Compositions and methods for interneuron mediated delivery of cytotoxic agents to the brain

WO2024196794A3PCT designated stage expired Publication Date: 2025-06-05THE CHILDRENS HOSPITAL OF PHILADELPHIA
View PDF 3 Cites 0 Cited by

Patent Information

Application Number
PCT/US2024/020245
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-03-17
Filing Date
2024-03-15
Publication Date
2025-06-05

AI Technical Summary

Technical Problem

Current treatments for brain tumors, particularly glioblastoma, are limited due to the immune-suppressive tumor microenvironment and lack of effective delivery methods for cytotoxic agents, leading to poor prognosis and limited survival rates.

Method used

Genetically modified migratory interneuron precursor cells (MIPs) are engineered to express bispecific antibodies that attract them to brain cancer cells, linking with immune effector cells like CD8+ T cells to activate them and kill cancer cells, thereby providing a targeted and effective delivery mechanism for cytotoxic agents.

Benefits of technology

This approach enables targeted killing of brain cancer cells with minimal systemic toxicity, potentially improving survival rates and treatment efficacy for glioblastoma and other brain malignancies by overcoming the immune-suppressive microenvironment.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2024020245_05062025_PF_FP_ABST
    Figure US2024020245_05062025_PF_FP_ABST
Patent Text Reader

Abstract

Compositions and methods for the treatment of brain cancer are disclosed.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] Compositions and Methods for Interneuron Mediated Delivery of Cytotoxic Agents to the Brain By Thomas De Raedt Stewart Anderson Stephanie Brosius William Manley Cross-Reference to Related Application This application claims priority of US Provisional application number 63 / 490,856 filed March 17, 2023, the entire contents being incorporated herein by reference as though set forth in full. Government Support Statement This invention was made with government support under grant number W81XWH2110381 awarded by the U.S. Department of Defense. The government has certain rights in the invention. Incorporation-by-Reference of Material Submitted in Electronic Form The contents of the electronic sequence listing (CHOP-146-PCT.xml; Size: 99,658 bytes; and Date of Creation: March 15, 2024) is herein incorporated by reference in its entirety. Field of the Invention The present invention relates to the fields of brain cancer and cell-mediated delivery of cytotoxic agents. More specifically, the invention provides genetically modified migratory interneuronal precursor cells as a delivery vector for the efficacious treatment of different brain malignancies, particularly glioblastoma. Background of the invention Several publications and patent documents are cited throughout the specification in order to describe the state-of-the-art to which this invention pertains. Each of these citations is incorporated by reference herein as though set forth in full. Brain tumors are formed from an abnormal mass of tissue in which malignant cells grow and multiply rapidly and uncontrollably. The two major types of brain tumors are either primary or metastatic. Primary brain tumors include low or high-grade tumors that originate from the tissues of the brain or those surrounding of the brain. According to the study published by a “Cancer Journal of Clinicians”, in 2021, an estimated 83,570 people were diagnosed with primary brain tumors in the U.S. Approximately 29.7% of all primary brain and other CNS tumors are high grade and 70.3% are low grade, such that non-malignant tumors more than twice as common as malignant tumors. However, the high-grade tumors account for most brain tumor related deaths. The average annual age-adjusted incidence rate of primary high grade brain and other CNS tumors was 7.08 per 100,000 the one of primary low grade brain and other CNS tumors was 16.71 per 100,000. The average annual mortality rate of primary high grade brain tumors for the five-year period between 2013 and 2017 was 4.42 per 100,000 with an average of 16,249 deaths per year. The five-year survival rate following diagnosis of a primary high grade brain tumors was 23.5%, while the five-year survival rate following diagnosis of a primary low grade brain tumors was 82.4%. Notably, the median observed survival in for primary high-grade glioblastoma was the lowest observed at 8 months. Glioblastoma is a devastating, high grade neoplasm of the brain with a 5% five-year overall survival1. High grade gliomas (HGG) like glioblastoma represent the leading cause of cancer-related mortality in the pediatric population2and are one of the most recalcitrant tumors to treat in adults as well3. Glioblastomas have a notoriously immune suppressed tumor microenvironment (TME), where microglia inhibit CD8 T-cell recruitment and activity, thereby evading clearance4,5. Despite significant advances in our understanding of the molecular drivers of glioblastoma, treatment options remain limited3. Novel therapies disrupting or coopting the TME have rapidly advanced with clinical trials ongoing that for example block CD47 (NCT05169944), an immune checkpoint receptor blocking phagocytosis by macrophages6,7. Cellular therapies are being explored, but so far have not yielded the anticipated results8, including Chimeric Antigen Receptor T-cell therapy (CAR-T) which is inherently subject to the immune suppressive TME. Secondary brain tumors, or brain metastases, are cancers that originate in other parts of the body and spread to the brain. Most common primary tissues of origin are lung, breast, colon, kidney and skin. Brain metastases are always malignant and have very poor prognosis. Although frequent in an adult population, brain metastases are rare in a pediatric population. The majority of diagnosed patients are older than 50 (91.9%). Common primary sites included lung (80%), melanoma (3.8%), breast (3.7%), and kidney / renal pelvis (3.0%), although the numbers for breast are likely an underestimate. Among pediatric patients, common primary sites of origin included kidney / renal pelvis and melanomas. The incidence was roughly 7.3 persons / 100,000 (Singh et al. Neurooncol Adv. 2020). Standard of care therapies for brain tumors include surgical removal, radiation therapy, chemotherapy and targeted therapies. Some high-grade primary brain tumors, like medulloblastoma, can be successfully treated with these standard of care therapies. Surgery is a common treatment for brain tumors, and, especially for low-grade tumors might be the only treatment needed. There are numerous surgical approaches to remove brain tumors depending on their size and location and some are curative in combination with chemotherapy or radiation. However, full resection of a brain tumor is often not possible, which contributes to the very low 5-year survival of many higher-grade tumors. Radiation therapy (also called “radiotherapy,” “irradiation,” or simply “radiation”) is another standard treatment that many patients with a brain tumor will receive. Radiation therapy involves the use of x-rays, gamma rays, neutrons, protons, and other sources to kill cancer cells and shrink tumors by damaging their DNA. In children, radiation therapy of the brain can lead to negative outcomes later in life. Effective alternatives to radiation could lead to fewer of these side effects. Chemotherapy is often part of the standard of care of patients with brain tumors. In some cases, the disease is well-controlled with the use of these agents; however, many high- grade tumors do not respond to chemotherapy. Cellular therapies, like CAR-T therapy, have revolutionized treatment for a number of cancers. Unfortunately, these therapies have so far shown limited efficacy for brain tumors, in part due to the lack of unique tumor antigens and an immune suppressive microenvironment8,35. Clearly, there is urgent need for new, effective treatment modalities for glioblastoma, and other malignancies of the brain. Summary of the Invention In accordance with the present invention, a composition for the treatment of brain cancer is disclosed. As exemplary composition comprises a purified population of genetically engineered post-mitotic migratory interneuron precursor cells (MIPs) chemoattracted to brain cancer cells, wherein said MIPs comprise at least one recombinant nucleic acid expressing a secretable, inhibitory bi-specific antibody having i) a first binding domain which forms a first specific binding pair with a surface ligand on an immune effector cell and ii) a second binding domain which forms a second specific binding pair with a surface ligand on a brain cancer cell. The composition also comprises a purified population of immune effector cells comprising the ligand bound by said second binding domain, secretion of said bispecific antibody in proximity of brain cancer cells and immune effector cells linking both types of cells, and causing activation of the immune effector cell, thereby killing any brain cancer cell in proximity thereof. In preferred embodiments the MIP cells are LHX6+. In another embodiment, the recombinant nucleic acid present in the genetically engineered cells encodes a bispecific antibody having said first and second binding domains in first and second scFv sequences said scFv sequence being operably linked at coupling sites to a linker peptide. Antigens bound by the scFv including for example CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, MUC17, HER2, EpCAM, B7H3, EGFR, GD2, CD16 or CD3. In particular embodiments, the brain cancer is a glioblastoma. In other embodiments, the brain cancer is a metastatic cancer originating from any tissue other than brain. For example, metastatic brain cancers can metastasize from lung, breast, kidney, prostate, bone, skin, colon, thyroid gland, liver, genitourinary tract, pancreas, lymph / blood, neuroblastoma, head and neck. In a particularly preferred embodiment, the immune effector cell is a CD8+ T cell, said first ligand binds CD3 on said T cell and said second ligand binds EGFR on said brain cancer cell when said T cell and said brain cell are in proximity to one another. The polynucleotide present in the MIP cells can be delivered in an expression vector, selected from lentivirus vectors, gamma retrovirus vectors, foamy virus vectors, adeno associated virus vectors, adenovirus vectors, pox virus vectors, herpes virus vectors, engineered hybrid viruses, and transposon mediated vectors. In another aspect of the invention, a purified post-mitotic migratory interneuron precursor cell (MIP) population genetically engineered to express a therapeutic agent is disclosed. In certain embodiments, the genetically engineered MIP the therapeutic agent is cytotoxic. In other embodiments, the cytotoxic agent is a bispecific antibody which binds brain cancer cells and activates CD8+ T cells. Also disclosed is a method for the treatment of brain cancer, in a patient in need thereof. An exemplary method entails administration of an effective amount of any one of the compositions described above into the cranial cavity wherein said T cells and MIPs are administered, said MIPs being chemoattracted to said brain cancer cells and secreting said bispecific antibody in proximity of said brain cancer cells and said T cells, thereby linking both types of cells, said linking causing activation of said T cell, thereby killing any brain cancer cell in proximity thereof. Preferably, the brain cancer is a glioblastoma. In other embodiments, the brain cancer is a metastatic cancer originating from any tissue other than brain. Antigen to be targeted in the method, include without limitation, CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, MUC17, HER2, EpCAM, B7H3, EGFR, GD2, CD1640, TRAIL, trimer TRAIL and CD3. In certain approaches, the composition is administered via a cannula placed anywhere in the brain. In other approaches, the composition is administered via repeated dosing though an Ommaya Reservoir directly into the ventricles of the brain. In another aspect of the method, the level of at least one of the prognostic biomarkers listed in Table 1 in the patient is assessed prior to treatment, to determine whether the patient is a candidate for the therapy described herein. Also disclosed is a method for the treatment of brain cancer, comprising administration of an effective amount of genetically engineered MIPs directly into the cranial cavity, said MIPs being chemoattracted to said brain cancer cells and secreting a bispecific antibody in proximity of said brain cancer cells and endogenous CD8+ T cells present in the brain, thereby linking both types of cells, said linking causing activation of said endogenous CD8+ T cell, thereby killing any brain cancer cell in proximity thereof. Accordingly, another aspect of the invention includes a method for identifying brain cancer patients most likely to benefit from treatment with the compositions described herein. An exemplary method comprises detecting in a biological sample one or more MIP migration- associated biomarkers listed in Table 1, and comparing said level of biomarkers with a reference level from subjects who benefitted from said treatment, patients exhibiting equal or higher levels being identified as most likely to benefit from treatment. Finally, the invention provides a composition comprising GD2-BiTE in a pharmaceutically acceptable carrier for use of the treatment of any cancer expressing a GD2 antigen. In certain embodiments, the GD2-BiTE sequence is set forth in SEQ ID NO:66. In other embodiments, SEQ ID NO: 66 comprises modifications that enhance one or both of stability and bioavailability. Also disclosed is a method for administration of the composition of GD2-BiTE or modified versions thereof to patients, comprising direct delivery of said GD2-BiTE through infusion, via a cannula, an Ommaya reservoir, or intravenously for treatment of a brain tumor. In preferred embodiments, the GD2-BiTE composition is administered in combination with a T-cell infusion. In certain approaches, the composition is administered via direct delivery of said GD2- BiTE through infusion, via a cannula, an Ommaya reservoir, or intravenously, for treatment of any tumor expressing GD2 antigen. Brief Description of the Drawings Figures 1A – 1E: Fig. 1A) Overview of how CXCL12 binding activates CXCR4 and its downstream pathways, which include the RAS pathway. Almost immediately after CXCL12 binding, CXCR4 becomes phosphorylated which drives Arrestin binding and CXCR4 degradation.22Fig. 1B) Violin plot comparing expression of CXCL12, HMGB1 and MIF in normal cortex and pediatric HGG. Fig 1C) Violin plot comparing expression of CXCL12, HMGB1 and MIF in normal cortex and pediatric LGG. Fig 1D) Table of expression of CXCL12, HMGB1 and MIF in breast and lung cancer brain metastases (TPM: transcripts per million) showing substantial higher expression than normal control cortex values. Fig 1E) Cortical and Striatal interneuron precursors are derived from MGE residing precursors and migrate to populate the Cortex and Striatum respectively. Figures 2A -2B: Fig. 2A) An scFv is composed of the linker connected heavy and light variable fragment (VHand VL) of the variable fragment (Fv) of an antibody. The Fv is responsible for antigen binding.27Fig. 2B) EGFR-BiTE mechanism of action: Binding of the BiTE to EGFR (tumor cell) and CD3 (T-cell) activates the T-cell and stimulates release of perforin and granzyme eliminating the tumor cell. Modified from29. Figures 3A – 3F: Fig. 3A) Strategy for generating the human LHX6-citrine ES line. cDNA encoding citrine was placed at the native start site for LHX6 exon 1, followed by a p2A sequence and in-frame read through into Lhx6 exon 1. This approach does not alter LHX6 expression from this allele. Fig. 3B) Differentiation of the LHX6-citrine ES line to medial ganglionic eminence- like or MGE-like cells containing Lhx6-citrine+, post-mitotic MIPs (MGE, the region of the ventral forebrain where LHX6-expressing MIPs are generated). Between differentiation day 24 and 40 the cultures are dissociated, optionally subjected to FACS, and in this case replated onto dissociated rat cortical cells. Fig. 3C) Co-staining for Citrine (green) and LHX6 (red) in differentiated MIPs (plated on Rat cortical feeders) showing that all Citrine positive cells are LHX6 positive i.e., MIP. Fig. 3D) MIP: IF Staining with MCIP Markers MAP2 and SOX6. Fig. 3E) In vitro migration assay: Tumor spheres (red) are allowed to form and become encased in a matrigel matrix containing MIP (green). MIPs are allowed to migrate for 5 days, and the radius of the migration front is determined. Bottom: Images at day 0 and 5 post plating. Fig. 3F) Incucyte transwell migration assay: Wells are coated with matrigel and MCIPs are plated on the top well (~20k cells). 24h later a chemoattractant is added to the bottom well and migration is monitored, data is plotted as fold change number of cells on the bottom of the membrane compared to control. Top: migration to chemokines, bottom: migration to conditioned media. 