MICA ANTIBODIES / BY METHODS OF USE

Abstract

Antibodies that specifically bind to MICA / B, which have variable heavy chain (VH) domains, variable light chain (VL) domains, and complementarity-determining regions described herein, are provided, along with methods and uses thereof.

Description

BRIEF DESCRIPTION OF THE INVENTION This paper describes monoclonal antibodies that specifically bind to MICA / B and thereby modulate an immune response against diseased cells. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 7. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 7.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO: 7.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain that... QQzcnn / Lznz / q / Yi comprise an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable light chain (VL) domain comprising an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence listed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence listed as SEQ ID NO: 10. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 8.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising a sequence of. QQzcnn / Lznz / q / Yi; amino acids at least 95% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the light chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 9. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 10.In some formulations, the monoclonal antibody or antigen-binding fragment specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the monoclonal antibody or antigen-binding fragment binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some formulations, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment is selected from a whole immunoglobulin, scFv, Fab, F(ab')2, or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment is an IgG or IgM.In some forms, the monoclonal antibody or fragment thereof is humanized or chimeric. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 8. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 8.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising a variable heavy chain (VH) domain that. QQzcnn / Lznz / q / Yii comprise an amino acid sequence at least 99% identical to an amino acid sequence listed as SEQ ID NO: 8. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 8.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising a variable heavy chain (VH) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9. QQzcnn / Lznz / q / Yii antigen-binding monoclonal antibody comprising a variable heavy chain (VH) domain comprising an amino acid sequence 100% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO: 7.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 7. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 10. In some embodiments, the light chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 9. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.In some formulations, the monoclonal antibody or antigen-binding fragment thereof is linked to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some formulations, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, an scFv, a Fab, an F(ab')i, or a disulfide-linked Fv. In some formulations, the monoclonal antibody or fragment of... QQzcnn / Lznz / q / Yii antigen binding is an IgG or IgM. In some forms, the monoclonal antibody or fragment thereof is humanized or chimeric. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 3.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 3.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 3.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 100% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 100% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 100% identical to SEQ ID NO: 3.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10. QQzcnn / Lznz / q / Yii presents, in certain embodiments, monoclonal antibodies or antigen-binding fragments thereof, comprising at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 100% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 100% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 100% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 6.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 6.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 4, a complementarity-determining region 2 (CDR2) sequence. QQzcnn / Lznz / á / Yi heavy chain 100% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence 100% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (VL) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (VH) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (VH) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 7. In some embodiments, the light chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 9. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 10. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins.In some formulations, the monoclonal antibody or antigen-binding fragment thereof is linked to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some formulations, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, scFv, Fab, F(ab')2, or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. In some formulations, the monoclonal antibody or fragment thereof is humanized or chimeric. Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence QQzcnn / Lznz / q / Yii at least 80% identical to SEQ ID NO: 6. Monoclonal antibodies or antigen-binding fragments thereof are hereby described in certain modalities, comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 6.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 6.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 6.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence 100% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence 100% identical to SEQ ID NO: 6.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9.QQzcnn / Lznz / q / Yi themselves, comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain embodiments, comprising at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9.Monoclonal antibodies or antigen-binding fragments thereof are described herein in certain modalities, comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence 100% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence 100% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain that does not have a QQzcnn / Lznz / q / Yii amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 3. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 3.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 3. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence 100% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence 100% identical a SEQ ID NO: 3.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (LV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (LV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 10. In some embodiments, the light chain comprises an amino acid sequence in which at least 1 to 10 amino acids are modified from the amino acid sequence listed as SEQ ID NO: 9. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.In some formulations, the monoclonal antibody or antigen-binding fragment thereof is linked to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some formulations, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, scFv, Fab, F(ab')2, or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. In some formulations, the monoclonal antibody or fragment thereof is humanized or chimeric. Pharmaceutical compositions comprising, in certain forms, a monoclonal antibody or an antigen-binding fragment thereof according to any of the descriptions herein; and a pharmaceutically acceptable carrier or excipient. Methods for treating cancer in an individual in need thereof are described herein in certain embodiments, comprising administering to the individual an effective quantity of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one heavy chain complementarity-determining region 1 (CDR1) sequence QQzcnn / Lznz / q / Yi; less than 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (VL) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (VH) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (LV) comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.In some modality, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some modality, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. In some modality, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, scFv, Fab, F(ab')2, or disulfide-linked Fv. In some modality, the monoclonal antibody or antigen-binding fragment thereof is IgG or IgM. In some modality, the monoclonal antibody or fragment thereof is humanized or chimeric. In some modality, the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both. In some modality, the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both.In some forms, the monoclonal antibody or its antigen-binding fragment inhibits the release of soluble MICA protein, soluble MICB protein, or both. In some forms, the cancer is hepatocellular carcinoma. This document describes, in certain forms, methods for treating cancer in an individual in need of it, which includes administering to the individual a quantity QQzcnn / Lznz / q / Yi effective of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and a complementarity-determining region sequence Complementarity 3 (CDR3) of light chain at least 80% identical to SEQ ID NO: 3.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (LV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (LV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some embodiments, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some embodiments, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, scFv, Fab, F(ab')2, or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. In some formulations, the monoclonal antibody or fragment thereof is humanized or chimeric. In some formulations, the monoclonal antibody or antigen-binding fragment thereof reduces the level of the... QQzcnn / Lznz / q / Yi soluble MICA protein, soluble MICB protein, or both. In some forms, the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both. In some forms, the monoclonal antibody or antigen-binding fragment thereof inhibits the shedding of soluble MICA protein, soluble MICB protein, or both. In some forms, the cancer is hepatocellular carcinoma. Methods for treating hepatocellular carcinoma in an individual in need thereof are described herein in certain modalities, comprising administering to the individual an effective amount of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, one heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and one heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (VL) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain (LV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins.In some forms, the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. QQzcnn / Lznz / q / Yii MICB. In some formulations, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some formulations, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, an scFv, a Fab, an F(ab')z, or a disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. In some formulations, the monoclonal antibody or fragment thereof is humanized or chimeric. In some formulations, the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both.In some forms, the monoclonal antibody or antigen-binding fragment thereof inhibits the release of soluble MICA protein, soluble MICB protein, or both. Methods for treating hepatocellular carcinoma in an individual in need thereof are described herein in certain modalities, comprising administering to the individual an effective quantity of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence. QQzcnn / Lznz / q / Yi