 55.46% PD compared to the CD26 / DPP4 titer before the first administration (Day 1, and so on) (p=0.026). Furthermore, at Day 15 pre (before administration), the serum soluble CD26 / DPP4 titer was 25.51% SD and 33.47% PD compared to the CD26 / DPP4 titer before the first administration (set as 100%). Additionally, at Day 29 pre (before administration), the serum soluble CD26 / DPP4 titer was 25.10% SD and 31.74% PD compared to the CD26 / DPP4 titer before the first administration (set as 100%). Furthermore, on Day 15 post (after administration), the serum soluble CD26 / DPP4 titer, compared to the CD26 / DPP4 titer before the initial administration (set as 100%), showed an SD of 24.06% and a PD of 30.56%. On Day 29 post (after administration), the serum soluble CD26 / DPP4 titer, compared to the CD26 / DPP4 titer before the initial administration (set as 100%), showed an SD of 25.64% and a PD of 30.93%.

[0110] In this study, a scatter plot analysis of the relationship between serum soluble CD26 / DPP4 titer changes and tumor volume changes according to RECIST criteria suggested that the predictable period during the course of YS110 treatment can be used to distinguish between SD and PD cases. This predictable period was before / after the third YS110 administration on day 29 of the Q2W treatment schedule, and the results were found to be statistically significant by PPMC / SRDC analysis and bar graph analysis. ROC analysis defined a cutoff titer for serum soluble CD26 / DPP4 titer changes before / after administration on day 29 as an index for cases with SD or PFS longer than 90 or 180 days, and a significantly viable prediction was obtained under the resulting index. In particular, the ROC analysis of 14 men treated on the Q2W schedule defined a cutoff value of p<0.001 (Table 11). Similar results were obtained for 9 men with MM treated on the Q2W administration schedule (Table 11). The results were statistically significant despite the small number of cases in the stratified group, strongly suggesting that serum soluble CD26 / DPP4 titer change is a definitive prognostic biomarker for cancer patients treated with YS110. Unlike the Q2W schedule, the number of cases treated on the Q1W schedule was insufficient for analysis. However, serum soluble CD26 titer change before the 15th day dose, rather than before the 29th day dose, showed a trend toward statistical significance (p=0.053), as shown in Figure 4D, and could be used to distinguish between PD and SD cases. These data suggest that increasing drug administration frequency and dose (YS110 dose levels 2, 4, and 6 mg / kg on Q1W) affects the optimal timing of serum soluble CD26 titer measurement, and that this optimal timing may vary depending on the frequency and / or dose of YS110 administration.

[0111] As our robust in vitro and in vivo data demonstrate, YS110 not only induces its direct antitumor effect through the induction of cell cycle arrest in the S / G1 phase (Inamoto T, et al., Clin Cancer Res. 2007;13(14):4191-200., Hayashi M, et al., Cancer Cell Int. 2016;16:35.), but also induces cytolysis of MM cells via antibody-dependent cell-mediated cytotoxicity (ADCC). Another important mechanism of action of YS110 was the nuclear translocation of the CD26 molecule, via internalization of the CD26-YS110 complex from the cell surface, which inhibits MM cell proliferation by suppressing the expression of the POLR2A gene, a component of RNA polymerase II. However, in CD26-expressing non-neoplastic cells such as human fetal kidney HEK293 cells and normal T lymphocytes, the CD26-YS110 complex did not translocate into the nucleus (Yamada K, et al., PLoS One. 2013;8(4):e62304., Hayashi M, et al., Cancers (Basel). 2019;11(8):1138.). Furthermore, the internalization of the CD26-antibody complex was dependent on the CD26 epitope recognized by the specific monoclonal antibody. CD26 internalization was not observed on the cell surface of MM cells treated with the mouse anti-human CD26 monoclonal antibody 5F8. It recognized a different CD26 epitope than that recognized by YS110 and did not exhibit antitumor activity (Yamada K, et al., PLoS One. 2013;8(4):e62304., Hatano R, et al., Diagn Pathol. 2014;9:30.).

[0112] Residues 201–211, 730, and 740 of CD26, along with the serine catalytic site of residue 630 which constitutes the CD26 / DPPIV pocket structure, are essential for DPP4 enzyme activity