100ng / ml CXCL12, NRG1, IGFPB2, HGF and MIF significantly attract MCIPs (p<0.05). MCIPs have a 4-fold increased migration to 8 / 13 conditioned medias. Fig 3G) Mouse MCIPs migrate to the site of a glioblastoma. Left: low magnification image showing an interneuron stream from the MCIP injection site to the tumor site. MCIP (red) arrive at the location of the tumor (blue, U87) in 7 days and wrap around the main glioblastoma (right) or micro-lesion (bottom) (green=CXCL12). Fig 3H) Human MIPs (green) migrate to the site of a glioblastoma within 14 days when injected 2mm apart. Top: MIP injection site and tumor injection site are indicated. MIPs migrate through different paths to the tumor (red, tumor 1746) indicated by green arrows. Bottom Left: U87 (Blue), Bottom Right: 1746 (red), higher magnification of top. The tumor is about 200uM across. Figures 4A -4E: Fig. 4A) 2D killing assay (0 and 48h) showing 1746 pHGG cells (red) mixed with BiTE expressing 293T cells and CD8 T-cells. A Cytotox agent stains dead cells fluorescent green. Fig. 4B) 3058 pHGG sphere (red) mixed with BiTE expressing MIPs and CD8 T-cells (small cells surrounding sphere), show potent tumor killing by EGFR within 48h. No killing was observed with a control BiTE Fig. 4C-D) Mice were injected with 3058 tumor cells, BiTE expressing MIPs and T-cells in a single location. CD19-BiTE was used as a control. Fig. 4C) Luminesce signal shows a tumor present with CD19-BiTE MIP controls but not with EGFR- BiTE expressing MIPs. Fig. 4D) Survival curves of the 3058 xenografts (pilot study) showing that the EGFR-BiTE treated mice have an extended survival (3 mice per study arm, p=0.025). Fig. 4E) Survival curves of the 3058 xenografts, where 3058 and MIPs were injected in a single location. A cannula was placed after 2 weeks and T-cells were infused weekly for 4 weeks. EGFR-BiTE treated mice have an extended survival. (6 mice per study arm, p=0.002) Fig 4F-4G 2D killing assay (0 and 48h) showing 1769 pHGG cells (red) mixed with GD2 BiTE expressing 293T cells and CD8 T-cells. No killing was observed with a control BiTE Figure 5: MIPs (green) of Lhx6-EGFP reporter mice migrate to CXCL12 containing beads, but not BSA, when placed on 13.5-day old embryonic brain slices48. Prior Art. Figure 6: Western blots showing RAS pathway activation (pERK) in MIPs after exposure to glioblastoma conditioned MIP media, rCXCL12, rMIF, rHMGB1 or rCXCL12 / rHMGB1 and showing CXCR4 phosphorylation upon rCXCL12 exposure. Arrows indicate the 3 phosphorylated bands. CXCR4 becomes rapidly phosphorylated (1min) and is degraded over a 15 min time period. Figure 7: Schematic overview of our BiTE, where we link the scFv of EGFR to the scFv of CD3. The IGK leader sequence drives secretion of the BiME, a HIS tag allows us to purify the BiME. Detailed Description of the Invention In all mammalian species studied, most inhibitory interneurons of the cerebral cortex and striatum originate embryonically, in the ventral / subcortical portion of the telencephalic neural tube9-12. Most interneurons originate from Nkx2.1-expressing progenitors. Expression of LHX6 serves as a biomarker for post-mitotic migratory inhibitory interneuron precursors (MIPs) which maintain LHX6 expression through post-migratory development11. MIP migration takes roughly one week in mice and 4-6 weeks in humans13and is guided by both chemorepulsant and chemoattractive factors11. Remarkably, even though these gradients are largely absent in adult brain, transplanted MIPs can migrate in the cerebral cortex of rodents, pigs, ferrets, and primates14. At least within rodents, MIPs can also migrate when transplanted outside of the cerebral cortex, including in striatum15, cerebellum16, and spinal cord17. During fetal brain development, MIPs are chemoattracted to migrate long distances from their subcortical origins into the cerebral cortex or striatum (FIG. 1E). Several MIP chemoattractants have been identified, CXCL12 for example activates CXCR4 and CXCR7 on MIPs to induce this migration. Intriguingly, multiple ligands of CXCR4 and CXCR7 are secreted by glioblastoma (CXCL12, HMGB1 and MIF) (FIG. 1B), suggesting that MIPs would be chemoattracted to HGG. Excitingly, both in vitro and in vivo data presented below show that MIPs robustly migrate to the majority of glioblastoma cell lines evaluated. Crucially, this migration is independent of unique tumor antigens and the TME and provides the opportunity to use MIPs as a delivery vector for cytotoxic agents. In one approach, we successfully eliminated glioblastoma in vivo by modifying MIPs to secrete Bispecific T-cell Engagers (BiTE) (FIG. 2). BiTEs are in essence two antibodies linked together, where one antibody binds to a tumor antigen and the other binds to CD3 on the T-cell, resulting in T-cell activation and elimination of the engaged tumor cell. Importantly, the CD8 T- cells have no innate recognition of the tumor cell as this is provided by the BiTE. Excitingly, the in vitro and in vivo data below show that EGFR-BiTE secreting MIPs eliminate EGFR expressing glioblastoma cells. Moreover, local EGFR BiTE secretion has limited systemic toxicity, thereby making EGFR a viable non-unique target. Notably, several BiTE therapies are FDA approved. The data showing the efficacy of the EGFR BiTE approach provides proof of principle, as MIPs can be equipped with a wide range of agents that destroy glioblastoma cells (FIG. 4). As a therapy, modified MIPs differentiated from patient or compatible donor or “off the shelf” induced pluripotent stem cells, are injected into the margin of the surgical cavity to “clean- up” tumor cells remaining post-surgery. Several iPSC based clinical trials are ongoing. CXCL12 is chemoattractive for MIPs. However, we hypothesize that other factors can drive MIP migration to glioblastoma as well. These can function as biomarkers to select an appropriate patient population for study in clinical trials. We describe modification of MIPs to both improve tumor-targeting and expand the patient population that could benefit from an MIP therapy. The data show that MIPs can migrate to glioblastoma in vivo (FIGS. 3G -3H). Glioblastoma express a number of proteins that can attract MIPs. Factors and biomarkers responsible for MIP-to-glioblastoma migration are identified herein and can be used to advantage to improve migratory capacity of MIPs by over-expressing migration promoting receptors like CXCR4, CXCR7 or by preventing CXCR4 or CXCR7 degradation upon ligand binding. Since transplanted MIP can migrate in multiple CNS regions, including striatum, cerebellum, and spinal cord, the compositions and methods provided herein can be used to advantage for the production of novel anti-glioblastoma therapeutic strategies for both forebrain glioblastoma and for other solid tumors of the CNS. Definitions It is to be understood that the disclosed method and compositions are not limited to specific synthetic methods, specific analytical techniques, or to particular reagents unless otherwise specified, and, as such, may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular forms and embodiments only and is not intended to be limiting. It should be understood that while various embodiments in the specification are presented using “comprising” language, under various circumstances, a related embodiment is also described using “consisting of” or “consisting essentially of” language. It is to be noted that the term “a” or “an”, refers to one or more, for example, “an immunoglobulin molecule,” is understood to represent one or more immunoglobulin molecules. As such, the terms “a” (or “an”), “one or more,” and “at least one” is used interchangeably herein. As used herein, the term “activity” refers to a biological activity. As used herein, the term “pharmacological activity” refers to the inherent physical properties of a peptide or polypeptide. These properties include but are not limited to half-life, solubility, and stability and other pharmacokinetic properties. The term “hit” refers to a test compound that shows desired properties in an assay. The term “test compound” refers to a chemical, drug or peptide to be tested by one or more screening method(s) as a putative modulator. A test compound can be any chemical, such as an inorganic chemical, an organic chemical, a protein, a peptide, a carbohydrate, a lipid, or a combination thereof. Usually, various predetermined concentrations of test compounds are used for screening, such as 0.01 micromolar, 1 micromolar and 10 micromolar. Test compound controls can include the measurement of a signal in the absence of the test compound or comparison to a compound known to modulate the target. The terms “high,” “higher,” “increases,” “elevates,” or “elevation” refer to increases above basal levels, e.g., as compared to a control. The terms “low,” “lower,” “reduces,” or “reduction” refer to decreases below basal levels, e.g., as compared to a control. The term “modulate” as used herein refers to the ability of a compound to change an activity in some measurable way as compared to an appropriate control. As a result of the presence of compounds in the assays, activities can increase or decrease as compared to controls in the absence of these compounds. Preferably, an increase in activity is at least 25%, more preferably at least 50%, most preferably at least 100% compared to the level of activity in the absence of the compound. Similarly, a decrease in activity is preferably at least 25%, more preferably at least 50%, most preferably at least 100% compared to the level of activity in the absence of the compound. A compound that increases a known activity is an “agonist”. One that decreases, or prevents, a known activity is an “antagonist”. The term “inhibit” means to reduce or decrease in activity or expression. This can be a complete inhibition or activity or expression, or a partial inhibition. Inhibition can be compared to a control or to a standard level. Inhibition can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64,65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%. The term “preventing” as used herein refers to administering a compound prior to the onset of clinical symptoms of a disease or conditions so as to prevent a physical manifestation of aberrations associated with the disease or condition. The term “in need of treatment” as used herein refers to a judgment made by a caregiver (e.g. physician, nurse, nurse practitioner, or individual in the case of humans; veterinarian in the case of animals, including non-human mammals) that a subject requires or will benefit from treatment. This judgment is made based on a variety of factors that are in the realm of a care giver's expertise, but that includes the knowledge that the subject is ill, or will be ill, as the result of a condition that is treatable by the disclosed compounds. As used herein, “subject” includes, but is not limited to, animals, plants, bacteria, viruses, parasites and any other organism or entity. The subject can be a vertebrate, more specifically a mammal (e.g., a human, horse, pig, rabbit, dog, sheep, goat, non-human primate, cow, cat, guinea pig or rodent), a fish, a bird or a reptile or an amphibian. The term does not denote a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are intended to be covered. A patient refers to a subject afflicted with a disease or disorder. The term “patient” includes human and veterinary subjects. By “treatment” and "treating" is meant the medical management of a subject with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, associated with brain cancer. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder. It is understood that treatment, while intended to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder, need not actually result in the cure, ameliorization, stabilization or prevention. The effects of treatment can be measured or assessed as described herein and as known in the art as is suitable for the disease, pathological condition, or disorder involved. Such measurements and assessments can be made in qualitative and / or quantitative terms. Thus, for example, characteristics or features of a disease, pathological condition, or disorder and / or symptoms of a disease, pathological condition, or disorder can be reduced to any effect or to any amount. A cell can be in vitro. Alternatively, a cell can be in vivo and can be found in a subject. A “cell” can be a cell from any organism. “Migratory inhibitory interneuron precursor cells” from the cerebral cortex or striatum originate embryonically, in the ventral / subcortical portion of the telencephalic neural tube9-12. Most interneurons originate from Nkx2.1-expressing progenitors, then express LHX6 in post- mitotic migratory inhibitory interneuron precursors (MIPs) and maintain this LHX6 expression through post-migratory development11. MIP migration takes roughly one week in mice and 4-6 weeks in humans13and is guided by both chemorepulsant and chemo-attractive factors. As described herein further below, MIP cells can be used to advantage for killing malignant cells in the brain with minimal adverse side effects. As used herein “immune effector cells” refers to cells from the human body that are capable of effecting or enhancing an immune response. These are collected from the human body (harvested) so they can be administered to patients directly into the brain in need thereof. Exemplary immune effector cells as used herein include CD8+ T cells, and NK cells. The term “chemoattraction” as used herein refers to the unidirectional movement of a cell, in response to a chemical gradient of ligands. During chemoattraction, cells move in the direction from a low to a high concentration of the chemoattractant. By the term “effective amount” of a compound as provided herein is meant a nontoxic but sufficient amount of the compound to provide the desired result. "Anti-tumor efficacy" herein refers to an inhibitory effect on tumor growth, particularly brain tumor growth, which can be manifested as slowing, retarding, arresting or even reversing (i.e., shrinking) growth of the tumor. By “pharmaceutically acceptable” is meant a material that is not biologically or otherwise undesirable, i.e., the material can be administered to a subject along with the selected compound without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained. “Sample” as used herein means any biological fluid or tissue that contains the biomarkers. The most suitable samples for use in the methods and with the compositions are blood samples, including serum, plasma, whole blood, and peripheral blood. It is also anticipated that other biological fluids, such as CNS fluids, saliva or urine may be used similarly. Such samples may further be diluted with saline, buffer or a physiologically acceptable diluent. Alternatively, such samples are concentrated by conventional means. By “change in expression” is meant an increased expression level of a selected biomarker, or upregulation of the genes or transcript encoding it in comparison to the reference or control; a decreased expression level of a selected biomarker or a downregulation of the genes or transcript encoding it in comparison to the reference or control; or a combination of certain increased / upregulated and decreased / down regulated biomarkers. The degree of change in target expression can vary with each individual and is subject to variation with each population. For example, in one embodiment, a large change, e.g., 2-3 fold increase or decrease in a small number of biomarkers, e.g., from 1 to 9 characteristic biomarkers, is statistically significant. In another embodiment, a smaller relative change in about 5, 10, 15, 20, 25, or more biomarkers is statistically significant By “target biomarker” or “target biomarker signature” as used herein is meant those proteins / peptides or the genes / transcripts encoding same, the expression of which changes (either in an up-regulated or down-regulated manner) characteristically in the presence of brain cancer from that in a healthy individual. In one embodiment, at least one target biomarker forms a suitable biomarker signature for use in the methods and compositions. In one embodiment, at least two target biomarkers form a suitable biomarker signature for use in the methods and compositions. Specific biomarker signatures can include any combination of brain cancer biomarkers employing at least one biomarker identified herein. One skilled in the art may readily reproduce the compositions and methods described herein by use of the sequences of the biomarkers, all of which are publicly available from conventional sources, such as GenBank. The term “microarray” refers to an ordered arrangement of hybridizable array elements, e.g., primers, probes, ligands, on a substrate. The term can also refer to a high grade glioblastoma (HGG) tissue microarray. The term “ligand” refers to a molecule that binds to a protein or peptide, and includes antibodies and fragments thereof. The term “polynucleotide,” when used in singular or plural form, generally refers to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA encoding a sequence of interest. Thus, for instance, polynucleotides as defined herein include, without limitation, single- and double-stranded DNA, DNA including single- and double-stranded regions, single- and double-stranded RNA, and RNA including single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or include single- and double-stranded regions. In addition, the term “polynucleotide” as used herein refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term “polynucleotide” specifically includes cDNAs. The term includes DNAs (including cDNAs) and RNAs that contain one or more modified bases. In general, the term “polynucleotide” embraces all chemically, enzymatically and / or metabolically modified forms of unmodified polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including simple and complex cells. In certain approaches the sequence of interest can include one or more ancillary sequences that facilitate expression of a nucleic acid of interest, e.g, promoters, leader sequences, polyA tails, and internal ribosome entry sites (IRES). Other ancillary sequences can include sequences that facilitate the cleavage of gene products or encoded RNAs post-expression, including but not limited to recognition sites of cellular or viral proteases or sequence encoding for catalytically active RNA or polypeptide sequences. Also included are sequences encoding functional RNAs, siRNA and shRNA. In certain