listed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some embodiments, the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both. In some embodiments, the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, scFv, Fab, F(abj2), or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. In some formulations, the monoclonal antibody or fragment thereof is humanized or chimeric. In some formulations, the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both. In some formulations, the monoclonal antibody or antigen-binding fragment thereof inhibits the shedding of soluble MICA protein, soluble MICB protein, or both. Methods for reducing the level of soluble MICA protein, soluble MICB protein, or both in an individual in need thereof are described herein, in certain embodiments, comprising administering to the individual an effective amount of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment QQzcnn / Lznz / q / Yi; The antigen thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7.In some formulations, the monoclonal antibody or antigen-binding fragment specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the monoclonal antibody or antigen-binding fragment binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the MICA protein is soluble MICA protein. In some formulations, the MICB protein is soluble MICB protein. In some formulations, the monoclonal antibody or antigen-binding fragment is selected from a whole immunoglobulin, scFv, Fab, F(ab')2, or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment is IgG or IgM. In some formulations, the monoclonal antibody or fragment is humanized or chimeric.In some cases, the monoclonal antibody or its antigen-binding fragment reduces or inhibits the shedding of soluble MICA protein, soluble MICB protein, or both, thereby lowering the level of soluble MICA protein, soluble MICB protein, or both in the individual. In some cases, the individual has a cancer characterized by elevated levels of soluble MICA protein, soluble MICB protein, or both. In some cases, the cancer is hepatocellular carcinoma. Methods for reducing the level of soluble MICA protein, soluble MICB protein, or both in an individual in need thereof are described herein, in certain embodiments, comprising administering to the individual an effective quantity of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence QQzcnn / Lznz / q / Yii at least 80% identical to SEQ ID NO: 6. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain (HV) comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8.In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to a MICA protein, a MICB protein, or both MICA and MICB proteins.In some formulations, the monoclonal antibody or antigen-binding fragment thereof is linked to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. In some formulations, the MICA protein is soluble MICA protein. In some formulations, the MICB protein is soluble MICB protein. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is selected from a whole immunoglobulin, scFv, Fab, F(ab')z, or disulfide-linked Fv. In some formulations, the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. In some formulations, the monoclonal antibody or fragment thereof is humanized or chimeric.In some cases, the monoclonal antibody or its antigen-binding fragment reduces or inhibits the shedding of soluble MICA protein, soluble MICB protein, or both, thereby lowering the level of soluble MICA protein, soluble MICB protein, or both in the individual. In some cases, the individual has a cancer characterized by elevated levels of soluble MICA protein, soluble MICB protein, or both. In some cases, the cancer is hepatocellular carcinoma. Monoclonal antibodies are described herein in certain modalities or QQzcnn / Lznz / q / Yii antigen-binding fragments thereof, according to any of the descriptions herein, are described herein for use in treating cancer in an individual in need thereof. Also described herein, in certain forms, are monoclonal antibodies or antigen-binding fragments thereof, according to any of the descriptions herein, for use in the preparation of a drug to treat cancer in an individual in need thereof. In some forms, the cancer is hepatocellular carcinoma. BRIEF DESCRIPTION OF THE DRAWINGS An understanding of the features and advantages of the present invention will be obtained by referring to the following detailed description, which sets out illustrative modalities, in which the principles of the invention are used, and the accompanying figures, of which: FIGURE 1 illustrates kinetic measurements of the PDI-1 antibody to MICA antigens (MICA*01 and MICA*08) by BioLayer Interferometry. FIGURE 2 illustrates the binding of the PDI-1 antibody to MICA / B alleles by ELISA. FIGURE 3 exemplifies that the PDI-1 antibody binds to cell surface MICA, as evaluated by cell staining of the MICA*04 transfected TRAMP C2 cell. FIGURE 4 exemplifies that the PDI-1 antibody inhibits the shedding of MICA from PLC / PRF / 5 cells. FIGURE 5 exemplifies that PDI-1 enhances NK-92 cell-mediated cytotoxicity of PLC / PRF / 5 cells. FIGURE 6 illustrates the measurement of soluble MICA levels in the serum of the human liver cancer xenograft model using the PDI-1 antibody. DETAILED DESCRIPTION OF THE INVENTION This paper describes, in some forms, monoclonal antibodies that specifically bind to MICA / B. In some forms, the MICA / B antibodies described herein bind to MICA / B proteins or fragments thereof and modulate the immune response in an individual, thereby treating cancer (e.g., hepatocellular carcinoma). The major histocompatibility complex class I (MICA / B) chains A and B are two stress-inducible ligands for the natural killer (NK) cell receptor NKG2D and play an important role in mediating NK and T cell cytotoxicity. Soluble MICA / B released by diseased cells (e.g., cancer cells) desensitizes NK and T cells by binding to the NKG2D receptor, thereby suppressing the immune response. Therefore, modulating MICA / B is useful in modulating an immune response in an individual, for example, in an individual with cancer. Antibodies that bind to MICA / B and modulate its activity are also relevant. QQzcnn / Lznz / q / Yi are desirable for the development of novel therapeutic agents for cancer treatment. Certain terminology As used herein, “MICA / B” refers to MICA protein, MICB protein, or both MICA and MICB proteins, including their variants, isoforms, and species homologs of human MICA / B. As used herein, “antibody” refers to a glycoprotein that exhibits specific binding to a specific antigen. An antibody frequently comprises a variable domain and a constant domain in each of its heavy and light chains. Accordingly, most antibodies have a heavy chain variable domain (HV) and a light chain variable domain (LV) that together form the antigen-binding portion of the antibody. Within each variable domain are three complementarity-determining regions (CDRs) that form loops in the heavy chain variable domain (HV) and the light chain variable domain (LV) that make contact with the antigen surface. Antibodies herein also include an “antigen-binding portion,” or fragments of the antibody that are capable of binding to the antigen. As used herein, “chimeric” antibodies are antibodies that have a portion of the heavy and / or light chain identical or homologous to the corresponding sequence in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical or homologous to the corresponding sequence(s) in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of these antibodies, provided they exhibit the desired biological activity (see, for example, Morrison et al., Proc. Nati. Acad. Sci. USA 81:6851-6855 (1984)). “Humanized antibodies” herein refers to chimeric antibodies that have substituted human sequences in the antibody sequence. The terms “recipient,” “individual,” “subject,” “host,” and “patient” are used interchangeably herein and, in some cases, refer to any subject or mammal for whom diagnosis, treatment, or therapy is desired, particularly humans. “Mammal” for treatment purposes refers to any animal classified as a mammal, including humans, domestic and farm animals, and laboratory, zoo, sporting, or pet animals, such as dogs, horses, cats, cows, sheep, goats, pigs, mice, rats, rabbits, guinea pigs, monkeys, etc. In some modalities, the mammal is human. As used herein, the terms “treatment,” “treat,” and similar terms, in some cases, refer to administering an agent or performing a procedure for the purpose of achieving an effect. The effect may be prophylactic in terms of completely preventing or QQ7Cnn / L7n7 / q / Yli partially a disease or a symptom thereof and / or may be therapeutic in terms of effecting a partial or complete cure for a disease and / or symptoms of the disease. “Treatment”, as used herein, may include treatment of a disease or disorder (e.g., cancer) in a mammal, particularly a human, and includes: (a) preventing the disease or a symptom of a disease occurring in a subject who may be predisposed to the disease but has not yet been diagnosed with it (e.g., including diseases that may be associated with or caused by a primary disease); (b) inhibiting the disease, i.e., stopping its development; and (c) alleviating the disease, i.e., causing the disease to regress."Treatment" may refer to any indication of success in the treatment, improvement, or prevention of cancer, including any objective or subjective parameter such as decrease; remission; reduction of symptoms; making the disease condition more tolerable to the patient; slowing the rate of regeneration or decline; or making the endpoint of degeneration less debilitating. Treatment or improvement of symptoms is based on one or more objective or subjective parameters, including the results of an examination by a physician. Accordingly, the term "treat" includes the administration of the compounds or agents of the present invention to prevent or delay, alleviate, or stop or inhibit the development of symptoms or conditions associated with diseases (e.g., cancer). The term "therapeutic effect" refers to the reduction, elimination, or prevention of the disease, disease symptoms, or disease side effects in the subject. A “therapeutically effective amount” in some cases means the amount that, when administered to a subject to treat a disease, is sufficient to accomplish the treatment for that disease. As used herein, the singular forms “a / an” and “the” include plural referents unless the context clearly indicates otherwise. Thus, for example, the reference to “an antibody” includes a plurality of antibodies, and the reference to “an antibody” in some modalities includes multiple antibodies, and so on. As used herein, all numeric values ​​or numeric ranges include whole numbers within or spanning these ranges and fractions of the values ​​or whole numbers within or spanning ranges unless the context clearly indicates otherwise. Thus, for example, a reference to a range of 90100% includes 91%, 92%, 93%, 94%, 95%, 95%, 97%, etc., as well as 91.1%, 91.2%, 91.3%, 91.4%, 91.5%, etc., 92.1%, 92.2%, 92.3%, 92.4%, 92.5%, etc., and so on. In another example, the reference to an interval of 1-5,000 times includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, times, etc., as well as 1.1, 1.2, 1.3, 1.4, 1.5, times, etc., 2.1, 2.2, 2.3, 2.4, 2.5, times, etc., and so on. “Approximately” a number, as used herein, refers to an interval that includes the number and ranges from 10% below that number to 10% above that number. “Approximately” an interval refers to 10% below the lower limit of the interval, encompassing 10% above the upper limit of the interval. MICA / B In this document, monoclonal antibodies that bind specifically to MICA / B