[26] . In contrast, YS110 recognizes the aa region of CD26 at positions 248–358, which is different from the catalytic site (Hatano R, et al., (2014) above, Dong RP, et al., Mol Immunol. 1998;35(1):13-11 21.), and YS110 binding does not directly affect DPP4 enzyme activity (Y's Therapeutics Inc. USA IND. 2008;100657:Section 8, 8.2.1.5:289.). Our data showed that YS110 treatment reduced the production of soluble CD26 from both CD26-expressing MM cell lines and non-tumor cells (Figure 6). The soluble form of CD26 begins at residue 39aa and lacks cytoplasmic and transmembrane domains (Iwaki-Egawa S, et al., J Biochem.14 1998;124(2):428-33.), but the precise mechanisms involved in the production and release of soluble CD26 from the cell surface are not yet fully understood. The decrease in soluble CD26 production after YS110 treatment may be due to antibody-mediated internalization of the cell surface CD26 molecule (Yamada K, et al., (2013) cited above). In a Phase I clinical trial using YS110, serum concentrations of soluble CD26 immediately after YS110 administration on day 1 (after day 1 administration) were significantly lower than serum concentrations before YS110 administration (before day 1 administration) (Figure 1). Phagocytosis of the soluble CD26-YS110 complex by phagocytic cells via Fc receptors may be involved in the rapid decrease of serum soluble CD26 after YS110 administration. In this study, we demonstrated that persistently low levels of serum soluble CD26 / DPP4 titer after YS110 administration were commonly observed in SD cases compared to PD cases, but there was no significant difference in serum soluble CD26 / DPP4 levels immediately after YS110 administration (after day 1 administration, after day 15 administration, and after day 29 administration) between SD and PD cases (Figures 1 and 3).

[0113] These results represent the first findings suggesting that changes in serum soluble CD26 / DPP4 titers in the early stages of treatment with the humanized anti-CD26 antibody YS110 may be a predictive biomarker for antitumor activity in CD26+ cancer patients, including MM.

Claims

1. A method for selecting cancer patients who may be able to receive therapeutic effects from anti-CD26 antibodies (excluding diagnostic acts performed by a physician or a person under the direction of a physician), Using ROC analysis, compare the level of soluble CD26 in the patient's serum before baseline administration of anti-CD26 antibody with the level of soluble CD26 in the patient's serum on the measurement day, and If the level of soluble CD26 in the patient's serum on the measurement day is less than 85% of the level of soluble CD26 in the patient's serum before reference administration, the patient is selected as potentially eligible for treatment with an anti-CD26 antibody. Here, the measurement dates are from day 1 to day 60, with the reference administration day being day 1, and The patient in question is a patient who has received at least one dose of anti-CD26 antibody as a standard dose, and, If the measurement date corresponds to the day on which the anti-CD26 antibody was administered, the level of soluble CD26 in the patient's serum on that measurement date is the level of soluble CD26 in the patient's serum before the administration of the anti-CD26 antibody on that measurement date. The aforementioned patient is a patient who receives anti-CD26 antibody once a week, and The measurement date is between 2 and 8 days after the standard dose, and If the level of soluble CD26 in the patient's serum on the measurement day is less than 50% of the level of soluble CD26 in the patient's serum before baseline administration, the patient is selected as potentially eligible for treatment with anti-CD26 antibodies. The aforementioned patient is a patient who is administered 6 mg / kg of anti-CD26 antibody, The cancer is malignant mesothelioma. method.

2. The method according to claim 1, wherein if the measurement date is 15 to 29 days after the reference administration, and the level of soluble CD26 in the patient's serum on the measurement date is less than 30% of the level of soluble CD26 in the patient's serum before the reference administration, the patient is selected as potentially being able to obtain a therapeutic effect from the anti-CD26 antibody.

3. The aforementioned patient is a patient who receives anti-CD26 antibody at a frequency of once every two weeks, and The aforementioned measurement date is the 29th day after the standard administration, and The method according to claim 1, wherein if the level of soluble CD26 in the patient's serum on the measurement day is less than 50% of the level of soluble CD26 in the patient's serum before reference administration, the patient is selected as potentially eligible for therapeutic effects from an anti-CD26 antibody.

4. The method according to claim 3, wherein the patient is male.

5. The method according to claim 1, wherein if the level of soluble CD26 in the patient's serum on the measurement day is less than 50% of the level of soluble CD26 in the patient's serum before reference administration, the patient is selected as potentially eligible for therapeutic effects from an anti-CD26 antibody.

6. The aforementioned patient is a patient who receives anti-CD26 antibody once a week, and The measurement date is 15 days or later from the reference dose, and The method according to claim 1, wherein if the level of soluble CD26 in the patient's serum on the measurement day is less than 30% of the level of soluble CD26 in the patient's serum before reference administration, the patient is selected as potentially eligible for therapeutic effects from an anti-CD26 antibody.

7. The method according to claim 6, wherein if the level of soluble CD26 in the patient's serum on the measurement day is less than 30% of the level of soluble CD26 in the patient's serum before reference administration, the patient is selected as potentially eligible for therapeutic effects from an anti-CD26 antibody.

8. The method according to any one of claims 1 to 7, wherein the standard dose is the first dose.

9. The method according to any one of claims 1 to 7, wherein the patient is a patient who is administered 0.1 to 6 mg / kg of anti-CD26 antibody.

10. The method according to claim 1 or claim 2, wherein the patient is a patient who is administered an anti-CD26 antibody at a frequency of once every two weeks or once a week.

11. The method according to any one of claims 1 to 10, wherein the anti-CD26 antibody is YS110.

Images