approaches sequences encoding other RNAs that function as guides or co-factors in gene editing processes, including but not limited to CRISPR Cas9 guide RNAs can be incorporated into the nanoparticle. The nucleic acid of interest can also comprise non-coding sequence that facilitates recombination of the DNA of interest with the cellular (host) genome, including but not limited to sequence derived from retroviruses (including lentiviruses), bacteriophages, or cellular genomes. Other non-coding sequence to be included include those that facilitate circularization of the DNA cargo post- delivery or promote the maintenance of DNA cargo as an episome post-delivery. As noted above, the nucleic acid of interest can be flanked by sequences corresponding to the inverted terminal repeats (ITRs) of an adenovirus genome, or modified forms of the ITRs. Any of the above-mentioned nucleic acid sequences can be modified to limit recognition by the innate immune response. The term “oligonucleotide” refers to a relatively short polynucleotide of less than 20 bases, including, without limitation, single-stranded deoxyribonucleotides, single- or double- stranded ribonucleotides, RNA:DNA hybrids and double-stranded DNAs. Oligonucleotides, such as single-stranded DNA probe oligonucleotides, are often synthesized by chemical methods, for example using automated oligonucleotide synthesizers that are commercially available. However, oligonucleotides can be made by a variety of other methods, including in vitro recombinant DNA-mediated techniques and by expression of DNAs in cells and organisms. “Antisense oligonucleotides or strands” are oligonucleotides that are complementary to sense oligonucleotides, pre-mRNA, RNA or sense strands of particular genes and which bind to such genes and gene products by means of base pairing. Examples of base pairing nucleotides include but are not limited to, uracil, thymine, adenine, cytosine, guanine and hypoxanthine having their respective amino groups protected by acyl protecting groups, 2-fluorouracil, 2- fluorocytosine, 5-bromouracil, 5-iodouracil, 2,6-diaminopurine, azacytosine, pyrimidine analogs such as pseudoisocytosine and pseudouracil and other modified nucleobases such as 8- substituted purines, xanthines, or hypoxanthines. Further examples of base pairing nucleotides, include but are not limited to, expanded-size nucleobases in which one or more benzene rings has been added. When binding to a sense oligonucleotide, the antisense oligonucleotide need not base pair with every nucleotide in the sense oligonucleotide. A “derivative” of a polypeptide, polynucleotide or fragments thereof means a sequence modified by varying the sequence of the construct, e.g., by manipulation of the nucleic acid encoding the protein or by altering the protein itself. “Derivatives” of a gene or nucleotide sequence refers to any isolated nucleic acid molecule that contains significant sequence similarity to the gene or nucleotide sequence or a part thereof. In addition, "derivatives" include such isolated nucleic acids containing modified nucleotides or mimetics of naturally-occurring nucleotides. Immune response modifiers ("IRMs") include compounds that possess potent immunomodulating activity including but not limited to antiviral and antitumor activity. Certain IRMs modulate the production and secretion of cytokines. For example, certain IRM compounds induce the production and secretion of cytokines such as, e.g., Type I interferons, TNF-alpha, IL- 1, IL-6, IL-8, IL-0, IL-12, MIP-1, and / or MCP-1. As another example, certain IRM compounds can inhibit production and secretion of certain TH2 cytokines, such as IL-4 and IL-5. Additionally, some IRM compounds are said to suppress IL-1 and TNF (U.S. Pat. No. 6,518,265). As used herein the term "wild type" is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms. As used herein the term "variant" or “mutant” should be taken to mean the exhibition of qualities that have a pattern that deviates from the wild type or a comprises non naturally occurring components. The term “variant” refers to a nucleic acid sequence or polypeptide comprising a sequence, which differs (by deletion, insertion, and / or substitution of a nucleic acid or amino acid, an L or D stereoisomer an amino acid, or a non-naturally occurring amino acid) in one or more nucleic acid or amino acid positions differ from that of a wild type nucleic acid or polypeptide sequence. The terms "non-naturally occurring" or "engineered" are used interchangeably and indicate the involvement of the hand of man. The terms, when referring to nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature. The term “linker” refers to a connection between two protein coding sequences or their protein products. Linkers comprise a stretch of contiguous nucleic acids or amino acids, which holds at least one cleavage site that enables separation of the genes or their products through cleavage of the linker. Preferably, the linker comprises a cleavage site at its 5′ end and a cleavage site at its 3′ end, or a cleavage site at its N-terminal end and a cleavage site at its C-terminal end. As noted above, the invention also includes polynucleotides encoding the peptides or fusion proteins comprising the protein sequences described herein. Those of skill in the art understand the degeneracy of the genetic code and that a variety of polynucleotides can encode the same polypeptide. In some embodiments, the polynucleotides (i.e., polynucleotides encoding the fusion polypeptides) may be codon-optimized for expression in a particular cell. Any polynucleotide sequences may be used which encode a desired form of the polypeptides described herein. The polynucleotide sequences which encode the polypeptides of the invention represent non-naturally occurring sequences. Computer programs for generating degenerate coding sequences are available and can be used for this purpose. Pencil, paper, the genetic code, and a human hand can also be used to generate degenerate coding sequences. In the present context, the term “codon optimization” refers to changing the codons of a nucleotide sequence without altering the amino acid sequence that it encodes in order to favor expression in a specific species. Codon optimization may be used to increase the abundance of the peptide or protein that the nucleotide sequence encodes since “rare” codons are removed and replaced with abundant codons. Regarding the fusion polypeptides disclosed herein, the phrases “% sequence identity,” “percent identity,” or “% identity” refer to the percentage of residue matches between at least two amino acid sequences aligned using a standardized algorithm. Methods of amino acid sequence alignment are well-known. Some alignment methods take into account conservative amino acid substitutions. Such conservative substitutions generally preserve the charge and hydrophobicity at the site of substitution, thus preserving the structure (and therefore function) of the polypeptide. Percent identity for amino acid sequences may be determined as understood in the art. The structural similarity is typically at least 80% identity, at least 81% identity, at least 82% identity, at least 83% identity, at least 84% identity, at least 85% identity, at least 86% identity, at least 87% identity, at least 88% identity, at least 89% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity. Polypeptide sequence identity may be measured over the length of an entire defined polypeptide sequence, for example, as defined by a particular SEQ ID number, or may be measured over a shorter length, for example, over the length of a fragment taken from a larger, defined polypeptide sequence, for instance, a fragment of at least 15, at least 20, at least 30, at least 40, at least 50, at least 70 or at least 150 contiguous residues. Such lengths are exemplary only, and it is understood that any fragment length supported by the sequences shown herein, may be used to describe a length over which percentage identity may be measured. A “specific binding pair” comprises a specific binding member (sbm) and a binding partner (bp) which have a particular specificity for each other and which in normal conditions bind to each other in preference to other molecules. Examples of specific binding pairs are antigens and antibodies, biotin and streptavidin, ligands and receptors and complementary nucleotide sequences. The skilled person is aware of many other examples. Further, the term “specific binding pair” is also applicable where either or both of the specific binding member and the binding partner comprise a part of a large molecule. In embodiments in which the specific binding pair comprises nucleic acid sequences, they will be of a length to hybridize to each other under conditions of the assay, preferably greater than 10 nucleotides long, more preferably greater than 15 or 20 nucleotides long. Vectors and Production Transgenic cells expression said polynucleotides also form an aspect of the invention. A transgenic cell may be obtained by introducing a recombinant nucleic acid molecule that encodes a protein of this disclosure. As used herein, the term “recombinant nucleic acid” refers to a polynucleotide that is manipulated by human intervention. A recombinant nucleic acid molecule can contain two or more nucleotide sequences that are linked in a manner such that the product is not found in a cell in nature. In particular, the two or more nucleotide sequences can be operatively linked and, for example, can encode a fusion polypeptide. A recombinant nucleic acid molecule also can be based on, but manipulated so as to be different, from a naturally occurring polynucleotide, for example, a polynucleotide having one or more nucleotide changes such that a first codon, which normally is found in the polynucleotide, is biased for chloroplast codon usage, or such that a sequence of interest is introduced into the polynucleotide, for example, a restriction endonuclease recognition site or a splice site, a promoter, a DNA origin of replication, or the like. Any appropriate technique for introducing recombinant nucleic acid molecules into cells may be used. Techniques for cellular transformation are known and include, without limitation, transfection, transduction, electroporation, biolistic transformation (also referred to as micro- projectile / particle bombardment), and cell to cell fusion. As used herein, the term “construct” refers to recombinant polynucleotides including, without limitation, DNA and RNA, which may be single-stranded or double-stranded and may represent the sense or the antisense strand. Recombinant polynucleotides are polynucleotides formed by laboratory methods that include polynucleotide sequences derived from at least two different natural sources or they may be synthetic. Constructs thus may include new modifications to endogenous genes introduced by, for example, genome editing technologies. Constructs may also include recombinant polynucleotides created using, for example, recombinant DNA methodologies. A “vector” is capable of transferring gene sequences to target cells. Typically, “vector construct,” “expression vector,” and “gene transfer vector,” mean any nucleic acid construct capable of directing the expression of a gene of interest and which can transfer gene sequences to target cells. Thus, the term includes cloning and expression vehicles, as well as integrating vectors. The constructs and vectors provided herein may be prepared by methods available to those of skill in the art. Notably each of the constructs or expression cassettes claimed are recombinant molecules and as such do not occur in nature. Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, and recombinant DNA techniques that are well known and commonly employed in the art. Standard techniques available to those skilled in the art may be used for cloning, DNA and RNA isolation, amplification and purification. Such techniques are thoroughly explained in the literature. As used herein, the terms “heterologous promoter,” “promoter,” “promoter region,” or “promoter sequence” refer generally to transcriptional regulatory regions of a gene, which may be found at the 5′ or 3′ side of the polynucleotides described herein, or within the coding region of the polynucleotides, or within introns in the polynucleotides. Typically, a promoter is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3′ direction) coding sequence. The typical 5′ promoter sequence is bounded at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter sequence is a transcription initiation site (conveniently defined by mapping with nuclease S1), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. In some embodiments, the disclosed polynucleotides are operably connected to the promoter. As used herein, a polynucleotide is “operably connected” or “operably linked” when it is placed into a functional relationship with a second polynucleotide sequence. For instance, a promoter is operably linked to a polynucleotide if the promoter is connected to the polynucleotide such that it may affect transcription of the polynucleotides. In various embodiments, the polynucleotides may be operably linked to at least 1, at least 2, at least 3, at least 4, at least 5, or at least 10 promoters. Heterologous promoters useful in the practice of the present invention include, but are not limited to, constitutive, inducible, temporally-regulated, developmentally regulated, chemically regulated, tissue-preferred and tissue-specific promoters. Preferably, the promoter is a constitutive promoter capable of driving high levels of an operably linked protein coding sequence. In some embodiments, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue- specific regulatory elements are used to express the nucleic acid). Non-viral vector delivery systems include DNA plasmids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome. Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211- 217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bihm (eds) (1995); and Yu et al., Gene Therapy 1:13-26 (1994). Methods of non-viral delivery of nucleic acids include lipofection, nucleofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTMand LipofectinTM). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91 / 17424; WO 91 / 16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration). The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787). The use of RNA or DNA viral based systems for the delivery of nucleic acids take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo). Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues. The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT / US94 / 05700). In applications where transient expression is preferred, adenoviral based systems may be used. Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system. Adeno-associated virus ("AAV") vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93 / 24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94:1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81:6466-6470 (1984); and Samulski et al., J. Virol. 63:03822-3828 (1989). Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ψ2 cells or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by producing a cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome. Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line may also be infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV. As used herein, “labels” or “reporter molecules” are chemical or biochemical moieties useful for labeling a nucleic acid (including a single nucleotide), polynucleotide, oligonucleotide, or protein ligand, e.g., amino acid, peptide sequence, protein, or antibody. “Labels” and “reporter molecules” include fluorescent agents, chemiluminescent agents, chromogenic agents, quenching agents, radionucleotides, enzymes, substrates, cofactors, inhibitors, radioactive isotopes, magnetic particles, and other moieties known in the art. “Labels” or “reporter molecules” are capable of generating a measurable signal and may be covalently or noncovalently joined to an oligonucleotide or nucleotide (e.g., a non-natural nucleotide) or ligand. A "targeting molecule" or "targeting agent" is a peptide or other molecule that binds to a targeted component). Optionally, the binding affinity of the targeting molecule may be in the range of 1 nM to 1 µM. In some embodiments, the targeting molecule may be an antagonist of a receptor on the surface of a targeted cell. As used herein, the term "adjuvant" refers to a compound that, with a specific immunogen or antigen, will augment or otherwise alter or modify the resultant immune response. Modification of the immune response includes intensification or broadening the specificity of either or both antibody and cellular immune responses. Modification of the immune response can also mean decreasing or suppressing certain antigen-specific immune responses. In certain embodiments, the adjuvant is a cyclic dinucleotide. Suitable antibodies and antibody fragments may be agonistic or antagonistic and include those with anticancer activity and those which modify host cell responses to the cancer, for example: an agonist or antagonistic antibody or antibody fragment may decrease vascularization or normalize vascularization of the tumor. In one embodiment agonistic antibodies or other encoded proteins may render the host cell more visible to the host's innate and adaptive immune responses, for example by expressing antigens, danger signals, cytokines or chemokines to attract and activate the same, or by binding to co-stimulatory or checkpoint pathway molecules to enhance adaptive immune responses. Registered therapeutic antibodies suitable for use in the methods described herein include without limitation abciximab, adalimumab, alemtzumab, basiliximab, belimumab, bevacizumab, brentuximab vedotin, canakinumab, cetuximab, certolzumab, daclizumab, denosumab, eculzumab, efalixumab, gemtuzumab, golimumab, ibritumomab tiuxetan, infliximab, ipilimumab, muromonab-CD3, ofatumumab, palivizumab, panitumumab, ranibizumab, rituximab, tocilizumab, tositumomab and trastuzumab. Antibody-binding fragments includes an antibody fragment able to target the antigen with the same, similar or better specificity to the original “antibody” from which it was derived. Antibody fragments include: Fab, modified Fab, Fab′, modified Fab′, F(ab′) 2, Fv, single domain antibodies (e.g. VH or VL or VHH), scFv, bi, tri or tetra-valent antibodies, Bis-scFv, diabodies, triabodies, tetrabodies and epitope-binding fragments of any of the above (see for example Holliger and Hudson, 2005, Nature Biotech. 