are described in some modalities. The Major Histocompatibility Complex (MHC) chain-related proteins A and B (MICA / B) are glycosylated, polymorphic, non-classical, membrane-anchored MHC class I proteins. MICA / B relates to MHC class I and has a similar domain structure comprising three extracellular Ig-like domains (alpha-1, alpha-2, and alpha-3), a transmembrane domain, and a C-terminal cytoplasmic tail. However, MICA / B does not associate with p2-microglobulin, lacks a CD8-binding site, and does not present any antigen. MICA / B are ligands for the Natural Killer 2D group of the C-type lectin-like activating receptor (NKG2D) on immune effector cells, including NK cells, NKT cells, and both CD8+αβ and γδ T cells. The interaction of MICA / B and NKG2D plays a role in tumor surveillance and in the immune response. MICA / B proteins are normally expressed at low levels in normal cells, but are expressed at higher levels in stressed or transformed cells (e.g., cancer cells). The interaction of immune effector cells bearing NKG2D with stressed or diseased cells expressing MICA / B ligands on their cell surface creates a cellular immune response against the stressed / disease cell, culminating in the death of the MICA / B-expressing cells. In cancer cells, truncated MICA / B proteins (proteins lacking the transmembrane domain and cytoplasmic tail but retaining the three alpha-1, 2, and 3 domains that comprise the extracellular domain) are frequently released into the bloodstream by proteases, resulting in downregulation (receptor internalization) of their proposed receptor, NKG2D, on immune effector cells.In some cases, MICA / B glycoproteins are produced intracellularly and are not routinely destined to bind to the cell surface membrane. Instead, they are incorporated into exosomes and released outside the cell, where they interact with NKG2D receptors on immune cells. These truncated or soluble MICA / B ligands shed from the surface of cancer cells act as decoy molecules and lead to downregulation of the NKG2D receptor on immune effector cells such as NK, NKT, and various CD8+ T cells. In some cases, the formation of soluble MICA / B leads to the unusual situation where effectors of the innate immune system, whose natural function is to seek out and destroy transformed cells, are inactivated. QQzcnn / Lznz / á / Yi due to the immunosuppressive actions of these decoy ligand molecules, thus allowing cancer cells to hide from the immune system and grow unchecked. Hepatocellular Carcinoma (HCC) In some modalities, the MICA / B antibodies described herein bind to MICA / B proteins or fragments thereof and modulate the immune response in an individual, thereby treating cancer (e.g., hepatocellular carcinoma). Hepatocellular carcinoma (HCC) is a primary malignant condition of the liver and occurs predominantly in individuals with underlying chronic liver disease and cirrhosis. Tumors progress with local expansion, intrahepatic dissemination, and distant metastasis. Hepatitis B and Hepatitis C predispose individuals to the development of chronic liver disease and subsequent HCC. Obesity, diabetes, alcohol abuse, and several other factors also predispose individuals to the development of HCC. MICA / B antibodies Antibodies that bind specifically to MICA / B proteins are provided herein. In some formulations, the MICA / B antibodies comprise at least one heavy chain comprising a heavy chain variable domain (HV) and at least one light chain comprising a light chain variable domain (LV). Each HV and LV comprises three complementarity-determining regions (CDRs). The amino acid sequences of the HV and LV and the CDRs determine the antigen-binding specificity and antigen-binding resistance of the antibody. The amino acid sequences of the HV and LV and the CDRs are summarized in Table 1. QQzcnn / L^nz / q / Yi Table 1: Anti-MICA / B monoclonal antibody sequences (PDI-1) SEQUENCE SEQ ID NO: Light chain CDR1 SASQGISNYLN 1 Light chain CDR2 TSLLHSG 2 Light chain CDR3 QQYSKFPRT 3 Heavy chain CDR1 GYTFTNYGMN 4 Heavy chain CDR2 INTYTGEPTYADDFKG 5 CDR3 heavy chain NYGNYLFDY 6 Lightweight chain variable dominance DIQMTQTTSSLSASLGDRVTISCSASQGISNYLNWYQQKPDGTLKLLIQ YTSLLHSGVPSRFSGSGSGTEYSLTISNLEPEDIATYFCQQYSKFPRTF GGGTKLEIKR 7 Lightweight chain variable dominance QIQLVQSGPELKKSGETVKISCKAFGYTFTNYGMNWVKQAPGKGLKW MGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINHLKNEDTATYF CARNYGNYLFDYWGQGTTLTVSS 8 Lightweight chain METDTLLLWVLLLWVPGSTGDIQMTQTTSSLSASLGDRVTISCSASQG ISNYLNWYQQKPDGTLKLLIQYTSLLHSGVPSRFSGSGSGTEYSLTISN LEPEDIATYFCQQYSKFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLT SGGASWCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC** 9 Cadena pesada METDTLLLWVLLLWVPGSTGQIQLVQSGPELKKSGETVKISCKAFGYT FTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLET SASTAYLQINHLKNEDTATYFCARNYGNYLFDYWGQGTTLTVSSAKTT APSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVH TFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR GPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCWVDVS EDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDW MSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYS KLRVEKKNWVERNSYSCSWHEGLHNHHTTKSFSRTPG** 10 In some modalities, antibodies bind specifically to a MICA protein. In some modalities, antibodies bind specifically to a MICB protein. In some modalities, antibodies bind specifically to both MICA and MICB proteins. In some modalities, antibodies bind to an alpha-3 domain of a MICA protein. In some modalities, antibodies bind to an alpha-3 domain of a MICB protein. In some modalities, antibodies bind to an alpha-3 domain of both MICA and MICB proteins. In some modalities, antibodies bind to a MICA protein that is membrane-bound. In some modalities, antibodies bind to a MICA protein that is soluble. In some modalities, antibodies bind to a MICA protein that is both membrane-bound and soluble.In some modalities, antibodies bind to a membrane-bound MICB protein. In some modalities, antibodies bind to a soluble MICB protein. In some modalities, antibodies bind to a MICB protein that is both a membrane-bound and a soluble MICB protein. In some modalities, the antibodies that bind specifically to MICA / B are monoclonal antibodies. In some modalities, the antibody is an antigen-binding fragment. In some modalities, the antibody is selected from a whole immunoglobulin, an scFv, a Fab, an F(abj2), or a disulfide-linked Fv. In some modalities, the antibody is an IgG or an IgM. In some modalities, the antibody is humanized. In some modalities, the antibody is chimeric. MICA / B Antibody Variable Domain In this paper, antibodies that bind specifically to MICA / B and have a light chain comprising a variable light chain (VL) domain are described. In some modalities, the antibodies that bind to MICA / B comprise a variable light chain (VL) domain that has an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 7. In some modalities, the VL has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 7. In some modalities, the VL has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 7. Also described herein are antibodies that bind specifically to MICA / B that have a heavy chain comprising a variable heavy chain (VH) domain. In some modality, the antibodies that bind to MICA / B comprise a variable heavy chain (VH) domain that has an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 8. In some modality, the VH has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 8. In some modality, the VH has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 8. Also described herein are MICA / B-binding antibodies comprising a light chain variable (LV) domain and a heavy chain variable (HV) domain. In some embodiments, the MICA / B-binding antibodies comprise a light chain variable (LV) domain having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 7 and a heavy chain variable (HV) domain having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ QQzcnn / Lznz / q / Yi ID NO: 8. In some modalities, the VL has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence exposed as SEQ ID NO: 7 and the VH has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the VL has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 7 and the VH has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 8. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a light chain that does not have an amino acid sequence listed as SEQ ID NO: 9.In some embodiments, the light chain comprises an amino acid sequence in which at least 1 to 10 amino acids of the amino acid sequence listed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 1 amino acid of the amino acid sequence listed as SEQ ID NO: 9 is modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 2 amino acids of an amino acid sequence listed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 3 amino acids of an amino acid sequence listed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 4 amino acids of an amino acid sequence listed as SEQ ID NO: 9 are modified.In some embodiments, the light chain comprises an amino acid sequence in which at least 5 amino acids of an amino acid sequence disclosed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 6 amino acids of an amino acid sequence disclosed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 7 amino acids of an amino acid sequence disclosed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 8 amino acids of an amino acid sequence disclosed as SEQ ID NO: 9 are modified. In some embodiments, the light chain comprises an amino acid sequence in which at least 9 amino acids of an amino acid sequence disclosed as SEQ ID NO: 9 are modified.In some embodiments, the light chain comprises an amino acid sequence in which at least 10 amino acids of an amino acid sequence exposed as SEQ ID NO: 9 are modified. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof. QQzcnn / Lznz / q / Yii comprises a heavy chain that does not have an amino acid sequence exposed as SEQ ID NO: 10. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 1 to 10 amino acids of the amino acid sequence exposed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 1 amino acid of the amino acid sequence exposed as SEQ ID NO: 10 is modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 2 amino acids of an amino acid sequence exposed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 3 amino acids of an amino acid sequence exposed as SEQ ID NO: 10 are modified.In some embodiments, the heavy chain comprises an amino acid sequence in which at least 4 amino acids of an amino acid sequence listed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 5 amino acids of an amino acid sequence listed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 6 amino acids of an amino acid sequence listed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 7 amino acids of an amino acid sequence listed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 8 amino acids of an amino acid sequence listed as SEQ ID NO: 10 are modified.In some embodiments, the heavy chain comprises an amino acid sequence in which at least 9 amino acids of an amino acid sequence exposed as SEQ ID NO: 10 are modified. In some embodiments, the heavy chain comprises an amino acid sequence in which at least 10 amino acids of an amino acid sequence exposed as SEQ ID NO: 10 are modified. MICA / B Antibody Complementarity Determining Regions Antibodies specifically binding to MICA / B are described herein, which have a light chain comprising a light chain complementarity-determining region (CDR). In some embodiments, the MICA / B-binding antibodies comprise at least one of the following: a light chain CDR1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 2, and a light chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 3. In some embodiments, the MICA / B-binding antibodies comprise at least one QQzcnn / Lznz / q / Yi; of a light chain of a light chain CDR1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence disclosed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence disclosed as SEQ ID NO: 2, and a light chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence disclosed as SEQ ID NO: 3.In some modalities, the antibodies that bind to MICA / B comprise at least one of a light chain CDR1 having an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 2, and a light chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 3. Also described herein are antibodies that bind specifically to MICA / B having a heavy chain comprising a heavy chain complementarity-determining region (CDR). In some embodiments, the MICA / B-binding antibodies comprise at least one of the following: a heavy chain CDE1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 6.In some modalities, the antibodies that bind to MICA / B comprise at least one of a heavy-chain CDE1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 4, a heavy-chain CDR2 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 5, a heavy chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 6. In some modalities, the antibodies that bind to. QQzcnn / Lznz / q / Yi MICA / B comprise at least one of a heavy chain CDE1 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 6. Also described herein are antibodies that bind to MICA / B comprising a light chain complementarity-determining region (CDR) and a heavy chain complementarity-determining region (CDR). In some embodiments, the antibodies that bind to MICA / B comprise at least one of the following: a light chain CDR1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 2, a light chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 3, and a light chain CDR1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 4.a heavy chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 6. In some modalities, the MICA / B-binding antibodies comprise at least one of a light chain CDR1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at less approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 2,a light chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence disclosed as SEQ ID NO: 3, a light chain CDR1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence exposed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, QQzcnn / Lznz / q / Yi 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 6.In some modalities, the antibodies that bind to MICA / B comprise at least one of a light chain CDR1 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 2, a light chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 3, a light chain CDR1 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 6. Treatment and Use Methods Methods for treating cancer (e.g., hepatocellular carcinoma) in an individual in need thereof are provided herein, comprising the administration of a MICA / B antibody described herein. Methods for reducing the level of soluble MICA / B proteins in an individual in need thereof are also provided herein, comprising the administration of a MICA / B antibody described herein. In some modalities, the antibodies that bind to MICA / B comprise at least one of a light chain CDR1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 2, and a light chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 3.In some modalities, the antibodies that bind to MICA / B comprise at least one of a light chain CDR1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 1, and a light chain CDR2 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 2, and a light chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 3.In some modalities, the antibodies that bind to MICA / B comprise at least one of a light chain CDR1 having an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 2, and a light chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 3. Also described herein are antibodies that bind specifically to MICA / B and have a heavy chain comprising a heavy chain complementarity-determining region (CDR). In some embodiments, the MICA / B-binding antibodies comprise at least one of the following: a heavy chain CDE1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 6.In some modalities, the antibodies that bind to MICA / B comprise at least one of a heavy-chain CDE1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 4, a heavy-chain CDR2 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 5, a heavy chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 6.In some modalities, the antibodies that bind to MICA / B comprise at least one of a heavy chain CDE1 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 6. Also described herein are antibodies that bind to MICA / B comprising a light chain complementarity-determining region (CDR) and a heavy chain complementarity-determining region (CDR). In some embodiments, the antibodies that bind to MICA / B comprise at least one of the following: a light chain CDR1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 2, a light chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 3, and a light chain CDR1 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 4.a heavy chain CDR2 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 6. In some modalities, the MICA / B-binding antibodies comprise at least one of a light chain CDR1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence at less approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 2,a light chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence disclosed as SEQ ID NO: 3, a light chain CDR1 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,or 99% identical to an amino acid sequence listed as SEQ ID NO: 6. In some modalities, the antibodies that bind to MICA / B comprise at least one, QQzcnn / Lznz / q / Yi of a light chain CDR1 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 1, a light chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 2, a light chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 3, a light chain CDR1 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 4, a heavy chain CDR2 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 5, and a heavy chain CDR3 having an amino acid sequence 100% identical to an amino acid sequence exposed as SEQ ID NO: 6. In this paper, antibodies that bind specifically to MICA / B and have a light chain comprising a variable light chain (VL) domain are described. In some modalities, the antibodies that bind to MICA / B comprise a variable light chain (VL) domain that has an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 7. In some modalities, the VL has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 7. In some modalities, the VL has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 7. Also described herein are antibodies that bind specifically to MICA / B that have a heavy chain comprising a variable heavy chain (VH) domain. In some modality, the antibodies that bind to MICA / B comprise a variable heavy chain (VH) domain that has an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 8. In some modality, the VH has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 8. In some modality, the VH has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 8. Also described herein are MICA / B-binding antibodies comprising a light chain variable (LV) domain and a heavy chain variable (HV) domain. In some embodiments, the MICA / B-binding antibodies comprise a light chain variable (LV) domain having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ ID NO: 7 and a heavy chain variable (HV) domain having an amino acid sequence at least approximately 70% identical to an amino acid sequence listed as SEQ QQzcnn / Lznz / q / Yii ID NO: 8. In some modalities, the VL has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence exposed as SEQ ID NO: 7 and the VH has an amino acid sequence at least approximately 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence listed as SEQ ID NO: 8. In some forms, the VL has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 7 and the VH has an amino acid sequence 100% identical to an amino acid sequence listed as SEQ ID NO: 8. In some modalities, antibodies bind specifically to a MICA protein. In some modalities, antibodies bind specifically to a MICB protein. In some modalities, antibodies bind specifically to both MICA and MICB proteins. In some modalities, antibodies bind to an alpha-3 domain of a MICA protein. In some modalities, antibodies bind to an alpha-3 domain of a MICB protein. In some modalities, antibodies bind to an alpha-3 domain of both MICA and MICB proteins. In some modalities, antibodies bind to a MICA protein that is membrane-bound. In some modalities, antibodies bind to a MICA protein that is soluble. In some modalities, antibodies bind to a MICA protein that is both membrane-bound and soluble.In some modalities, antibodies bind to a membrane-bound MICB protein. In some modalities, antibodies bind to a soluble MICB protein. In some modalities, antibodies bind to a MICB protein that is both a membrane-bound and a soluble MICB protein. In some modalities, the antibodies that bind specifically to MICA / B are monoclonal antibodies. In some modalities, the antibody is an antigen-binding fragment. In some modalities, the antibody is selected from a whole immunoglobulin, an scFv, a Fab, an F(abj2), or a disulfide-linked Fv. In some modalities, the antibody is an IgG or an IgM. In some modalities, the antibody is humanized. In some modalities, the antibody is chimeric. In some modalities, the antibodies described herein reduce the level of soluble MICA protein. In some modalities, the antibodies described herein reduce the level of soluble MICB protein. In some modalities, the antibodies described herein reduce the level of both soluble MICA and soluble MICB proteins. In some modalities, the antibodies described herein reduce the shedding of soluble MICA protein. In some modalities, the antibodies described herein reduce the shedding of soluble MICB protein. In some modalities, the antibodies described herein reduce the shedding of both soluble MICA and soluble MICB proteins. In some modalities, the antibodies described herein inhibit the shedding of soluble MICA protein.In some forms, the antibodies described herein inhibit the shedding of soluble MICB protein. In some forms, the antibodies described herein inhibit the shedding of both soluble MICA and soluble MICB proteins. In some forms, the antibodies described herein reduce or inhibit the shedding of soluble MICA protein, soluble MICB protein, or both, thereby reducing the level of soluble MICA protein, soluble MICB protein, or both. Any suitable route of administration is contemplated for use with the method described herein. In some formulations, the antibody is administered intravenously. In some formulations, the antibody is administered subcutaneously. In some formulations, the antibody is administered locally. In some formulations, the antibody is administered systemically (e.g., intravenously, intramuscularly, subcutaneously, intradermally, orally, intranasally, sublingually). In some formulations, the antibody is formulated as a balm, lotion, or emulsion. In some formulations, the antibody is formulated as a solution. In some formulations, the antibody is formulated for topical, oral, buccal, or nasal administration. In some modalities, the individual is monitored prior to antibody administration. Symptoms are identified and their severity assessed. An antibody as described herein is administered alone or in combination with additional treatments, either individually or in multiple doses over time as outlined herein or as conducted by someone experienced in the technique. In some modalities, the individual is monitored to determine the efficacy of the treatment regimen. In some modalities, a treatment regimen is modified in response to preliminary treatment results, such that the treatment dose or frequency, or both, is altered to achieve a desired level of response in the subject with a view to symptom relief, reduction of side effects, or a combination of symptom relief and reduction of side effects. Therapeutically effective amounts and dosages are considered, including dosages from approximately 0.01 mg / kg to approximately 20 mg / kg, for example, approximately 0.01 mg / kg, approximately 0.02 mg / kg, approximately 0.03 mg / kg, approximately 0.04 mg / kg, approximately 0.05 mg / kg, approximately 0.06 mg / kg, approximately 0.07 mg / kg, approximately 0.08 mg / kg, approximately 0.09 mg / kg, approximately 0.1 mg / kg, approximately 0.2 mg / kg, approximately 0.3 mg / kg, approximately 0.4 mg / kg, approximately 0.5 mg / kg. approximately 0.6 mg / kg, 38 approximately 0.7 mg / kg, approximately 0.8 mg / kg, approximately 0.9 mg / kg, approximately 1.0 mg / kg, approximately 1.1 mg / kg, approximately 1.2 mg / kg, approximately 1.3 mg / kg, approximately 1.4 mg / kg, approximately 1.5 mg / kg, approximately 1.6 mg / kg, approximately 1.7 mg / kg, 5 approximately 1.8 mg / kg, approximately 1.9 mg / kg, approximately 2 mg / kg, approximately 2.1 mg / kg, approximately 2.2 mg / kg, approximately 2.3 mg / kg, approximately 2.4 mg / kg, approximately 2.5 mg / kg, approximately 2.6 mg / kg, approximately 2.7 mg / kg, approximately 2.8 mg / kg, approximately 2.9 mg / kg, approximately 3 mg / kg, approximately 3.1 mg / kg, approximately 3.2 mg / kg, 10 approximately 3.3 mg / kg, approximately 3.4 mg / kg, approximately 3.5 mg / kg, approximately 3.6 mg / kg, approximately 3.7 mg / kg, approximately 3.8 mg / kg, approximately 3.9 mg / kg, approximately 4 mg / kg, approximately 4.1 mg / kg, approximately 4.2 mg / kg, approximately 4.3 mg / kg, approximately 4.4 mg / kg, approximately 4.5 mg / kg, approximately 4.6 mg / kg, approximately 4.7 mg / kg, 15 approximately 4.8 mg / kg, approximately 4.9 mg / kg, approximately 5 mg / kg, approximately 5.1 mg / kg, approximately 5.2 mg / kg, approximately 5.3 mg / kg, approximately 5.4 mg / kg, approximately 5.5 mg / kg, approximately 5.6 mg / kg, approximately 5.7 mg / kg, approximately 5.8 mg / kg, approximately 5.9 mg / kg, approximately 6 mg / kg, approximately 6.1 mg / kg, approximately 6.2 mg / kg, 20 approximately 6.3 mg / kg, approximately 6.4 mg / kg, approximately 6.5 mg / kg, approximately 6.6 mg / kg, approximately 6.7 mg / kg, approximately 6.8 mg / kg, approximately 6.9 mg / kg, approximately 7 mg / kg, approximately 7.1 mg / kg, approximately 7.2 mg / kg, approximately 7.3 mg / kg, approximately 7.4 mg / kg, approximately 7.5 mg / kg, approximately 7.6 mg / kg, approximately 7.7 mg / kg, 25 approximately 7.8 mg / kg, approximately 7.9 mg / kg, approximately 8 mg / kg, approximately 8.1 mg / kg, approximately 8.2 mg / kg, approximately 8.3 mg / kg, approximately 8.4 mg / kg, approximately 8.5 mg / kg, approximately 8.6 mg / kg, approximately 8.7 mg / kg, approximately 8.8 mg / kg, approximately 8.9 mg / kg, approximately 9 mg / kg, approximately 9.1 mg / kg, approximately 9.2 mg / kg, approximately 9.3 mg / kg, approximately 9.4 mg / kg, approximately 9.5 mg / kg, approximately 9.6 mg / kg, approximately 9.7 mg / kg, approximately 9.8 mg / kg, approximately 9.9 mg / kg, approximately 10 mg / kg; approximately 10.1 mg / kg, approximately 10.2 mg / kg, approximately 10.3 mg / kg, approximately 10.4 mg / kg, approximately 10.5 mg / kg, approximately 10.6 mg / kg, approximately 10.7 mg / kg, 35 approximately 10.8 mg / kg, approximately 10.9 mg / kg, approximately 11 mg / kg, approximately 11.1 mg / kg, approximately 11.2 mg / kg, approximately 11.3 mg / kg, approximately 11.4 mg / kg, approximately 11.5 mg / kg, approximately 11.6 mg / kg. QQzcnn / Lznz / q / Yi approximately 11.7 mg / kg, approximately 11.8 mg / kg, approximately 11.9 mg / kg, approximately 12 mg / kg, approximately 12.1 mg / kg, approximately 12.2 mg / kg, approximately 12.3 mg / kg, approximately 12.4 mg / kg, approximately 12.5 mg / kg, approximately 12.6 mg / kg, approximately 12.7 mg / kg, approximately 12.8 mg / kg, approximately 12.9 mg / kg, approximately 13 mg / kg, approximately 13.1 mg / kg, approximately 13.2 mg / kg, approximately 13.3 mg / kg, approximately 13.4 mg / kg, approximately 13.5 mg / kg, approximately 13.6 mg / kg, approximately 13.7 mg / kg, approximately 13.8 mg / kg, approximately 13.9 mg / kg, approximately 14 mg / kg, approximately 14.1 mg / kg, approximately 14.2 mg / kg, approximately 14.3 mg / kg, approximately 14.4 mg / kg, approximately 14.5 mg / kg, approximately 14.6 mg / kg, approximately 14.7 mg / kg, approximately 14.8 mg / kg, approximately 14.9 mg / kg, approximately 15 mg / kg, approximately 15.1 mg / kg, approximately 15.2 mg / kg, approximately 15.3 mg / kg, approximately 15.4 mg / kg, approximately 15.5 mg / kg, approximately 15.6 mg / kg, approximately 15.7 mg / kg, approximately 15.8 mg / kg, approximately 15.9 mg / kg, approximately 16 mg / kg, approximately 16.1 mg / kg, approximately 16.2 mg / kg, approximately 16.3 mg / kg, approximately 16.4 mg / kg, approximately 16.5 mg / kg, approximately 16.6 mg / kg, approximately 16.7 mg / kg, approximately 16.8 mg / kg, approximately 16.9 mg / kg, approximately 17 mg / kg, approximately 17.1 mg / kg, approximately 17.2 mg / kg, approximately 17.3 mg / kg, approximately 17.4 mg / kg, approximately 17.5 mg / kg, approximately 17.6 mg / kg, approximately 17.7 mg / kg, approximately 17.8 mg / kg, approximately 17.9 mg / kg, approximately 18 mg / kg, approximately 18.1 mg / kg, approximately 18.2 mg / kg, approximately 18.3 mg / kg, approximately 18.4 mg / kg, approximately 18.5 mg / kg, approximately 18.6 mg / kg, approximately 18.7 mg / kg, approximately 18.8 mg / kg, approximately 18.9 mg / kg, approximately 19 mg / kg, approximately 19.1 mg / kg, approximately 19.2 mg / kg, approximately 19.3 mg / kg, approximately 19.4 mg / kg, approximately 19.5 mg / kg, approximately 19.6 mg / kg, approximately 19.7 mg / kg, approximately 19.8 mg / kg, approximately 19.9 mg / kg, or approximately 20 mg / kg. Therapeutically effective amounts or dosages, in some cases, are considered to include dosages of approximately 0.1 mg / kg to approximately 2.0 mg / kg. The treatment methods described herein comprise one or more administrations of MICA / B antibodies at the doses described herein. In some modalities, the methods comprise one administration of MICA / B antibodies. In some modalities, the methods comprise two administrations of MICA / B antibodies. In some modalities, the methods comprise three administrations of MICA / B antibodies. In some modalities, the methods comprise four administrations of MICA / B antibodies. In some modalities, the methods comprise five administrations of MICA / B antibodies. In some modalities, the methods comprise six administrations of MICA / B antibodies. In some modalities, one or more of the six administrations of MICA / B antibodies are administered daily. In some modalities, one or more of the six administrations of MICA / B antibodies are administered weekly. In some modalities, one or more of the six administrations of MICA / B antibodies are administered every two weeks. In some modalities, one or more of the six administrations of MICA / B antibodies are administered monthly. In some modalities, one or more of the six administrations of MICA / B antibodies are administered every three months. In some modalities, one or more of the six administrations of MICA / B antibodies are administered every six months. In some modalities, one or more of the six administrations of MICA / B antibodies are administered annually. Pharmaceutical Compositions Also described herein are pharmaceutical compositions comprising MICA / B antibodies described herein and a pharmaceutically acceptable carrier or excipient. In some embodiments, the excipients for use with the compositions described herein include maleic acid, tartaric acid, lactic acid, citric acid, acetic acid, sodium bicarbonate, sodium phosphate, histidine, glycine, sodium chloride, potassium chloride, calcium chloride, zinc chloride, water, dextrose, N-methylpyrolidone, dimethyl sulfoxide, N,N-dimethylacetamide, ethanol, propylene glycol, polyethylene glycol, diethylene glycol monoethyl ether, and polyoxyethylene-sorbitan surfactant monooleate. In some formulations, the compositions also include an additional therapeutic agent. In some formulations, the therapeutic agent is a chemotherapeutic agent. Chemotherapeutic agents may include, among others, cytotoxic agents, antimetabolite agents (e.g., folate antagonists, purine analogues, pyrimidine analogues, etc.), topoisomerase inhibitors (e.g., camptothecin derivatives, anthracenedione, anthracyclines, epipodophyllotoxins, quinoline alkaloids, etc.), anti-microtubule agents (e.g., taxanes, vinca alkaloids), protein synthesis inhibitors (e.g., cephalotoxin, camptothecin derivatives, quinoline alkaloids), alkylating agents (e.g., alkyl sulfonates, ethyleneimines, nitrogen mustards, nitrosoureas, platinum derivatives, triazene, etc.), alkaloids, terpenoids, and kinase inhibitors. In some modalities, the antibody and the therapeutic agent are in the same formulation. In some modalities, the antibody and the therapeutic agent are in different formulations. In some modalities, the antibody described herein is used before the administration of the other therapeutic agent. In some modalities, the antibody described herein is used concurrently with the administration of the other therapeutic agent. In some modalities, the antibody described herein is used subsequently to the administration of the other therapeutic agent. Pharmaceutical formulations, in some cases, are designed to be compatible with a particular local, regional, or systemic administration route. Thus, pharmaceutical formulations include carriers, diluents, or excipients suitable for administration via specific routes. Non-limiting examples of specific routes of administration for the compositions herein include parenteral administration, e.g., intravenous, intra-arterial, intradermal, intramuscular, subcutaneous, intrapleural, transdermal (topical), transmucosal, intracranial, intraspinal, intraocular, rectal, oral (alimentary), mucosal, and any other formulation suitable for the treatment method or administration protocol. In some formulations, the solutions or suspensions used for parenteral administration include: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol, or other synthetic solvents; antibacterial agents such as benzyl alcohol or methylparabens; antioxidants such as ascorbic acid or sodium bisulfate; chelating agents such as ethylenediaminetetraacetic acid; buffer solutions such as acetates, citrates, or phosphates; and tonicity-adjusting agents such as sodium chloride or dextrose. In some formulations, the pH is adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. Pharmaceutical formulations for injection include sterile aqueous solutions (either water-soluble) or sterile dispersions and powders for the extemporaneous preparation of sterile injectable solutions or dispersions. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor ELMR (BASF, Parsippany, NJ), or phosphate-buffered saline (PBS). In some embodiments, the carrier is a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol and the like), or suitable mixtures thereof. Flowability is maintained, in some embodiments, for example, by the use of a coating such as lecithin, by maintaining the required particle size in the case of dispersions, and by the use of surfactants.Antibacterial and antifungal agents include, for example, parabens, chlorobutanol, phenol, ascorbic acid, and thimerosal. Isotonic agents, such as sugars; polyalcohols like mannitol or sorbitol; or sodium chloride, are included in some formulations. In some cases, an absorption-delaying agent is also included; for example, aluminum monostearate or gelatin prolongs the absorption of injectable compositions. In some formulations, sterile injectable formulations are prepared by incorporating the active ingredient in the required amount into an appropriate solvent with one or a combination of the aforementioned ingredients. Generally, dispersions are prepared by incorporating the active ingredient into a sterile vehicle containing a basic dispersion medium and any other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, preparation methods include, for example, vacuum drying and freeze-drying, which produce a powder of the active ingredient plus any additional desired ingredients from a previously prepared solution of the same. For transmucosal or transdermal administration, appropriate penetrants for the barrier being penetrated are used in the formulation. These penetrants are known in the art and include, for example, transmucosal detergents, bile salts, and fusidic acid derivatives. In some modalities, transmucosal administration is achieved through the use of nasal sprays, inhalation devices (e.g., aspirators), or suppositories. For transdermal administration, the active compounds are formulated as ointments, balms, gels, creams, or patches. In some formulations, pharmaceutical formulations are prepared with carriers that protect against rapid elimination from the body, such as controlled-release formulations or time-delay materials such as glycerol stearate. In some formulations, the formulations are also delivered using manufactured devices such as implants and microencapsulated delivery systems to achieve local, regional, or systemic administration, or controlled or sustained release. EXAMPLES The following examples are given for the purpose of illustrating various embodiments of the invention and are not intended to limit the present invention in any way. These examples, together with the methods described herein, are representative of preferred embodiments, are exemplary, and are not intended to limit the scope of the invention. Those skilled in the art will think of variations on these and other uses that fall within the spirit of the invention as defined by the scope of the claims. Example 1: Generation and Classification of MICA / B Monoclonal Antibodies Antibodies were prepared using conventional techniques known in the field, e.g., Kohler and Milstein, 1975, Nature 256(5517):495-7; Coligan et al., supra, sections 2.5.1-2.6.7; Current Protocols in Immunology, John Wiley and Sons, Inc. (1992); and Antibodies: A Laboratory Manual, Harlow and Lañe, eds., Cold Spring Harbor Press, New York (1988); Monoclonal Antibodies: Methods and Protocols in Methods Mol Biol., Vol. 378, Albitar M., ed., Humana Press (2007), which are incorporated herein by way of reference. Monoclonal antibodies were generated in mice by administration of immunogen and subsequent isolation of antibody-producing B cells. The B cells were then immortalized by fusion with another stable cell type of the same species as the B cell to create a hybridoma. The hybridoma clones were classified using ELISA for their ability to bind to the antigen (MICA / B).An individual B cell produces a specific antibody (i.e., it is clonally monospecific) that is defined by its primary amino acid sequence and its underlying gene sequence. Monoclonal antibodies that show specific binding to MICA / B are isolated and purified from hybridoma cultures using conventional methodologies such as Sepharose Protein A affinity chromatography, size exclusion chromatography, and ion-exchange chromatography (see, for example, Coligan et al., supra, sections 2.7.1-2.7.12 and sections 2.9.12.9.3; Barnes et al., Purification of Immunoglobulin G (IgG), in Methods Mol. Biol., Vol. 10, pages 79-104, Humana Press (1992)). Example 2: Measurement of PDI-1 Antibody Binding Kinetics Affinity kinetics were determined using a ForteBio Octet Red96 analyzer. Briefly, PDI-1 (30 pg / ml) was captured on Dip and ReadMñ Anti-mouse IgG Fe Capture Biosensors (AMC) (ForteBio) at room temperature in an assay buffer of PBS + 0.1% BSA + 0.02% Tween-20 (pH 7.2). The sensors were washed in assay buffer and then incubated with purified 6xHis-MICA*08 and 6xHis-MICA*01 proteins (100 nM), respectively, in a 2-fold dilution series for 5 minutes in assay buffer to determine antibody-protein antigen association kinetics. The sensors were then incubated in assay buffer for 10 minutes to determine dissociation kinetics. The resulting kinetic parameters were calculated using the ForteBio package 8.0 analysis with a 1:1 model. The results for these trials are shown in FIGURE 1. Example 3: Binding of antibody PDI-1 to MICA / B alleles Recombinant MICA*01, MICA*02, MICA*04, MICA*08, MICA*09, and MICB proteins were diluted to 1 pg / ml in 50 mM sodium carbonate buffer, pH 9.6, and coated onto 96-well high-binding microplates (Corning #9018), 100 ng in 10 µL per well. The following morning, the coated ELISA plates were washed three times with TBS-Tween-20, pH 7.4, and then blocked in SuperBiock T20 blocking buffer (Pierce #37536). After blocking, the ELISA plates were washed once with TBS-T and incubated with serially diluted PDI-1 antibody (0–1 pg / ml) for approximately two hours at room temperature. After incubation, the ELISA plates were washed three times with TBS-T and then incubated with anti-goat mouse IgG (H+L)HRP conjugate (ThermoFisher Scientific #626520) for 45 minutes at room temperature with shaking (~400rpm).After incubation, the ELISA plates were washed three times with TBS-T and incubated with TMB Supersensitive Liquid Substrate (Sigma #T4444), 10 µL per well, until sufficient color development was achieved. The reaction was stopped with 1N sulfuric acid, 100 µL per well. Optical density (OD) values ​​were recorded. QQzcnn / Lznz / q / Yi were measured at 450nm using a microplate reader. The result of this assay is shown in FIGURE 2. Example 4: Binding of PDI-1 antibody to cell surface MICA Mouse prostate adenocarcinoma TRAMP-C2 cells (TC2) (ATCC, Manassas, VA) were used to generate a stable cell line expressing the MICA*04 allele (TC2-MICA04). PDI-1 binding to TC2-IVIICA-04 was analyzed by flow cytometry. Briefly, the cells were first stained with LIVE / DEAD near-IR stain (Thermo) for 30 min at 4°C, and then washed once by centrifugation with FACS buffer (1 mM EDTA, 25 mM HEPES, 2% FBS in 1X PBS). Approximately 2-3 x 10⁵ TC2-MICA04 cells were incubated with 100 µL of FACS buffer containing 500 ng of PDI-1 antibody at 4°C for 30 minutes, followed by incubation with 100 µL of 2 µg / ml PE-conjugated goat-mouse IgG secondary antibody (Biolegend, San Diego, CA) at 4°C for 30 minutes. The cells were then washed once, and the cell pellets were resuspended in FACS buffer for FACS analysis in live cells.A significantly higher PE fluorescence signal was observed with TC2-MICA-04 cells compared to parenteral TC2 cells, indicating the binding of PDI-1 to surface-expressed MICA. The result for this assay is shown in Figure 3. Example 5: The PDI-1 Antibody Inhibits MICA Shedding from PLC / PRF / 5 Cells Four 10⁴ PLC / PRF / 5 cells (Hepatocellular Carcinoma) (ATCC, Manassas, VA) were plated into a 96-well plate and incubated overnight at 37°C. The cells were then treated with 100 µL of Complete Medium (MEM + 10% FBS, Thermo, Grand Island, NY) containing PDI-1 control and negative antibodies, respectively, and incubated at 37°C for another day. The cell supernatants, containing shed MICA, were used to determine the level of soluble MICA by ELISA. Briefly, the 96-well plate was coated with 100 µL of 2 pg / ml MICA / MICB anti-human capture antibody, clone 6D4 (Biolegend, San Diego, CA) overnight at 4°C. The plate was blocked and then incubated with cell supernatant and MICA standards for 2 hours. After incubation, the plates were washed and followed by 1 hour of incubation with 100 µL of 500 ng / ml detection Ab (MICA mAb anti-human, clone 159227, R&D Systems, Minneapolis, MN) with biotin.Next, 100 μL of HRP-conjugated streptavidin (HRP-SA) (R&D Systems, Minneapolis, MN) was added to the wells and incubated for 30 minutes. The samples were developed with TMB for 4 minutes, stopped with 1N sulfuric acid, and detected by absorbance at 450 nm. The soluble mica level was interpolated from the standard curve. The result for this assay is shown in Figure 4. QQzcnn / Lznz / q / Yi Example 6: The PDI-1 Antibody Enhances NK-92 Cell-Mediated Cytotoxicity to PLC / PRF / 5 Cells PLC / PRF / 5 cells (Target) were suspended in RPMI-1640 with 10% FBS and plateped in 96-well flat-bottom plates (Costar) at 6000 cells / well. The cells were then incubated with PDI-1 antibody (10 pg / ml) for 24 hours before being labeled with AM calcein (1 μM) for 3 hours at 37°C, 5% CO2. The cells were washed, and NK-92 cells (Effector) suspended in RPMI-1640 with 10% FBS were then added to the wells in various Effect-Target (E:T) ratios as indicated and co-cultured with target cells for 4 hours. At the end of the cultures, the supernatant was removed, replaced with PBS, and the calcein AM signal was measured using a VICTOR Multilabel plate reader (Perkin Elmer). A matched isotype non-reactive immunoglobulin (R&D) antibody was used as a control. The result for this assay is shown in FIGURE 5. Example 7: ELISA of Intercalation of Soluble Mica High-binding 96-well plates (Costar #9018) were coated overnight at 42°C with 200 ng / well of anti-MICA capture antibody in sodium buffer (50 mM pH 9.6) in a volume of 100 µL, then blocked with SuperBiock T20 (Pierce #37536) and washed with TBS-T. Serum samples from the human liver cancer xenograft model, diluted 1:3 in SuperBiock T20 or recombinant MICA*08 standard, were then added to the plate and incubated for 2 hours at room temperature. After 2 hours of incubation, the plate was washed three times with TBS-T and then incubated with biotinylated PDI-1 detection antibody diluted to 1 pg / ml in SuperBiock T20. After 1 hour of incubation, the plate was washed three times with TBS-T, and then incubated for 45 minutes with a 1 / 5000 dilution of Streptavidin-HRP conjugate (Invitrogen #SNN2004) in SuperBiock T20, 100 µL per well. After 45 minutes of incubation, the plate was washed three times with TBS-T.Next, the TMB Supersensitive Liquid Substrate for ELISA (Sigma T4444), 100 µL per well, was added and the color was allowed to develop. The reaction was stopped by adding 100 µL per well of 1N H₂SO₄. The yield was measured by OD determined at 450 nm. The result of this assay is shown in Figure 6. Although shown and described in the present preferred embodiments of the invention, it will be obvious to those skilled in the art that these embodiments are provided by way of example only. Those skilled in the art will now be able to think of numerous variations, changes, and substitutions without departing from the invention. It should be understood that various alternatives to the embodiments described herein may be employed. The following claims are intended to define the scope of the invention, and the methods and structures within the scope of these claims and their equivalents are covered by them.