23(9):1126-1136; Adair and Lawson, 2005, Drug Design Reviews—Online 2(3), 209-217). The methods for creating and manufacturing these antibody fragments are well known in the art (see for example Verma et al., 1998, Journal of Immunological Methods, 216, 165-181). Other antibody fragments for use in the present invention include the Fab and Fab′ fragments described in international patent applications WO2005 / 003169, WO2005 / 003170 and WO2005 / 003171. Multi-valent antibodies may comprise multiple specificities e.g. bispecific or may be monospecific (see for example WO 92 / 22853, WO05 / 113605, WO2009 / 040562 and WO2010 / 035012). The term "binding domain" refers to a domain which (specifically) binds to (i.e., interacts with or recognizes) a given target epitope or a given target site on a target molecule (antigen), such as, e.g., CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, MUC17, HER2, EpCAM, EGFR, GD2 or CD3. In a bispecific antibody construct, for example, the structure and function of the first binding domain (recognizing, e.g., CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, HER2, EpCAM, GD2, EGFR or MUC17), and preferably also the structure and / or function of the second binding domain (recognizing CD3), is / are based on the structure and / or function of an antibody, e.g., of a full-length or whole immunoglobulin molecule. The first and second binding domain are connected with a linker (Figure 7). Alternatively, the structure and function are drawn from the variable heavy chain (VH) and / or variable light chain (VL) domains of an antibody or fragment thereof. Preferably, the first binding domain is characterized by the presence of three light chain CDRs (i.e., CDR1, CDR2 and CDR3 of the VL region) and / or three heavy chain CDRs (i.e., CDR1, CDR2 and CDR3 of the VH region). The second binding domain preferably also comprises the minimum structural requirements of an antibody which allow for the target binding. More preferably, the second binding domain comprises at least three light chain CDRs (i.e., CDR1, CDR2 and CDR3 of the VL region) and / or three heavy chain CDRs (i.e., CDR1, CDR2 and CDR3 of the VH region). In various aspects, one or more of the antigen binding domains are human or humanized or chimeric. In some embodiments, the antibody construct comprises a single chain antibody construct. An scFv comprises a variable heavy chain, an scFv linker, and a variable light domain. Optionally, the C-terminus of the variable light chain is attached to the N-terminus of the scFv linker, the C-terminus of which is attached to the N-terminus of a variable heavy chain (N-vh- linker-vl-C), although the configuration can be switched (N-vl-linker-vh-C). Alternatively, the C-terminus of the variable heavy chain is attached to the N-terminus of the scFv linker, the C- terminus of which is attached to the N-terminus of a variable light chain (N-vl-linker-vh-C), although the configuration can be switched (N-vh-linker-v-C). scFvs in either orientation are contemplated herein, as are scFvs with half-life extending moieties. Peptide linkers (spacer peptides) may be used in the context of antigen binding domains and variable domains (VH / VL). A peptide linker may link variable domains and / or may be used to fuse a third domain to an antibody construct. Peptide linkers used in the context of the disclosure do not comprise polymerization activity. Peptide linkers also may be used to attach other domains or modules or regions (such as half-life extending domains) to an antigen binding protein, such as the bispecific antibody constructs described herein. Among the suitable peptide linkers are those described in U.S. Patents 4,751,180 and 4,935,233 or International Patent Publication No. WO 88 / 09344, the disclosures of which are incorporated herein by reference in their entireties. In some embodiments, the antibody construct comprises a third domain comprising a “Fc” or “Fc region” or “Fc domain,” which refers to the polypeptide comprising the constant region of an antibody excluding the first constant region immunoglobulin domain. Thus, “Fc domain” refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N- terminal to these domains. For IgA and IgM, Fc may include the J chain. For IgG, the Fc domain comprises immunoglobulin domains Cy2 and Cy3 (Cy2 and Cy3) and the lower hinge region between Cy1 (Cy1 ) and Cy2 (Cy2). A bispecific antibody construct of the disclosure is preferably based on an IgG antibody (which includes several subclasses, including, but not limited to lgG1, lgG2, lgG3, and lgG4). Although the boundaries of the Fc region may vary, the human IgG heavy chain Fc region is usually defined to include residues C226 or P230 to its carboxyl-terminus, wherein the numbering is according to the EU index as in Kabat. In some embodiments, amino acid modifications are made to the Fc region, for example, to alter binding to one or more FcyR receptors or to the FcRn receptor. In some embodiments, a bispecific antibody construct comprising a first binding domain that binds to a target cell surface antigen and a second binding domain that binds to human CD3 on the surface of a T cell. In any of the aspects described herein, the target cell surface antigen can be any antigen present on a brain cancer cell, preferably a glioblastoma specific antigen. Certain antigens of interest include, include without limitation, CDH19, MSLN, DLL3, FLT3, EGFR, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, MUC17, GD2, HER2, EpCAM or CLDN18.2. The bispecific antibody construct, in various aspects, comprises a third domain comprising, in an amino to carboxyl order, hinge-CH2 domain-CH3 domain-linker-hinge- CH2 domain-CH3 domain. In some embodiments, each of the first and second binding domains comprise a VH region and a VL region. Thus, in some embodiments, the formulations described herein comprise a bispecific antibody construct which binds human CD3 and human EGFR, or human CD3 and human MSLN, or human CD3 and human DLL3, or human CD3 and human FLT3, or human CD3 and human CDH19, or human CD3 and human BCMA, or human CD3 and PSMA, or human CD3 and human CD33, or human CD3 and human CD19, human CD3 and human CD70, or human CD3 and human MUC17, or human CD3 and human CLDN18.2. The term "solid matrix" as used herein refers to any format, such as beads, microparticles, a microarray, the surface of a microtitration well or a test tube, a dipstick or a filter. The material of the matrix may be polystyrene, cellulose, latex, nitrocellulose, nylon, polyacrylamide, dextran or agarose. The following materials and methods are provided to facilitate practice of the invention. The skilled person is aware that other techniques can be employed. Western blot Cells were lysed with 1% SDS lysis buffer (1% SDS, 100mM NaCl, 10mM Tris(base) pH7.5). Protein concentration was measured by the Bradford Assay (Bio-Rad). For immunoblot, cells were lysed in boiling 1%SDS lysis buffer, sample buffer was added and samples were boiled for 5 minutes before separation by electrophoresis on 4-12% SDS-PAGE gel in the electrophoresis chamber (Bio-Rad). Protein was transferred to nitrocellulose membrane using the same electrophoresis chamber. Non- specific protein binding was prevented by blocking the membrane with the Incept (PBS) blocking solution (Li-Cor). Membrane was incubated at 4 degrees overnight in blocking solution with primary antibodies (pERK, pAKT, total AKT or Vinculin from Cell signaling). After five washes with PBS-T (0.1% Tween-20), the blot was incubated with respective secondary antibodies (Li-COR Rabbit (1:10,000) at room temperature. The Li-Cor Odyssey imager was used for detection according to manufacturer's instruction. hESC Culture and Neural Differentiation hESCs (WA-09, HES-3 (NKX2.1::GFP), and iPSCs (C72 and SeV6) were maintained on mouse embryonic fibroblasts and dissociated with accutase (Innovative Cell Technologies) for differentiation or dispase for passaging (Chambers et al., 2009). Differentiation media were described previously (Kriks et al., 2011): knockout serum replacer (KSR) and N2 medium for neural induction, and neurobasal medium + B27 (GIBCO) and N2 supplements (Invitrogen) for neuronal differentiation. Small-molecule compounds were as follows: XAV939 (2 mM; Stemgent;), LDN193189 (100 nM; Stemgent), SB431542 (10 mM; Tocris Bioscience), purmorphamine (1–2 mM; Calbiochem), ascorbic acid (200 mM), and dibutyryl-cyclic AMP (200 mM; both from Sigma-Aldrich). Recombinant growth factors were as follows: SHH (C25II; 50–500 ng / ml), Noggin (125 ng / ml), DKK1 (250 ng / ml), BDNF (10 ng / ml), all from R&D Systems, and FGF2 (5–10 ng / ml; Promega). For human treatment, ES or iPSC cells can be used. iPSC can be prepared using standard protocols as described in Ghaedi et al. in Methods Mol Biol. (2019); 1576: 55–92, which is incorporated herein by reference. Modification of stem cells Transgenes can be introduced using a variety of methods as explained above. These include lentiviral transduction, retroviral transduction, piggybac vectors etc. In the example below, a lentiviral construct was employed, with the transgene under the CAG promotor referred to herein as a modified pLEX306 construct. These transgenes serve multiple purposes, including delivering a therapeutic agent or genes / factors / modifications that improve migration. Therapeutic agents BiTEs: Preferred examples of BiTEs useful in the present invention, include without limitation,EGFR-BiTE, GD2-BiTE, B7H3-BiTE, IL13RA-BiTE, KDR-BiTE, EGFRvIII-BiTE, HER2-Bite, Epcam-BiTE Each of the aforementioned BiTe’s can be synthesized using the methods described herein. Also of interest are CXCR4 blocking peptides. Chemokines that remodel the tumor microenvironment to reduce the immune suppressive nature of these tumors like IL6, IL1b, CSF2, IFNγ, TNFα can also be used to advantage in the treatment of brain cancer. Markers that enhance detection (fluorescent markers, GFP, RFP, etc) Improving migration, e.g., via introduction of a nucleic acid construct, (e.g., a lentiviral construct) with gene driven by hSYN, EIF2A, CAG, PGK or other promoter which result in: - CXCR4 expression; - CXCR4 S338X expression; - CXCR7 expression; - CXCR7 S335X expression; - CD74 expression; - CD44 expression; - Expression of or more sequences encoding variants of CXCR4 and CXCR7 (e.g., splice variants), said sequences lacking or comprising modifications to prevent degradation of sequence alterations that alter degradation of these receptors upon ligand binding. - Expression of or more sequences encoding variants of CD74 and CD44 (e.g., (splice variants) - shRNA targeting CXCR7 (also known as ACKR3, shRNAs ordered from Sigma Aldrich: (TRCN0000014512, TRCN0000358300, TRCN0000363139, TRCN0000363205, TRCN0000378566) - CRISPR can also be used to modify the endogenous CXCR4 or knock out CXCR7: a) CXCR4 S338X generation by CRISPR sequence: CTCTCCAAAGGAAAGCGAGG (SEQ ID NO: 2), PAM: TGG; CRISPR from IDT technologies (Hs.HC9.BLWL3886.AA), with the following sequence / AltR1 / rCrU rCrUrC rCrArA rArGrG rArArA rGrCrG rArGrG rGrUrU rUrUrA rGrArG rCrUrA rUrGrC rU / AltR2 / (SEQ ID NO: 3) HDR sequence positive strand: TGGAGTGAAAACTTGAAGACTCAGACTCAGTGGAAACAGATTAATGTCCACC TCGCTTTCCTTTGGAGAGGATCTTGAGGCTGGACCCTCTGC (SEQ ID NO: 4) HDR sequence negative strand: GCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGGTGGACATTA ATCTGTTTCCACTGAGTCTGAGTCTTCAAGTTTTCACTCCA (SEQ ID NO: 5) b) CXCR7 knockout CRISPR sequence: TTGCACGTGAGCTCGCCCAT, PAM: GGG (SEQ ID NO: 6); we are ordering this from IDT technologies, with the following sequence (Hs.Cas9.ACKR3.1.AA) / AltR1 / rUrU rGrCrA rCrGrU rGrArG rCrUrC rGrCrC rCrArU rGrUrU rUrUrA rGrArG rCrUrA rUrGrC rU / AltR2 / (SEQ ID NO: 7) Sequences for modification of MIPs (gene expression) >CXCR4 (codon optimized) ATGGAAGGCATTAGCATCTACACATCTGATAACTACACCGAGGAAATGGGAA GCGGCGACTACGACTCCATGAAAGAGCCTTGCTTCAGAGAGGAAAACGCCA ACTTCAACAAGATCTTCCTGCCTACCATCTACAGCATCATCTTCCTGACCGGA ATCGTGGGAAATGGCCTGGTGATCCTGGTCATGGGCTACCAGAAAAAGCTGA GAAGCATGACAGACAAGTACAGACTGCACCTGAGCGTTGCCGATCTGCTGTT CGTGATCACACTGCCCTTCTGGGCCGTGGACGCCGTGGCGAATTGGTACTTCG GCAACTTCCTCTGTAAAGCCGTGCACGTGATCTATACCGTGAACCTGTACAGC TCTGTGCTGATTCTGGCCTTTATCTCTCTGGACAGATACCTGGCTATCGTGCAT GCTACAAACAGCCAGCGGCCTAGAAAGCTGCTGGCCGAGAAGGTGGTGTAC GTGGGCGTGTGGATCCCTGCCCTGCTGCTGACAATCCCCGACTTCATCTTTGC CAATGTGTCCGAGGCTGATGATAGATACATCTGCGACAGATTCTACCCTAAC GACCTGTGGGTCGTGGTGTTCCAGTTCCAACACATCATGGTGGGCCTGATCCT CCCAGGTATCGTTATCCTTTCATGCTACTGCATCATCATCAGCAAACTGAGCC ACTCTAAAGGCCACCAGAAGCGCAAGGCCCTGAAGACCACCGTGATCCTGAT CCTGGCTTTTTTCGCTTGTTGGCTGCCCTACTACATCGGCATCAGCATCGACA GCTTTATTCTGCTGGAAATCATTAAGCAGGGATGTGAATTCGAGAACACCGT GCACAAGTGGATCAGCATCACCGAGGCCCTGGCCTTCTTCCACTGCTGCCTG AACCCTATCCTTTATGCCTTCCTGGGCGCCAAGTTCAAGACCAGCGCCCAGCA CGCCCTGACTAGCGTGAGCAGAGGCTCTAGCCTGAAGATCCTGTCCAAGGGC AAGCGGGGCGGCCACAGCAGCGTGTCCACCGAGAGCGAGTCTAGCTCTTTTC ACAGCAGCTGA (SEQ ID NO: 8) >CXCR4 amino acid sequence (codon optimized) MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNG LVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCK AVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPAL LLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIII SKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVH KWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGH SSVSTESESSSFHSS*(SEQ ID NO: 9) >CXCR4_S338X (codon optimized) ATGGAAGGCATTAGCATCTACACATCTGATAACTACACCGAGGAAATGGGAA GCGGCGACTACGACTCCATGAAAGAGCCTTGCTTCAGAGAGGAAAACGCCA ACTTCAACAAGATCTTCCTGCCTACCATCTACAGCATCATCTTCCTGACCGGA ATCGTGGGAAATGGCCTGGTGATCCTGGTCATGGGCTACCAGAAAAAGCTGA GAAGCATGACAGACAAGTACAGACTGCACCTGAGCGTTGCCGATCTGCTGTT CGTGATCACACTGCCCTTCTGGGCCGTGGACGCCGTGGCGAATTGGTACTTCG GCAACTTCCTCTGTAAAGCCGTGCACGTGATCTATACCGTGAACCTGTACAGC TCTGTGCTGATTCTGGCCTTTATCTCTCTGGACAGATACCTGGCTATCGTGCAT GCTACAAACAGCCAGCGGCCTAGAAAGCTGCTGGCCGAGAAGGTGGTGTAC GTGGGCGTGTGGATCCCTGCCCTGCTGCTGACAATCCCCGACTTCATCTTTGC CAATGTGTCCGAGGCTGATGATAGATACATCTGCGACAGATTCTACCCTAAC GACCTGTGGGTCGTGGTGTTCCAGTTCCAACACATCATGGTGGGCCTGATCCT CCCAGGTATCGTTATCCTTTCATGCTACTGCATCATCATCAGCAAACTGAGCC ACTCTAAAGGCCACCAGAAGCGCAAGGCCCTGAAGACCACCGTGATCCTGAT CCTGGCTTTTTTCGCTTGTTGGCTGCCCTACTACATCGGCATCAGCATCGACA GCTTTATTCTGCTGGAAATCATTAAGCAGGGATGTGAATTCGAGAACACCGT GCACAAGTGGATCAGCATCACCGAGGCCCTGGCCTTCTTCCACTGCTGCCTG AACCCTATCCTTTATGCCTTCCTGGGCGCCAAGTTCAAGACCAGCGCCCAGCA CGCCCTGACTAGCGTGAGCAGAGGCTCTAGCCTGAAGATCCTGTCCAAGGGC AAGCGGGGCGGCCACTGA(SEQ ID NO: 10) >CXCR4_S338 amino acid sequence MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNG LVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCK AVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPAL LLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIII SKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVH KWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGH *(SEQ ID NO: 11) Residues that could be mutated to prevent reduce degradation are in any of the CXCR4 variants described above include for example as least one of S324, S325, S330, S338. S339 S347. S346, T342. >CD74-1 NP_001020329.1 HLA class II histocompatibility antigen gamma chain isoform c [Homo sapiens] MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFS ILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMR MATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLG WV*(SEQ ID NO:16) >CD74-2 NP_001020330.1 HLA class II histocompatibility antigen gamma chain isoform a [Homo sapiens] MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFS ILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMR MATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLK GSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTK CQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRG HHNCSESLELEDPSSGLGVTKQDLGPVPM* (SEQ ID NO:17) >CD74-3 NP_001351012.1 HLA class II histocompatibility antigen gamma chain isoform d [Homo sapiens] MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFS ILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMR MATPLLMQALPMGALPQGNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFE SWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM* (SEQ ID NO:18) >CD74-4 NP_001351013.1 HLA class II histocompatibility antigen gamma chain isoform e [Homo sapiens] MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFS ILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMR MATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLK GSFPENLRHLKNTMETIDWKSHWNWRTRLLGWV* (SEQ ID NO:19) >CD74-5 NP_004346.1 HLA class II histocompatibility antigen gamma chain isoform b [Homo sapiens] MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFS ILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMR MATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLK GSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLEL EDPSSGLGVTKQDLGPVPM* (SEQ ID NO:20) >CXCR7 NP_064707.1 atypical chemokine receptor 3 [Homo sapiens] MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVI GMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQW PMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCIL VWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFA VPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSIL HYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYS AKTGLTKLIDASRVSETEYSALEQSTK* (SEQ ID NO:21) >CXCR7 S335X MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVI GMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQW PMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCIL VWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFA VPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSIL HYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKY* (SEQ ID NO:22) In certain approaches any one of S335, T338, T341, S352, S355 and S350 can be mutated in CXCR7 to prevent or reduce degradation. CD74_1 NM_001025158.3 Homo sapiens CD74 molecule (CD74), transcript variant 3, mRNA ATCCTGCCCCGCAAAAGGCAGCTTCACCAAAGTGGGGTATTTCCAGCCTTTGT AGCTTTCACTTCCACATCTACCAAGTGGGCGGAGTGGCCTTCTGTGGACGAAT CAGATTCCTCTCCAGCACCGACTTTAAGAGGCGAGCCGGGGGGTCAGGGTCC CAGATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTC ATGGATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGG GCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACA CAGGCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCC TACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCC AGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCC TGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATG GGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGA CAGAGGACCATGTGATGCACCTGCTCCAGAGTCACTGGAACTGGAGGACCCG TCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAG AGCAGCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTT CTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCCTGTACCTCATCC CATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAA GTCGGAACAGCAGATAACAATGCAGCAAGGCCCTGCTGCCCAATCTCCATCT GTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCC CGTTCCTGACATCACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTCA TGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCC CAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTT CTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCCCTTTCCCCAGCATCAC TCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTA GTTCCCTCTGCTCAGCCAAGCTTGTTATCAGCTTTCAGGGCCATGGTTCACAT TAGAATAAAAGGTAGTAATTAGAA (SEQ ID NO:23) >CD74_2 NM_001025159.3:162-1052 Homo sapiens CD74 molecule (CD74), transcript variant 1, mRNA ATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATG GATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCC GGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAG GCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTAC TTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGA ACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGT GAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGA GCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAG AGGACCATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCC GCCACTGAAGGGGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATG GAGACCATAGACTGGAAGGTCTTTGAGAGCTGGATGCACCATTGGCTCCTGT TTGAAATGAGCAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCGAA AGTACTGACCAAGTGCCAGGAAGAGGTCAGCCACATCCCTGCTGTCCACCCG GGTTCATTCAGGCCCAAGTGCGACGAGAACGGCAACTATCTGCCACTCCAGT GCTATGGGAGCATCGGCTACTGCTGGTGTGTCTTCCCCAACGGCACGGAGGT CCCCAACACCAGAAGCCGCGGGCACCATAACTGCAGTGAGTCACTGGAACTG GAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCC CCATGTGA (SEQ ID NO:24) >CD74_3 NM_001364083.3:162-797 Homo sapiens CD74 molecule (CD74), transcript variant 4, mRNA ATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATG GATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCC GGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAG GCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTAC TTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGA ACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGT GAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGA GCCCTGCCCCAGGGGAATGCTGACCCCCTGAAGGTGTACCCGCCACTGAAGG GGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATGGAGACCATAG ACTGGAAGGTCTTTGAGAGCTGGATGCACCATTGGCTCCTGTTTGAAATGAG CAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCGAAAGAGTCACTG GAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCC CAGTCCCCATGTGA (SEQ ID NO:25) >CD74_4 NM_001364084.3:162-740 Homo sapiens CD74 molecule (CD74), transcript variant 5, mRNA ATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATG GATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCC GGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAG GCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTAC TTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGA ACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGT GAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGA GCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAG AGGACCATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCC GCCACTGAAGGGGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATG GAGACCATAGACTGGAAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCT GGGTGTGA (SEQ ID NO:26) >CD74_5 NM_004355.4:162-860 Homo sapiens CD74 molecule (CD74), transcript variant 2, mRNA ATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATG GATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCC GGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAG GCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTAC TTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGA ACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGT GAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGA GCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAG AGGACCATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCC GCCACTGAAGGGGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATG GAGACCATAGACTGGAAGGTCTTTGAGAGCTGGATGCACCATTGGCTCCTGT TTGAAATGAGCAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCGAA AGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAG GATCTGGGCCCAGTCCCCATGTGA (SEQ ID NO:27) >CXCR7 NM_020311.3:127-1215 Homo sapiens atypical chemokine receptor 3 (ACKR3), mRNA ATGGATCTGCATCTCTTCGACTACTCAGAGCCAGGGAACTTCTCGGACATCAG CTGGCCATGCAACAGCAGCGACTGCATCGTGGTGGACACGGTGATGTGTCCC AACATGCCCAACAAAAGCGTCCTGCTCTACACGCTCTCCTTCATTTACATTTT CATCTTCGTCATCGGCATGATTGCCAACTCCGTGGTGGTCTGGGTGAATATCC AGGCCAAGACCACAGGCTATGACACGCACTGCTACATCTTGAACCTGGCCAT TGCCGACCTGTGGGTTGTCCTCACCATCCCAGTCTGGGTGGTCAGTCTCGTGC AGCACAACCAGTGGCCCATGGGCGAGCTCACGTGCAAAGTCACACACCTCAT CTTCTCCATCAACCTCTTCGGCAGCATTTTCTTCCTCACGTGCATGAGCGTGG ACCGCTACCTCTCCATCACCTACTTCACCAACACCCCCAGCAGCAGGAAGAA GATGGTACGCCGTGTCGTCTGCATCCTGGTGTGGCTGCTGGCCTTCTGCGTGT CTCTGCCTGACACCTACTACCTGAAGACCGTCACGTCTGCGTCCAACAATGA GACCTACTGCCGGTCCTTCTACCCCGAGCACAGCATCAAGGAGTGGCTGATC GGCATGGAGCTGGTCTCCGTTGTCTTGGGCTTTGCCGTTCCCTTCTCCATTATC GCTGTCTTCTACTTCCTGCTGGCCAGAGCCATCTCGGCGTCCAGTGACCAGGA GAAGCACAGCAGCCGGAAGATCATCTTCTCCTACGTGGTGGTCTTCCTTGTCT GCTGGCTGCCCTACCACGTGGCGGTGCTGCTGGACATCTTCTCCATCCTG CACTACATCCCTTTCACCTGCCGGCTGGAGCACGCCCTCTTCACGGCCCTGCA TGTCACACAGTGCCTGTCGCTGGTGCACTGCTGCGTCAACCCTGTCCTCTACA GCTTCATCAATCGCAACTACAGGTACGAGCTGATGAAGGCCTTCATCTTCAA GTACTCGGCCAAAACAGGGCTCACCAAGCTCATCGATGCCTCCAGAGTCTCA GAGACGGAGTACTCTGCCTTGGAGCAGAGCACCAAATGA (SEQ ID NO:28) >CXCR7_S335X ATGGATCTGCATCTCTTCGACTACTCAGAGCCAGGGAACTTCTCGGACATCAG CTGGCCATGCAACAGCAGCGACTGCATCGTGGTGGACACGGTGATGTGTCCC AACATGCCCAACAAAAGCGTCCTGCTCTACACGCTCTCCTTCATTTACATTTT CATCTTCGTCATCGGCATGATTGCCAACTCCGTGGTGGTCTGGGTGAATATCC AGGCCAAGACCACAGGCTATGACACGCACTGCTACATCTTGAACCTGGCCAT TGCCGACCTGTGGGTTGTCCTCACCATCCCAGTCTGGGTGGTCAGTCTCGTGC AGCACAACCAGTGGCCCATGGGCGAGCTCACGTGCAAAGTCACACACCTCAT CTTCTCCATCAACCTCTTCGGCAGCATTTTCTTCCTCACGTGCATGAGCGTGG ACCGCTACCTCTCCATCACCTACTTCACCAACACCCCCAGCAGCAGGAAGAA GATGGTACGCCGTGTCGTCTGCATCCTGGTGTGGCTGCTGGCCTTCTGCGTGT CTCTGCCTGACACCTACTACCTGAAGACCGTCACGTCTGCGTCCAACAATGA GACCTACTGCCGGTCCTTCTACCCCGAGCACAGCATCAAGGAGTGGCTGATC GGCATGGAGCTGGTCTCCGTTGTCTTGGGCTTTGCCGTTCCCTTCTCCATTATC GCTGTCTTCTACTTCCTGCTGGCCAGAGCCATCTCGGCGTCCAGTGACCAGGA GAAGCACAGCAGCCGGAAGATCATCTTCTCCTACGTGGTGGTCTTCCTTGTCT GCTGGCTGCCCTACCACGTGGCGGTGCTGCTGGACATCTTCTCCATCCTGCAC TACATCCCTTTCACCTGCCGGCTGGAGCACGCCCTCTTCACGGCCCTGCATGT CACACAGTGCCTGTCGCTGGTGCACTGCTGCGTCAACCCTGTCCTCTACAGCT TCATCAATCGCAACTACAGGTACGAGCTGATGAAGGCCTTCATCTTCAAGTA CTGA (SEQ ID NO:29) >CXCR4_1 NM_001008540.2:297-1367 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 1, mRNA ATGTCCATTCCTTTGCCTCTTTTGCAGATATACACTTCAGATAACTACACCGA GGAAATGGGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAA GAAAATGCTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTT CTTAACTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAG AAGAAACTGAGAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCC GACCTCCTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAA CTGGTACTTTGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCA ACCTCTACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTG GCCATCGTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAA AGGTGGTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGAC TTCATCTTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTT CTACCCCAATGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTT GGCCTTATCCTGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCC AAGCTGTCACACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACA GTCATCCTCATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATC AGCATCGACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTT GAGAACACTGTGCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCA CTGTTGTCTGAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCT CTGCCCAGCACGCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCT CTCCAAAGGAAAGCGAGGTGGACATTCATCTGTTTCCACTGAGTCTGAGTCT TCAAGTTTTCACTCCAGCTAA (SEQ ID NO:30) >CXCR4-1_ NP_001008540.1 C-X-C chemokine receptor type 4 isoform a [Homo sapiens] MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIV GNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNF LCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWI PALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCY CIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENT VHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRG GHSSVSTESESSSFHSS* (SEQ ID NO:31) >CXCR4_2 NM_001348056.2:90-1361 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 3, mRNA ATGGAGGGGATCAGTGAAAATGCCCCGCTCCCTAACGTCCCAAACGCGCCAA GTGATAAACACGAGGATGGCAAGAGACCCACACACCGGAGGAGCGCCCGCT TGGGGGAGGAGGTGCCGTTTGTTCATTTTCTGACACTCCCGCCCAATATACCC CAAGCACCGAAGGGCCTTCGTTTTAAGACCGCATTCTCTTTACCCACTACAAG TTGCTTGAAGCCCAGAATGATATACACTTCAGATAACTACACCGAGGAAATG GGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATG CTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTG GCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACT GAGAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTC TTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTT TGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACA GCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATCGTC CACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCT ATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTG CCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAA TGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCC TGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCAC ACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCAT CCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACT CCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGT GCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGA ACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCAC GCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAA AGCGAGGTGGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAGTTTTCAC TCCAGCTAA (SEQ ID NO:32) >CXCR4_2 NP_001334985.1 C-X-C chemokine receptor type 4 isoform c [Homo sapiens] MEGISENAPLPNVPNAPSDKHEDGKRPTHRRSARLGEEVPFVHFLTLPPNIPQAPK GLRFKTAFSLPTTSCLKPRMIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIF LPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAV DAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLL AEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMV GLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFIL LEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRG SSLKILSKGKRGGHSSVSTESESSSFHSS* (SEQ ID NO:33) >CXCR4_3 NM_001348059.2:90-1247 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 4, mRNA ATGGAGGGGATCAGTGAAAATGCCCCGCTCCCTAACGTCCCAAACGCGCCAA GTGATAAACACGAGGATGGCAAGAGACCCACACACCGGAGGAGCGCCCGCT TGGGGGAGGAGATATACACTTCAGATAACTACACCGAGGAAATGGGCTCAG GGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAATTT CAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTGGCATTGT GGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGAAGC ATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTCTTTGTCAT CACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTTTGGGAACT TCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCAGTGTC CTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATCGTCCACGCCAC CAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATGTTGGC GTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTGCCAACGTC AGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGACTTGT GGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGCCTGGT ATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACACTCCAA GGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCTGGCT TTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACTCCTTCATC CTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGTGCACAAGT GGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGAACCCCATC CTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCACGCACTCAC CTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGGT GGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAGTTTTCACTCCAGCTA A (SEQ ID NO:34) >CXCR4_3 NP_001334988.1 C-X-C chemokine receptor type 4 isoform d [Homo sapiens] MEGISENAPLPNVPNAPSDKHEDGKRPTHRRSARLGEEIYTSDNYTEEMGSGDY DSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYR LHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISL DRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANV SEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQK RKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFF HCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSF HSS* (SEQ ID NO:35) >CXCR4_4 NM_001348060.2:372-1385 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 5, mRNA ATGGGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAA ATGCTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAA CTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAA ACTGAGAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTC CTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTA CTTTGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCT ACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATC GTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTG GTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATC TTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCC CAATGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTA TCCTGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGT CACACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCT CATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCG ACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACT GTGCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCT GAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGC ACGCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGG AAAGCGAGGTGGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAGTTTTC ACTCCAGCTAA (SEQ ID NO:36) >CXCR4_4 NP_001334989.1 C-X-C chemokine receptor type 4 isoform e [Homo sapiens] MGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRS MTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSV LILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEAD DRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKAL KTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCL NPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS* (SEQ ID NO:37) >CXCR4_5 NM_003467.3:90-1148 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 2, mRNA ATGGAGGGGATCAGTATATACACTTCAGATAACTACACCGAGGAAATGGGCT CAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAA TTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTGGCAT TGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGA AGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTCTTTG TCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTTTGGG AACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCA GTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATCGTCCAC GCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATG TTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTGCCA ACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGA CTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGC CTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACACT CCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCT GGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACTCCTT CATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGTGCAC AAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGAACCC CATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCACGCAC TCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCG AGGTGGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAGTTTTCACTCCA GCTAA (SEQ ID NO:38) >CXCR4_5 NP_003458.1 C-X-C chemokine receptor type 4 isoform b [Homo sapiens] MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNG LVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCK AVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPAL LLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIII SKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVH KWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGH SSVSTESESSSFHSS* (SEQ ID NO:39) >CXCR4_1 S338X NM_001008540.2:297-1367 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 1, mRNA ATGTCCATTCCTTTGCCTCTTTTGCAGATATACACTTCAGATAACTACACCGA GGAAATGGGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAA GAAAATGCTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTT CTTAACTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAG AAGAAACTGAGAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCC GACCTCCTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAA CTGGTACTTTGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCA ACCTCTACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTG GCCATCGTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAA AGGTGGTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGAC TTCATCTTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTT CTACCCCAATGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTT GGCCTTATCCTGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCC AAGCTGTCACACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACA GTCATCCTCATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATC AGCATCGACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTT CTGTTGTCTGAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCT CTGCCCAGCACGCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCT CTCCAAAGGAAAGCGAGGTGGACATTAA (SEQ ID NO:40) >CXCR4-1 S338X NP_001008540.1 C-X-C chemokine receptor type 4 isoform a [Homo sapiens] MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIV GNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNF LCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWI PALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCY CIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENT VHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRG GH* (SEQ ID NO:41) >CXCR4_2 S338X NM_001348056.2:90-1361 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 3, mRNA ATGGAGGGGATCAGTGAAAATGCCCCGCTCCCTAACGTCCCAAACGCGCCAA GTGATAAACACGAGGATGGCAAGAGACCCACACACCGGAGGAGCGCCCGCT TGGGGGAGGAGGTGCCGTTTGTTCATTTTCTGACACTCCCGCCCAATATACCC CAAGCACCGAAGGGCCTTCGTTTTAAGACCGCATTCTCTTTACCCACTACAAG TTGCTTGAAGCCCAGAATGATATACACTTCAGATAACTACACCGAGGAAATG GGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATG CTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTG GCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACT GAGAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTC TTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTT TGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACA GCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATCGTC CACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCT ATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTG CCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAA TGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCC TGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCAC ACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCAT CCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACT CCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGT GCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGA ACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCAC GCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAA AGCGAGGTGGACATTAA (SEQ ID NO:42) >CXCR4_2 S338X NP_001334985.1 C-X-C chemokine receptor type 4 isoform c [Homo sapiens] MEGISENAPLPNVPNAPSDKHEDGKRPTHRRSARLGEEVPFVHFLTLPPNIPQAPK GLRFKTAFSLPTTSCLKPRMIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIF LPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAV DAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLL AEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMV GLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFIL LEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRG SSLKILSKGKRGGH* (SEQ ID NO:43) >CXCR4_3 S338X NM_001348059.2:90-1247 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 4, mRNA ATGGAGGGGATCAGTGAAAATGCCCCGCTCCCTAACGTCCCAAACGCGCCAA GTGATAAACACGAGGATGGCAAGAGACCCACACACCGGAGGAGCGCCCGCT TGGGGGAGGAGATATACACTTCAGATAACTACACCGAGGAAATGGGCTCAG GGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAATTT CAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTGGCATTGT GGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGAAGC ATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTCTTTGTCAT CACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTTTGGGAACT TCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCAGTGTC CTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATCGTCCACGCCAC CAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATGTTGGC GTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTGCCAACGTC AGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGACTTGT GGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGCCTGGT ATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACACTCCAA GGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCTGGCT TTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACTCCTTCATC CTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGTGCACAAGT GGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGAACCCCATC CTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCACGCACTCAC CTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGGT GGACATTAA (SEQ ID NO:44) >CXCR4_3 S338X NP_001334988.1 C-X-C chemokine receptor type 4 isoform d [Homo sapiens] MEGISENAPLPNVPNAPSDKHEDGKRPTHRRSARLGEEIYTSDNYTEEMGSGDY DSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYR LHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISL DRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANV SEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQK RKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFF HCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGH* (SEQ ID NO:45) >CXCR4_4 S338X NM_001348060.2:372-1385 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 5, mRNA ATGGGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAA ATGCTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAA CTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAA ACTGAGAAGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTC CTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTA CTTTGGGAACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCT ACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATC GTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTG GTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATC TTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCC CAATGACTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTA TCCTGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGT CACACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCT CATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCG ACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACT GTGCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCT GAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGC ACGCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGG AAAGCGAGGTGGACATTAA (SEQ ID NO:46) >CXCR4_4 S338X NP_001334989.1 C-X-C chemokine receptor type 4 isoform e [Homo sapiens] MGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRS MTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSV LILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEAD DRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKAL KTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCL NPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGH* (SEQ ID NO:47) >CXCR4_5 S338X NM_003467.3:90-1148 Homo sapiens C-X-C motif chemokine receptor 4 (CXCR4), transcript variant 2, mRNA ATGGAGGGGATCAGTATATACACTTCAGATAACTACACCGAGGAAATGGGCT CAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAA TTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTGGCAT TGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGA AGCATGACGGACAAGTACAGGCTGCACCTGTCAGTGGCCGACCTCCTCTTTG TCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTTTGGG AACTTCCTATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCA GTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCATCGTCCAC GCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATG TTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTGCCA ACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGA CTTGTGGGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGC CTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACACT CCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCT GGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGGGATCAGCATCGACTCCTT CATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGTGCAC AAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTGTTGTCTGAACCC CATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCACGCAC TCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCG AGGTGGACATTAA (SEQ ID NO:48) >CXCR4_5 S338X NP_003458.1 C-X-C chemokine receptor type 4 isoform b [Homo sapiens] MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNG LVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCK AVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPAL LLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIII SKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVH KWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGH * (SEQ ID NO:49) >CD44_1 NM_000610.4:134-2362 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 1, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCAC TAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTG GTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAA CACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAA TGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGC ATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGC TTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCAT TCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACA GAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCC CCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGC ACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAG GAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAA GAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCC ATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTG ATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAG AAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAAT CCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGA CAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGA AGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAAT GATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTT TACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTT CATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTG TTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACA TTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGAC ACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAG GACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGG CTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAG AAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAG CCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGG TGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGAC AAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAA (SEQ ID NO:50) >CD44_1 NP_000601.3 CD44 antigen isoform 1 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT TLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGW EPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHS NPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQA TPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGR TTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDL DRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHS EGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGD QDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALAL ILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKE SSETPDQFMTADETRNLQNVDMKIGV* (SEQ ID NO:51) >CD44-2 NM_001001389.2:134-2233 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 2, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGTACGTCTTCAAA TACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGA CAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCT CCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCA GGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAG ACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAG GAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGA GGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGT ACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGG CATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGG ACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACAC CAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCC ATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCAT AGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATT TGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAG CTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACT TCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACC CAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTAC CCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTG GGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAAT CGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATA CCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGG AGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTG ATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCA GTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGT GGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCC AGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTC CAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACAT GAAGATTGGGGTGTAA (SEQ ID NO:52) >CD44_2 NP_001001389.1 CD44 antigen isoform 2 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT STSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQ DWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEE EETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAAS AHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPT ANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRND VTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDS NSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPE WLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEAS KSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV* (SEQ ID NO:53) >CD44_3 NM_001001390.2:134-1615 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 3, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAG TCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAA GATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTC AGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAAC AACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGA GACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCA TTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAG ACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGT CAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCC CATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAG GTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATG GCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCAT TGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAA CAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGA GGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAA ACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGG ACATGAAGATTGGGGTGTAA (SEQ ID NO:54) >CD44_3 NP_001001390.1 CD44 antigen isoform 3 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT NMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDH PTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTG SFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGAN TTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVED RKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV* (SEQ ID NO:55) CD44_4 NM_001001391.2:134-1219 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 4, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGAGACCAAGACAC ATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGA CACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAA GGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTG GCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCA GAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAA GCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTG GTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGA CAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAA (SEQ ID NO:56) >CD44_4 NP_001001391.1 CD44 antigen isoform 4 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT RDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLA LALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLV NKESSETPDQFMTADETRNLQNVDMKIGV* (SEQ ID NO:57) >CD44_5 NM_001001392.2:134-553 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 5, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGA GGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAAT GGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACA GCTGA (SEQ ID NO:58) >CD44_5 NP_001001392.1 CD44 antigen isoform 5 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCSLHCSQQSKKVWAEEKASDQQWQWSCGGQ KAKWTQRRGQQVSGNGAFGEQGVVRNSRPVYDS* (SEQ ID NO:59) >CD44_6 NM_001202555.2:134-1423 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 6, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATAGGAATGATGT CACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTG GAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCC CAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGA GATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCA CCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCA CATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACAC CCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTG ATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGA AAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAA GTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAA CAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGG AACCTGCAGAATGTGGACATGAAGATTGGGGTGTAA (SEQ ID NO:60) >CD44_6 NP_001189484.1 CD44 antigen isoform 6 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT NRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTP QIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNG EASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV* (SEQ ID NO:61) >CD44_7 NM_001202556.2:134-1156 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 7, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGACACTCACATGG GAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCA AATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCT TGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAA GCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGG ACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAG GAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACC TGCAGAATGTGGACATGAAGATTGGGGTGTAA (SEQ ID NO:62) >CD44_7 NP_001189485.1 CD44 antigen isoform 7 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT RHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKK LVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQN VDMKIGV* (SEQ ID NO:63) >CD44_8 NM_001202557.2:134-1018 Homo sapiens CD44 molecule (IN blood group) (CD44), transcript variant 8, mRNA ATGGACAAGTTTTGGTGGCACGCAGCCTGGGGACTCTGCCTCGTGCCGCTGA GCCTGGCGCAGATCGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCAC GTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCT GCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCT GAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTG ATTCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGT ACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCA GCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTG ATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTG ATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGG TTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTC CCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGAGACCAAGACAC ATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGA CACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAA GGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTG GCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGTTGA (SEQ ID NO:64) >CD44_8 NP_001189486.1 CD44 antigen isoform 8 precursor [Homo sapiens] MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLC KAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTS NTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTN PEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPAT RDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLA LALILAVCIAVNSRRS* (SEQ ID NO:65) Other therapeutic agents include shRNA for reducing expression of MIF, HMGB1 and CXCL12 available from Sigma Aldrich. MIF TRCN0000056818 TRCN0000056819 TRCN0000056820 TRCN0000056821 TRCN0000056822 HMGB1 TRCN0000018930 TRCN0000018932 TRCN0000018933 TRCN0000018934 TRCN0000109040 CXCL12 TRCN0000262665 TRCN0000262666 TRCN0000262667 TRCN0000262668 TRCN0000262669 CXCL12a ATGAACGCCAAGGTGGTGGTCGTTCTGGTGCTCGTGCTGACAGCCCTGTGCCTGTCT GATGGCAAACCTGTGTCCCTGAGCTACCGGTGCCCATGTAGATTCTTCGAGAGCCAC GTGGCTCGGGCCAACGTGAAGCACCTGAAGATCCTGAATACCCCTAACTGCGCCCT GCAGATCGTGGCTAGACTGAAGAACAACAATAGACAGGTGTGCATCGACCCCAAGC TGAAATGGATCCAGGAGTACCTGGAAAAGGCCCTGAACAAGTGA (SEQ ID NO: 12) >MIF ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTC CTCTCCGAGCTCACCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACAT CGCGGTGCACGTGGTCCCGGACCAGCTCATGGCCTTCGGCGGCTCCAGCGAGCCGT GCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGCGCGCAGAACCGCTCC TACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACAG GGTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCA CCTTCGCCTAA (SEQ ID NO: 13) >HMGB1 ATGGGCAAGGGAGATCCTAAGAAGCCTAGAGGCAAAATGTCTAGCTACGCCTTTTT CGTGCAGACCTGTAGAGAAGAGCACAAGAAAAAGCACCCAGATGCCAGCGTGAAC TTCTCCGAGTTCAGCAAGAAATGCTCTGAGCGGTGGAAGACCATGTCCGCCAAGGA AAAGGGCAAGTTCGAGGACATGGCCAAGGCCGACAAGGCCAGATACGAGAGAGAG ATGAAGACATACATCCCCCCCAAGGGAGAGACAAAGAAAAAGTTTAAGGACCCTAA TGCCCCTAAGCGGCCTCCAAGCGCCTTCTTCCTGTTCTGCAGCGAGTACAGACCTAA GATCAAGGGAGAACACCCCGGCCTGAGCATCGGCGACGTGGCCAAAAAGCTGGGC GAGATGTGGAACAACACCGCCGCTGATGACAAGCAGCCTTACGAGAAGAAGGCTGC TAAACTGAAGGAAAAGTACGAAAAAGACATCGCCGCTTATCGGGCCAAGGGCAAGC CCGACGCCGCCAAGAAGGGCGTGGTGAAGGCCGAGAAAAGCAAGAAGAAAAAAGA AGAGGAAGAGGACGAGGAGGACGAAGAGGATGAGGAAGAGGAAGAGGATGAGGA AGACGAGGACGAGGAAGAAGATGATGACGACGAGTGA (SEQ ID NO: 14) >IGK_HMGB1 ATGGAAACCGACACCCTGCTGCTGTGGGTGCTGCTGCTCTGGGTCCCTGGCAGCACA GGCGACATGGGCAAGGGAGATCCTAAGAAGCCTAGAGGCAAAATGTCTAGCTACGC CTTTTTCGTGCAGACCTGTAGAGAAGAGCACAAGAAAAAGCACCCAGATGCCAGCG TGAACTTCTCCGAGTTCAGCAAGAAATGCTCTGAGCGGTGGAAGACCATGTCCGCCA AGGAAAAGGGCAAGTTCGAGGACATGGCCAAGGCCGACAAGGCCAGATACGAGAG AGAGATGAAGACATACATCCCCCCCAAGGGAGAGACAAAGAAAAAGTTTAAGGAC CCTAATGCCCCTAAGCGGCCTCCAAGCGCCTTCTTCCTGTTCTGCAGCGAGTACAGA CCTAAGATCAAGGGAGAACACCCCGGCCTGAGCATCGGCGACGTGGCCAAAAAGCT GGGCGAGATGTGGAACAACACCGCCGCTGATGACAAGCAGCCTTACGAGAAGAAG GCTGCTAAACTGAAGGAAAAGTACGAAAAAGACATCGCCGCTTATCGGGCCAAGGG CAAGCCCGACGCCGCCAAGAAGGGCGTGGTGAAGGCCGAGAAAAGCAAGAAGAAA AAAGAAGAGGAAGAGGACGAGGAGGACGAAGAGGATGAGGAAGAGGAAGAGGAT GAGGAAGACGAGGACGAGGAAGAAGATGATGACGACGAGTGA (SEQ ID NO: 15) E13.5 Slice Migration Analysis Coronal telencephalic slices (250 mm) were prepared as described previously (Anderson et al., 2001) and maintained in neurobasal medium / B27 with 5 ng / ml FGF2 (Promega). hESC- derived NKX2.1::GFP+ cells were isolated by FACS and carefully injected (5,000 cells) into the periventricular region of the MGE using an oocyte microinjector (Nanoject II; Drummond Scientific). After 2–6 days, cultures were fixed and immunostained. For cell counting, zone 1 was defined as the region from the ventricular zone of the lateral ganglionic eminence extending to the pallial-subpallial border, and zone 2 was defined as the region from the lateral cortex through the neocortex to the cortical hem. In an alternative approach, beads loaded with recombinant ligand can be placed on brain slices of day 13.5-day old mouse embryos of the Lhx6-GFP reporter strain (Tg(Lhx6- EGFP)BP331Gsat)48to determine if they attract MIPs. MIPs are GFP positive (Lhx6 promotor expression). Briefly, Coronal telencephalic slices (250 mm) were prepared as described previously (Anderson et al., 2001) and maintained in neurobasal medium / B27 with 5 ng / ml FGF2 (Promega). Beads loaded with BSA or recombinant ligand are placed at specific locations on the section for 12h. Migration of green MIPs is analyzed under a fluorescent dissection microscope (3 embryos per ligand). This is a classic way to prove that a specific ligand is a chemoattractant for MIP48. Example is shown in Figure 5. Mouse and Human Cortical Culture Preparation The cortical feeder cultures were prepared by dissociating dorsal cortices from 250mm coronal slices of E13.5 mouse brain and cultured as described previously (Xu et al., 2010). For human cortical feeder preparation, cells were subjected to XLSB-mediated neural induction in the presence of cylcopamine and purified for CD24+ / CD44- / CD184+ at day 32. Immunocytochemical Analyses Cultures were fixed in 4%paraformaldehyde and processed for immunocytochemistry. Secondary antibodies were species-specific Alexa-dye conjugates (Invitrogen). For the automated quantification (Operetta, PerkinElmer). Transplantation Studies Transplantation into the neonatal cortex of NOD-SCID IL2RG- / -mice was conducted as described previously (Wonders et al., 2008). Adult mice were also transplanted as well. In brief, 50-200 x 103cells were injected at following coordinates from bregma (2.0mm A, 2.5mm L, 1.0mm D), targeting cortical layers 3–6. All animal experiments were carried out in accordance with institutional and National Institutes of Health guidelines. Construction of BiTEs. The Anti-EGFR.BiTE and anti-CD19.BiTE were synthesized and cloned into a third- generation lentiviral plasmid backbone under the regulation of the CAG promotor. BiTEs were designed against wild-type EGFR and CD19 with both sequences flanked by an Igκ leader peptide and a His-tag element (Figure 7). Individual anti-EGFR and anti-CD3 scFv sequences were as previously described. The sequences of CD19 BiTE including the anti-CD3 scFv, as well as the anti-EGFR scFv, were obtained from publicly available sequences for blinatumomab and cetuximab, respectively. Ribosomal skip sites were incorporated at appropriate locations. All constructs also contained a transgene coding for puromycin to aid in the evaluation of transduction efficiency and selection of transduced cells. In vitro assays 1) Migration assays: MIPs 5000 RFP+ brain tumor cells are plated in 100ul (N2AA media, see MIP differentiation protocol) in a low attachment round bottom well plate (MS-9096UZ), are spun down 5min at 150g and are allowed to form a sphere overnight. Subsequently, 50k MIPs are overlayed on top of the brain tumor sphere mixed in 50% Matrigel. MIP migration to the brain tumor sphere is tracked using the Incucyte live imager over 3-7 days. Everything is repeated in triplicate. This protocol is reminiscent of the spheroid invasion assay of the incucyte (see attached PDF). 2) In vitro killing assays: Depending on the growth properties of our cells, we use either a spheroid or a 2D monolayer. 2D monolayer: Brain tumor cells (10,000 cells, expressing nuclear RFP) are plated in their specific brain tumor media together with bispecific engager expressing MIPs (2,000 cells, targeting or control engager) in triplicate. The following day 50k T-cells are added and each well is imaged every 8h. The number of brain tumor cells is counted (2D assay) using the Incucyte software. Spheroid: Brain tumor cells (10,000 cells, expressing nuclear RFP) are plated in their specific brain tumor media together with bispecific engager expressing MIPs (2,000 cells, targeting or control engager) in triplicate in round bottom well plates (MS-9096UZ), are spun down 5min at 150g and are allowed to form a sphere overnight. The following day 50k T-cells are added and each well is imaged every 8h. The number of brain tumor cells is inferred by the strength of the RFP signal using the Incucyte software. T-cells were obtained from the Penn Immunology Core. 3) Transwell migration assay: 20k interneurons are plated in the top well of a transwell migration plate (Sartorius, 4582) coated with growth factor depleted Matrigel (1 / 50 dilution for 3h), chemokines or conditioned media is added 24h post plating and transwell migration is determined 3-5 days later using the Incucyte Live Imager. Conditioned media is generated by incubating 2 million cells in interneuron media for 48h. In vivo mouse assays 1) Migration assays: Eight to 10-week-old Nu / J mice were anesthetized with 2.5% isoflurane, placed into the stereotactic frame, then injected sequentially with 500,000 tumor cells. Tumors were allowed to establish for 2 weeks, then mice underwent a second surgical procedure with stereotactic injection of 200,000 MIPs a total of 2 mm apart from initial injection site. One to two weeks later the animals are sacrificed and stained for MIP markers (GFP or NCAM) to assess how well the MIPs migrated to the tumor. 2) In vivo killing assays: a) co-injection of MIPs, tumor cells and T-cells: Eight to 10-week-old Nu / J mice were anesthetized with 2.5% isoflurane, placed into the stereotactic frame, then injected with 500,000 brain tumor cells, of 200,000 MIPs and 2 million activated T-cells in a single location. Mice were aged to determine differential survival and imaged using the IVIS imager. T-cells were obtained from the Penn immunology core and activated using standard protocols (found on the world wide web at thermofisher.com / order / catalog / product / 11161D). b) co-injection of MIPs and tumor cells; repeated T-cells administered through cannula: Eight to 10-week-old Nu / J mice were anesthetized with 2.5% isoflurane, placed into the stereotactic frame, then injected with 500,000 brain tumor cells and of 200,000 MIPs. Two weeks later, after a tumor has been established, a cannula is placed in the ventricles of the brain. T-cells are subsequently infused once weekly for 4 weeks total. Survival of the mice is monitored and plotted. T-cells were obtained from the Penn immunology core and activated using standard protocols (found on the world wide web at thermofisher.com / order / catalog / product / 11161D). c) Injection of MIPs and tumor cells at 2mm distance; T-cells administered through cannula: Eight to 10-week-old Nu / J mice were anesthetized with 2.5% isoflurane, placed into the stereotactic frame, then injected sequentially with 500,000 brain tumor cells and of 200,000 MIPs 2 mm apart from initial injection site. Two weeks later a cannula is placed in the ventricles of the brain. T-cells are subsequently infused once weekly for 4 weeks total. Survival of the mice is monitored and plotted. T-cells were obtained from the Penn immunology core and activated using standard protocols (found on the world wide web at thermofisher.com / order / catalog / product / 11161D). Patient selection and biomarkers 1) CXCR4 is one of the most important receptors for MIP migration. Multiple CXCR4 ligands are expressed in brain tumors. The methods described below can be used to advantage to identify ligands which are most effective at modulating migration and cell killing. Identification of pro-migratory ligands / biomarkers expressed in brain tumors. a) In vitro by western blot: MIPs are growth factor starved for 8h and subsequently treated with recombinant ligand (MIF, CXCL12, HMGB1). MIPs are harvested 0, 5, 15 and 60 minutes post exposure. CXCR4 pathway activation is then evaluated by western blot using pERK antibodies (assessing RAS-MAPK pathway activation) b) In vitro migration assay: MIF, CXCL12 and HMGB1 can be knocked down using siRNAs (standard protocol: found on the world wide web at thermofisher.com / us / en / home / life- science / cell-culture / transfection / transfection-reagents / lipofectamine-rnaimax-reagent.html) in brain tumor cells. MIF, CXCL12 and / or HMGB1 can also be overexpressed in in brain tumor cells lacking expression of these ligands and migration (LN319) using suitable nucleic acid constructs (e.g., lentiviral or AAV expression vectors). Migration capacity in these modified brain tumor cells can then be assessed in the migration assay described. c) In vivo migration assay: Cell with knocked down / knocked out of MIF, CXCL12 or HMGB1 (shRNAs or CRISPR) will be used in our in vivo migration assay described herein. 2) Patient selection: Biomarkers so identified can be used to select patient. For example, if MIF is identified as a marker, MIF levels in blood should correlate with expression levels of MIF in the tumor. Patients can then be selected using a simple test. In other approaches, certain ligands to be detected may require biopsy of the tumor. Differentiation protocol to MIPs Following generation of stem cells expressing the desired transgenes, the transformed cells can then be differentiated to MIPs. See Xu et al. Neuron 65, 328–340, (2010), Zhu et al., Neuron 111, 1–17, (2023) and US Patent applications 17 / 280,225 and 14 / 922,110, each being incorporated by reference herein as though set forth in full. In certain approaches, the MIPs can be coated with ferrofluid particles to facilitate imaging during MRI. The skilled person is aware of the many protocols suitable for generation of interneurons. An exemplary protocol is adapted from Ni et al 2019, Molecular Psychiatry & Ni et al 2019, Molecular Therapy: Methods. Day 0 (anytime after thawing of cell stock, but before differentiation): Matrigel-coated plates • StemMACS media (Miltenyl) • 10 µM Y27632 ROCK inhibitor (ApexBio) Day 1: Low-adherence culture flasks / dishes • SRM media o DMEM (Invitrogen) o 15% knockout serum replacement (Invitrogen) o 2 mM L-glutamine Compound Stock Volume (per 10 mL) Final Concentration Y27632 ROCK 10 mM 10 µL 10 µM inhibitor y • SRM media: o DMEM (Invitrogen) o 15% knockout serum replacement (Invitrogen) o 2 mM L-glutamine Compound Stock Volume (per 10 mL) Final Concentration Days 8-14: Low-adherence culture flasks / dishes • SRM media o DMEM (Invitrogen) o 15% knockout serum replacement (Invitrogen) o 2 mM L-glutamine Compound Stock Volume (per 10 mL) Final Concentration Days 15-21: Low-adherence culture flasks / dishes • N2AA SAG8 media o DMEM / F12 media o 0.5% N2 supplement o 200 µM AA-ascorbic acid Compound Stock Volume (per 10 mL) Final Concentration SAG 1 mM 1 L 01 M er wee s o n uc on ( ), mos o e ce s a op a p eno ype, a w c point they will spontaneously differentiate and generate post-mitotic interneurons. Therefore, the protocol recommends withdrawing all morphogenic signaling molecules from the culture starting on D22. Plating: Matrigel -coated dishes Starting at Day 22, can use the following procedure to passage cells: 1. Dissociate interneuron spheres in 0.05% trypsin + 100 mM trehalose 2. Incubate for 5 min at 37°C, then triturate to fully dissociate the spheres 3. Add equal volume of N2AA media with 0.1 µM SAG and 10% FBS to neutralize Trypsin, supplemented with Turbo DNase o (for 2 U / mL concentration, add 1 µL of DNase per mL of media) 4. Incubate for 15 min at 37°C, then filter cells through a 40 µM nylon mesh cell strainer cap to remove a dead cell cluster Day 22-44: Starting at Day 23, replace half of the media in each well with the N2AA GB media (see recipe below), supplemented with the preferred cocktail of cell cycle inhibitors (DAPT, PD 0332991 After Day 27, can just aspirate and replace the media entirely. • N2AA GB media o DMEM / F12 media o 0.5% N2 supplement o 200 µM AA-ascorbic acid Compound Stock Volume (per 10 mL) Final Concentration Transport: 1. Cells prepared in N2AA Media ~5mls in 15 ml conical tube 2. Cells stored and transport cells on ice Transplantation Protocol 1. Spin at 150g for 5 minutes 2. Resuspend cells in 1 mL N2AA media for counting by flicking bottom of tube then count cells on Luna cell counter. For injections, cells are suspended at appropriate volume either in combination with T- cells and tumor cells for the triple injections, or at 100k cells per uL in N2AA media. 3. Cells are maintained on ice and then injected using Hamilton syringe with beveled edge cortically. Injection proceeds slowly over 2 minutes and then an additional 1-2 minutes are spent allowing the cells to settle prior to withdrawal of the needle. Cells are flicked in the tube to mix prior to each injection. 