Claims

Having described the present invention, the following are considered novel and are therefore claimed as property: CLAIMS 1. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO:

10.

2. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable light chain (VL) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO:

10.

3. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable light chain (VL) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO:

10.

4. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable light chain (VL) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO:

10. QQzcnn / Lznz / q / Yi; 5. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable light chain (VL) domain comprising an amino acid sequence 100% identical to an amino acid sequence disclosed as SEQ ID NO: 7, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO:

10.

6. The monoclonal antibody according to any of claims 1-5, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

7. The monoclonal antibody according to any of claims 1-5, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

8. The monoclonal antibody according to any of claims 1-5, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

9. The monoclonal antibody according to any of claims 1-5, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

10. The monoclonal antibody according to any of claims 1-5, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence 100% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

11. The monoclonal antibody according to any of claims 1-10, characterized in that the light chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence set out as SEQ ID NO: 9 are modified.

12. The monoclonal antibody according to any of claims 1-11, characterized in that the heavy chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence set out as SEQ ID NO: 10 are modified.

13. The monoclonal antibody according to any of claims 1-12, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

14. The monoclonal antibody according to any of claims 1-13, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

15. The monoclonal antibody according to claim 13 or claim 14, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

16. The monoclonal antibody according to claim 13 or claim 14, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

17. The monoclonal antibody according to any of claims 1-16, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

18. The monoclonal antibody according to any of claims 1-17, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

19. The monoclonal antibody according to any of claims 1-18, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

20. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO:

9.

21. A monoclonal antibody or an antigen-binding fragment thereof, QQzcnn / Lznz / á / Yi 49, characterized in that it comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO:

9.

22. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO:

9.

23. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO:

9.

24. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises a variable heavy chain (VH) domain comprising an amino acid sequence 100% identical to an amino acid sequence disclosed as SEQ ID NO: 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence disclosed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence disclosed as SEQ ID NO:

9.

25. The monoclonal antibody according to any of claims 20-24, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

26. The monoclonal antibody according to any of claims 20-24, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 90% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

27. The monoclonal antibody according to any of claims 20-24, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 95% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

28. The monoclonal antibody according to any of claims 20-24, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 99% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

29. The monoclonal antibody according to any of claims 20-24, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence 100% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

30. The monoclonal antibody according to any of claims 20-29, characterized in that the heavy chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence set out as SEQ ID NO: 10 are modified.

31. The monoclonal antibody according to any of claims 20-30, characterized in that the light chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence set out as SEQ ID NO: 9 are modified.

32. The monoclonal antibody according to any of claims 20-31, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

33. The monoclonal antibody according to any of claims 20-32, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

34. The monoclonal antibody according to claim 36 or claim 33, characterized in that the MICA protein is the membrane-bound MICA protein, soluble MICA protein, or both.

35. The monoclonal antibody according to claim 36 or claim 33, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

36. The monoclonal antibody according to any of claims 20-35, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

37. The monoclonal antibody according to any of claims 20-36, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

38. The monoclonal antibody according to any of claims 20-37, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

39. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO:

10.

40. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO:

10.

41. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO:

10.

42. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO:

10.

43. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 100% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 100% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 100% identical to SEQ ID NO: 3, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO: 9, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO:

10.

44. The monoclonal antibody according to any of claims 39-43, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

45. The monoclonal antibody according to any of claims 39-43, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO:

6.

46. ​​The monoclonal antibody according to any of claims 39-43, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO:

6.

47. The monoclonal antibody according to any of claims 39-43, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO:

6.

48. The monoclonal antibody according to any of claims 39-43, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence 100% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence 100% identical to SEQ ID NO:

6.

49. The monoclonal antibody according to any of claims 39-48, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

50. The monoclonal antibody according to claim 49, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

51. The monoclonal antibody according to any of claims 39-48, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

52. The monoclonal antibody according to claim 51, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

53. The monoclonal antibody according to any of claims 39-52, characterized in that the light chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence described as SEQ ID NO: 9 are modified.

54. The monoclonal antibody according to any of claims 39-53, characterized in that the heavy chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence described as SEQ ID NO: 10 are modified.

55. The monoclonal antibody according to any of claims 39-54, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

56. The monoclonal antibody according to any of claims 39-55, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

57. The monoclonal antibody according to claim 55 or claim 56, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

58. The monoclonal antibody according to claim 55 or claim 56, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

59. The monoclonal antibody according to any of claims 39-58, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')s, or a disulfide-linked Fv.

60. The monoclonal antibody according to any of claims 39-59, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM. QQzcnn / Lznz / q / Yii 61. The monoclonal antibody according to any of claims 39-60, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

62. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO:

9.

63. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO:

9.

64. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO:

9.

65. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence QQzcnn / Lznz / q / Yi at least 99% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO:

9.

66. A monoclonal antibody or an antigen-binding fragment thereof, characterized in that it comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence 100% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence 100% identical to SEQ ID NO: 6, wherein the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain not having an amino acid sequence exposed as SEQ ID NO: 10, or wherein the monoclonal antibody or antigen-binding fragment thereof comprises a light chain not having an amino acid sequence exposed as SEQ ID NO:

9.

67. The monoclonal antibody according to any of claims 62-66, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

3.

68. The monoclonal antibody according to any of claims 62-66, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 90% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 90% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 90% identical to SEQ ID NO:

3.

69. The monoclonal antibody according to any of claims 62-66, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 95% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 95% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 95% identical to SEQ ID NO:

3. QQzcnn / Lznz / á / Yi 70. The monoclonal antibody according to any of claims 62-66, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 99% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 99% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 99% identical to SEQ ID NO:

3.

71. The monoclonal antibody according to any of claims 62-66, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a light chain complementarity-determining region 1 (CDR1) sequence 100% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence 100% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence 100% identical to SEQ ID NO:

3.

72. The monoclonal antibody according to any of claims 62-71, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

73. The monoclonal antibody according to claim 72, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

74. The monoclonal antibody according to any of claims 62-71, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

75. The monoclonal antibody according to claim 74, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

76. The monoclonal antibody according to any of claims 62-75, characterized in that the heavy chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the 58 amino acid sequence set out as SEQ ID NO: 10 are modified.

77. The monoclonal antibody according to any of claims 62-76, characterized in that the light chain comprises an amino acid sequence wherein at least 1 to 10 amino acids of the amino acid sequence set out as SEQ ID NO: 9 are modified.

78. The monoclonal antibody according to any of claims 62-77, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

79. The monoclonal antibody according to any of claims 62-78, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

80. The monoclonal antibody according to claim 78 or claim 79, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

81. The monoclonal antibody according to claim 78 or claim 79, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

82. The monoclonal antibody according to any of claims 62-81, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

83. The monoclonal antibody according to any of claims 62-82, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

84. The monoclonal antibody according to any of claims 62-83, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

85. A pharmaceutical composition, characterized in that it comprises: a monoclonal antibody or an antigen-binding fragment thereof according to any one of claims 1 to 84; and a pharmaceutically acceptable carrier or excipient.

86. A method for treating cancer in an individual in need thereof, characterized in that it comprises administering to the individual an effective quantity of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a complementarity-determining region 1 (CDR1) sequence of QQzcnn / Lznz / q / Yi light chain at least 80% identical to SEQ ID NO: 1, a complementarity-determining region 2 (CDR2) sequence of light chain at least 80% identical to SEQ ID NO: 2, and a complementarity-determining region 3 (CDR3) sequence of light chain at least 80% identical to SEQ ID NO:

3.

87. The method according to claim 86, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

88. The method according to any of claims 86 or 87, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

89. The method according to claim 88, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

90. The method according to any of claims 86 or 87, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

91. The method according to claim 90, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

92. The method according to any of claims 86-91, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both a MICA and a MICB protein.

93. The method according to any of claims 86-92, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins. QQzcnn / Lznz / q / Yii 94. The method according to claim 92 or claim 93, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

95. The method according to claim 92 or claim 93, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

96. The method according to any of claims 86-95, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

97. The method according to any of claims 86-96, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

98. The method according to any of claims 86-97, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

99. The method according to any of claims 86-98, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both.

100. The method according to any of claims 86-98, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both.

101. The method according to any of claims 86-98, characterized in that the monoclonal antibody or antigen-binding fragment thereof inhibits the release of soluble MICA protein, soluble MICB protein, or both.

102. The method according to any of claims 86-101, characterized in that the cancer is hepatocellular carcinoma.

103. A method for treating cancer in an individual in need thereof, characterized in that it comprises the individual an effective quantity of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

104. The method according to claim 103, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

3.

105. The method according to any of claims 103 or 104, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

106. The method according to claim 105, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

107. The method according to any of claims 103 or 104, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

108. The method according to claim 107, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

109. The method according to any of claims 103-108, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

110. The method according to any of claims 103-109, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

111. The method according to claim 109 or claim 110, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

112. The method according to claim 109 or claim 110, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both. QQzcnn / Lznz / q / Yii 113. The method according to any of claims 103-112, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

114. The method according to any of claims 103-113, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

115. The method according to any of claims 103-114, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

116. The method according to any of claims 103-115, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both.

117. The method according to any of claims 103-115, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both.

118. The method according to any of claims 103-115, characterized in that the monoclonal antibody or antigen-binding fragment thereof inhibits the release of soluble MICA protein, soluble MICB protein, or both.

119. The method according to any of claims 103-118, characterized in that the cancer is hepatocellular carcinoma.

120. A method for treating hepatocellular carcinoma in an individual in need thereof, characterized in that it comprises administering to the individual an effective amount of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

3.

121. The method according to claim 120, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

122. The method according to any of claims 120 or 121, 63 characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

123. The method according to claim 122, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

124. The method according to any of claims 120 or 121, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

125. The method according to claim 124, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

126. The method according to any of claims 120-125, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

127. The method according to any of claims 120-126, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

128. The method according to claim 126 or claim 127, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

129. The method according to claim 126 or claim 127, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

130. The method according to any of claims 120-129, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

131. The method according to any of claims 120-130, characterized in that the monoclonal antibody or antigen-binding fragment of the QQzcnn / Lznz / q / Yi 64 itself is an IgG or IgM.

132. The method according to any of claims 120-131, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

133. The method according to any of claims 120-132, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both.

134. The method according to any of claims 120-132, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both.

135. The method according to any of claims 120-132, characterized in that the monoclonal antibody or antigen-binding fragment thereof inhibits the release of soluble MICA protein, soluble MICB protein, or both.

136. A method for treating hepatocellular carcinoma in an individual in need thereof, characterized in that it comprises administering to an individual an effective quantity of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

137. The method according to claim 136, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

3.

138. The method according to any of claims 136 or 137, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

139. The method according to claim 138, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

140. The method according to any of claims 136 or 137, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

141. The method according to claim 140, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

142. The method according to any of claims 136-141, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

143. The method according to any of claims 136-142, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

144. The method according to claim 142 or claim 143, characterized in that the MICA protein is membrane-bound MICA protein, soluble MICA protein, or both.

145. The method according to claim 142 or claim 143, characterized in that the MICB protein is membrane-bound MICB protein, soluble MICB protein, or both.

146. The method according to any of claims 136-145, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

147. The method according to any of claims 136-146, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

148. The method according to any of claims 136-147, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

149. The method according to any of claims 136-148, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the level of soluble MICA protein, soluble MICB protein, or both.

150. The method according to any of claims 136-148, QQzcnn / Lznz / q / Yi 66 characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces the shedding of soluble MICA protein, soluble MICB protein, or both.

151. The method according to any of claims 136-148, characterized in that the monoclonal antibody or antigen-binding fragment thereof inhibits the release of soluble MICA protein, soluble MICB protein, or both.

152. A method for reducing the level of soluble MICA protein, soluble MICB protein, or both in an individual in need thereof, characterized in that it comprises administering to the individual an effective amount of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, a light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and a light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

3.

153. The method according to claim 152, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

154. The method according to any of claims 152 or 153, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

155. The method according to claim 154, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

156. The method according to any of claims 152 or 153, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

157. The method according to claim 156, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain QQzcnn / Lznz / q / Yi 67 comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

158. The method according to any of claims 152-157, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

159. The method according to any of claims 152-158, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

160. The method according to claim 158 or claim 159, characterized in that the MICA protein is soluble MICA protein.

161. The method according to claim 158 or claim 159, characterized in that the MICB protein is soluble MICB protein.

162. The method according to any of claims 152-161, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

163. The method according to any of claims 152-162, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

164. The method according to any of claims 152-163, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

165. The method according to any of claims 152-164, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces or inhibits the release of soluble MICA protein, soluble MICB protein, or both, thereby reducing the level of soluble MICA protein, soluble MICB protein, or both in the individual.

166. The method according to any of claims 152-165, characterized in that the individual has a cancer characterized by elevated levels of soluble MICA protein, soluble MICB protein, or both.

167. The method according to claim 166, characterized in that the cancer is hepatocellular carcinoma.

168. A method for reducing the level of soluble MICA protein, soluble MICB protein, or both in an individual in need thereof, characterized in that it comprises administering to the individual an effective amount of a monoclonal antibody or an antigen-binding fragment thereof comprising at least one of a heavy chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 4, a heavy chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 5, and a heavy chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

6.

169. The method according to claim 168, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises at least one light chain complementarity-determining region 1 (CDR1) sequence at least 80% identical to SEQ ID NO: 1, one light chain complementarity-determining region 2 (CDR2) sequence at least 80% identical to SEQ ID NO: 2, and one light chain complementarity-determining region 3 (CDR3) sequence at least 80% identical to SEQ ID NO:

3.

170. The method according to any of claims 168 or 169, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

171. The method according to claim 170, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

172. The method according to any of claims 168 or 169, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable light chain (VL) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

7.

173. The method according to claim 172, characterized in that the monoclonal antibody or antigen-binding fragment thereof comprises a variable heavy chain (VH) domain comprising an amino acid sequence at least 80% identical to an amino acid sequence disclosed as SEQ ID NO:

8.

174. The method according to any of claims 168-173, characterized in that the monoclonal antibody or antigen-binding fragment thereof binds specifically to a MICA protein, a MICB protein, or both MICA and MICB proteins.

175. The method according to any of claims 168-174, characterized in that the monoclonal antibody or antigen-binding fragment thereof is bound to an alpha-3 domain of a MICA protein, a MICB protein, or both MICA and MICB proteins.

176. The method according to claim 174 or claim 175, characterized in that the MICA protein is soluble MICA protein.

177. The method according to claim 174 or claim 175, characterized in that the MICB protein is soluble MICB protein.

178. The method according to any of claims 168-177, characterized in that the monoclonal antibody or antigen-binding fragment thereof is selected from an entire immunoglobulin, an scFv, a Fab, an F(ab')2, or a disulfide-linked Fv.

179. The method according to any of claims 168-178, characterized in that the monoclonal antibody or antigen-binding fragment thereof is an IgG or IgM.

180. The method according to any of claims 168-179, characterized in that the monoclonal antibody or fragment thereof is humanized or chimeric.

181. The method according to any of claims 168-180, characterized in that the monoclonal antibody or antigen-binding fragment thereof reduces or inhibits the release of soluble MICA protein, soluble MICB protein, or both, thereby reducing the level of soluble MICA protein, soluble MICB protein, or both in the individual.

182. The method according to any of claims 168-181, characterized in that the individual has a cancer characterized by elevated levels of soluble MICA protein, soluble MICB protein, or both.

183. The method according to claim 182, characterized in that the cancer is hepatocellular carcinoma.

184. A monoclonal antibody or an antigen-binding fragment thereof according to any one of claims 1 to 84, characterized in that it is for use in treating cancer in an individual in need thereof.

185. A monoclonal antibody according to any of claims 1 to 84, characterized in that it is for use in the preparation of a medicament for treating cancer in an individual in need thereof.

186. The monoclonal antibody for use according to claim 184 or claim 185, characterized in that the cancer is hepatocellular carcinoma.