4. Inject cells at 100K cells per microliter. Delivery of MIP and T cells to the brain For safe and effective delivery of the components of the brain cancer cell killing agents described here in humans, the Clear Point® Neuro Navigation platform can be used. The ClearPoint® Neuro platform enables stereotactic navigation and delivery to the brain. Applications include, without limitation, electrode insertion, placement of laser catheters, biopsy, and delivery of approved therapeutics in the brain, including biosimilars, gene and stem cell therapies. T-cells or MIPs can also be administered with repeated dosing though an Ommaya Reservoir directly into the ventricles of the brain. An ommaya reservoir is in essence a catheter connected to a soft plastic dome-shaped reservoir. The catheter is placed in the ventricles of the brain, the reservoir is placed under the skin on top of the skull. Different agents can be delivered to the ventricles via injection into the reservoir. The following examples are provided to illustrate certain embodiments of the invention. They are not intended to limit the invention in any way. Example I The present inventors have discovered that MIPs migrate to glioblastoma tumors both in vitro and in vivo. Moreover, we have shown that MIPs are able to express and secrete bispecific engagers that activate the local immune system to eliminate glioblastoma. Our data show that EGFR is a potential epitope to target glioblastoma. Connecting MIP chemoattraction to Glioblastoma invasiveness One of the major chemoattractants for MIPs is CXCL12 (stromal derived factor 1; SDF1)20,21, which activates the CXCR4 and the CXCR7 signaling pathway (Fig 1A)22. Intriguingly, expression of CXCL12 enhances the invasiveness of many glioblastomas23,24by activating CXCR4 on the vascular endothelium and microglia / macrophages. The present inventors, experts in interneuron development, and glioblastoma treatment, realized that MIPs transplanted into the vicinity of those CXCL12-expressing glioblastomas should migrate to the tumor. Thus, MIP could be used to advantage as a therapeutic delivery vehicle for cytotoxic agents for the killing of glioblastoma and other brain cancer cells. Intriguingly, besides CXCL12, a large percentage of glioblastoma also highly express the CXCR4 and CXCR7 ligands HMGB125and MIF26(Fig 1B). HMGB1 can also bind with CXCL12 to CXCR4 and CXCR7, additionally it has been reported that MIF needs the presence of the CD74 receptor to bind CXCR4 or CXCR4. MIF also binds the CD44 / CD74 complex. Many low-grade gliomas and brain metastases also secrete CXCL12, HMGB1 and MIF (FIGS. 1C, 1D). MIP delivery of Bispecific Engagers to induce an anti-tumor response by engaging the local immune system: The most well-known class of bispecific engagers are BiTEs, or Bispecific T-cell Engagers. BiTEs are bispecific monoclonal antibodies where the single-chain variable fragment27(scFv) of an anti-CD3 antibody is bound to the scFv of a targeting antibody28,29, in essence creating an adaptor linking T-cells to a tumor antigen of choice29,30(Fig 2A,B). This engagement induces an immune response against the bound tumor cell. Without the BiTE, the T- cell does not recognize nor respond to cells expressing the target. BiTEs have a short half-life; hence, they will only engage with local T-cells at the BiTE production site. This allows for use of BiTEs to target antigens that are not unique to the tumor yet still retain a low toxicity profile as was for shown for an EGFR-BiTE31. Importantly, multiple BiTE clinical trials are ongoing, and the FDA has approved Blinatumomab, a CD33-BiTE used for refractory or recurrent B-ALL and teclistamab-cqyv, a B-cell maturation antigen directed BiTE for adult relapsed or refractory multiple myeloma. Of note, an scFv based on the Cetuximab anti-EGFR antibody was tested as described herein. (SEQ ID NO: 1) – EGFR-BiTE DILLTQSPVILSVSPGERVSFSCRASQSI GTNIHWYQQRTNGSPRLLIKYASESISGI PSRFS GSGSGTDFTLSINSVESEDIADYY CQQNNNWPTTFGAGTKLELKGGGGSGGGG SGGGG SQVQLKQSGPGLVQPSQSLSITCT VSGFSLTNYGVHWVRQSPGKGLEWLGVIW SGGNT DYNTPFTSRLSINKDNSKSQVFFK MNSLQSNDTAIYYCARALTYYDYEFAYWG QGTLV TVSAGGGGSDIKLQQSGAELARPG ASVKMSCKTSGYTFTRYTMHWVKQRPGQG LEWI GYINPSRGYTNYNQKFKDKATLTTD KSSSTAYMQLSSLTSEDSAVYYCARYYDD HYC LDYWGQGTTLTVSSVEGGSGGSGGSG GSGGVDDIQLTQSPAIMSASPGEKVTMTC RAS SSVSYMNWYQQKSGTSPKRWIYDTSK VASGVPYRFSGSGSGTSYSLTISSMEAED AAT YYCQQWSSNPLTFGAGTKLELK The MIP therapy described in the present examples form part of a broader tumor resection strategy. Complete surgical removal of glioblastoma is often impossible. Due to the extreme migratory nature of glioblastoma, tumor cells often remain in the margin of the resected cavity. MIPs can migrate to small clusters of tumor cells and are thus ideally suited to target and eradicate those small lesions post-surgery. Modified MIPs, differentiated from patient or donor or “off-the-shelf” iPSCs available from commercial sources, can be injected into the margin of the surgical cavity to clear residual tumor cells. “Off-the-shelf” cells have been suggested for use in CAR-T cellular therapy34as well. In the experiments described here, we employ embryonic stem cell (ES) derived MIP. However, in the clinic, MIPs can be derived from the donor, ES cells or iPSCs. iPSC and ES derived MIPs have similar migratory capacities. Several iPSC based cellular therapies are currently in clinical trials. In certain approaches HLA-matched MIPs will be employed. We can also test non- HLA- matched MIPs to determine if HLA matching is necessary. A kill switch can also be engineered into the MIPs to minimize undesirable adverse effects. In the present example, the non-unique tumor antigen EGFR is targeted for our bispecific engager experiments. We chose EGFR because our strong preliminary data demonstrates that MIP mediated delivery of EGFR-BiTE efficiently eliminates glioblastoma, and because local secretion of BiTEs targeting non-unique tumor antigens has been shown to have limited toxicity31. BiTEs can also be created with target validated, unique glioblastoma antigens, including for example EGFR vIII, IL13RA2, HER2, EpCAM, and GD2. Cellular therapies, like CAR-T therapy, have revolutionized treatment for a number of cancers. Unfortunately, these therapies have so far shown limited efficacy for brain tumors, in part due to the lack of unique tumor antigens and an immune suppressive microenvironment8,35. However, any cell that can migrate to a tumor and deliver a cytotoxic response is a potentially viable cellular therapy. Therefore, to bypass the brain tumor CAR-T obstacles, we have developed a cellular delivery system derived from MIPs, where injected cells are chemoattracted to the tumor, independent of unique tumor antigens or TME. We can engineer these MIPs to deliver a cytotoxic agent at the margin of brain tumors. MIPs are post-mitotic neural precursors capable of long-distance migration in the embryonic human brain via chemo-attractants such as CXCL1220,21. Interestingly, a substantial number of pediatric and adult glioblastoma express high levels of CXCL12 (34%, defined as expression higher than the 95% confidence interval of CXCL12 expression in normal cortex, Fig 1B). Crucially, we have shown that MIPs indeed migrate to the majority of glioblastoma (5 / 7 cell lines evaluated) both in vitro and in vivo (2 / 3 lines evaluated), indicating that other chemoattractants are likely driving MIP guidance as well. Moreover, if we equip these MIPs with anti-tumor agents and co-inject them with glioblastoma cells in the brains of mice, we are able to significantly delay glioblastoma onset (Fig 4D, E). These observations should enable elucidation of the role of key drivers in MIP migration / guidance in order to define a target patient population, engineer suitable MIPs to improve migration, thereby treating glioblastoma for example, by activating tumor directed T- cell killing with bispecific engagers. The data implicate MIPs as a viable cellular therapy for brain cancer, particularly glioblastoma, and independently, that we can engage resident or supplied T-cells to clear brain cancer. Additionally, our investigation sheds light on new chemoattractants that also play a role in MIP migration during embryonal brain development. The development of MIPs as cellular therapies for brain tumors: Even though MIPs are currently in clinical trials for the treatment of epilepsy, the use of MIPs as delivery vector for anti-tumor agents has not yet been explored. Notably, MIPs can be equipped with a range of anti-tumor agents beyond the ones suggested in this proposal. These include, without limitation, BiTEs targeting EGFR, EGFRvIII, HER2, GD2, EpCAM, B7H3, TME modulating agents (IL6, IL1β, CSF2, IFNγ, TNFα,), markers that enhance tumor detection, e.g., fluorescent markers) and other peptides like the CXCR4 blocking peptide or other therapeutic agents. The data below demonstrate that we can treat glioblastoma via MIPs delivery of agents that engage the local immune system. Indeed, MIPs migrate to glioblastoma both in vitro and in vivo and exposure of EGFR-BiTE expressing MIPs and CD8+ T cells, significantly delays glioblastoma onset in mice. Pediatric and adult Glioblastoma Cell Lines: 9 pediatric HGG glioma stem cell lines (7316-24, 7316-195, 7316-913, 7316-1746, 7316-1763, 7316-1769, 7316-6349, 7316-5335 and 7316-3058) and 4 adult glioblastoma lines (TM31HGG, LN229, LN319 and U87). were employed in this study. Our pediatric lines were derived from hemispheric, midline and cerebellar pediatric glioblastoma and were acquired from and fully characterized by the Children’s Brain Tumor Network (mutation and gene expression profiles)39. These pediatric HGG lines are glioma stem cell lines, which more accurately represent human disease than their serum-grown counterparts. All but one these lines (7316-1746) naturally grow as spheres. We have modified these lines to express nuclear RFP, which allows us to monitor proliferation and survival using the Incucyte live imaging system. Our adult cell lines are well established and frequently cited in glioblastoma research40,41. Three (LN229, LN319 and U87) are grown in serum-containing media and form a monolayer, TM31HGG is grown in glioma stem cell media. Luciferase is expressed in the 5 lines (1746, 3058, LN229, LN319 and U87) that form tumors in vivo, allowing for live imaging. Lung and breast cancer cell lines: The lung and breast cancer cell lines HCC1395, BT549 and HCC1806 (all grown as a monolayer in RPMI + 10% FBS + 1% Pen / Strep + 1X glutaMAX) will be used for evaluation of metastatic brain tumors. Migratory Interneuron Precursor cells derived from an LHX6-citrine human ES line: The present study assesses MIP differentiated from human ES lines (WA09 line: NIH approved and HES3 line) and from mouse MIPs harvested from 13.5-day old embryos. For human use, MIPs differentiated from the NIH approved human ES line WA09 or iPSCs will be employed. A major subgroup of MIPs express LHX6 after cell cycle exit42. Therefore, the LHX6 locus was targeted in human (WA09) ES cells by the Anderson lab (and others) to express fluorescent Citrine (close to GFP in wavelength and recognized by a GFP antibody). During the MIP differentiation process cells turn on Citrine43,44(Fig 3A-C). This Citrine marker is a marker employed in the lab and will not be engineered into MIPs that will be given to patients, we can use NCAM to positively identify MIP identity. The MIP differentiation process yields MIPs between days 24 and 40 post differentiation start45. MIPs can be flow sorted using the Citrine marker which also allows us to identify the MIP in in vivo assays by immunohistochemical staining. Although iPSC derived MIPs will be preferred for use in a clinical setting, WA09 ES cell line derived MIPs were utilized herein, since both migrate and differentiate similarly. It is crucial to note that MIPs are post-mitotic precursor cells and will not proliferate once injected into the brain. Figure 3D shows staining of MIPs with neuronal markers MAP2 and SOX6. Incucyte Live Imaging System: In vitro live imaging was performed using the Incucyte® S3 Live-Cell imager (Essen bioscience), a fluorescence microscope embedded in the incubator, that images each well of a plate with high frequency (every 1-8 hours). This frequent imaging gives us high-quality data and the ability to track MIP migration or glioblastoma killing46. In killing assays, we use the analysis software to identify and count the number of individual cells present in each well (the number of RFP+ nuclei) in 2D assays or infer the number of cells by tracking the total RFP signal in spheroid assays46. The (inferred) number of cells is graphed over time. We also use the Incucyte for our transwell migration assays. MIPs potently migrate to glioblastoma in vitro: MIPs harvested from both mouse embryonic brains and MIPs differentiated from human ES cells potently migrate to glioblastoma spheres in our spheroid migration assay (Fig 3E). Briefly, 5000 RFP+ glioblastoma cells are plated in a round bottom well plate and are allowed to form a sphere overnight. Subsequently, 50k MIPs (green) are overlayed on top of the glioblastoma sphere mixed in 50% Matrigel. MIP migration to the glioblastoma sphere is tracked using the Incucyte live imager over 3-7 days (Fig 3F). MIPs migrate to the majority of glioblastoma cell lines (5 / 7) evaluated (robust migration: 1746, LN229, U87; moderate migration: 1763, 3058; no / limited migration: 1769, LN319). Of these only LN229 and U87 express high levels of CXCL12, suggesting that other chemokines contribute as well. In a transwell migration assay MIPs potently and significantly migrate to 8 / 13 conditioned high grade glioma medias evaluated (defined as >4x migration versus control), where 20k cells were plated in the top well of a transwell migration plate coated with a 1 / 50 dilution of growth factor depleted Matrigel. (Fig 3F). MIPs potently migrate to glioblastoma in vivo: Crucially, our data also shows that MIPs, derived from mouse embryonic brains or differentiated from human ES cells, transplanted in the forebrain, robustly and aggressively migrate to the margin of glioblastoma within 14 days (FIGS. 3G, 3H). Tantalizingly, MIPs also wrap around micro-lesions, underscoring the sensitivity and specificity of the MIP migration process (FIG. 3G). The ability of MIPs to hone into patches of glioblastoma cells that migrated away from the main tumor should enhance cell killing for the successful treatment of glioblastoma in the clinic. Briefly, to standardize our in vivo migration assay we inject the MIPs 2mm from the glioblastoma injection site in the cortex and allow the MIPs to migrate for 2 weeks before sacrificing the animals and evaluating if MIPs (green) reached the glioblastoma tumor site. Importantly, 2 / 3 glioblastoma cell lines evaluated in vivo indeed attracted MIPs (1746, U87, not LN229). EGFR-BiTEs potently kill glioblastoma in vitro: Depending on the growth properties of our cells, we use either a spheroid or a 2D monolayer Incucyte killing assay. Glioblastoma cells (10,000 cells, expressing nuclear RFP) are plated together with bispecific engager expressing cells (2,000 cells, targeting or control engager) in triplicate. The following day 50k T-cells are added and each well is imaged every 8h. The number of glioblastoma cells is counted (2D assay) or inferred (spheroid assay) using the Incucyte software. The bispecific engagers were assessed in a 2-stage process, where our engagers are initially expressed in easy to manipulate 293T cells, which allows us to quickly assess the engager’s ability to eliminate glioblastoma in vitro. When successful glioblastoma killing is observed, we repeat our killing assay with bispecific engager expressing MIPs. Bispecific engager MIP cells are generated by infecting our LHX6 ES line with lentivirus, delivering the bispecific engager under a CAG promotor, selecting transduced cells with puromycin and subsequently differentiating these ES cells to MIPs. Figure 4A and B shows representative images of potent EGFR-BiTE induced killing of glioblastoma cell lines. Importantly, 4 / 7 cell lines show very potent EGFR-BiTE induced killing, 2 / 7 show moderate killing, and line 1 / 7 showed no killing. EGFR-BiTEs potently kill glioblastoma in vivo: In in vivo preclinical experiments, glioblastoma cells are injected into the cortex of immunocompromised mice (Nu / J). The tumor is allowed to establish, and interneurons are injected at 2mm distance from the tumor margin. Subsequently, a canula is implanted into the ventricles, and repeated T-cell dosing (weekly) 2 weeks post interneuron injection is performed. Because this ideal experiment requires several surgeries in a short timeframe, we opted to start with a small proof of concept experiment where all 3 cell types were co-injected into a single location (500k glioblastoma cells, 100k MIPs and 106CD8 T-cells) in a number of mice (3 per treatment arm). Human CD8-T cells were acquired from the Penn Immunology Core and were activated and expanded in vitro (Dynabeads human T-cell activator and expansion kit from Gibco). Excitingly, even though our experiment differed from the preferred protocol, we observed a marked increase in survival when mice were co-injected with glioblastoma cells, T- cells and EGFR-BiTE expressing MIPs, but not with CD19 control BiTE expressing MIPs (2 / 3 glioblastoma cell lines evaluated, Figs. 4C, 4D shows data from tumor 3058). Interestingly, the line that did not respond had a lower in vitro sensitivity to the EGFR-BiTE. These are encouraging results given that only a single T-cell infusion was performed, and T-cells are expected to survive roughly one month in the immunocompromised mouse brain. These experiments have been expanded where we co-inject glioblastoma cells with BiTE expressing MIPs, have a tumor establish and place a cannula in the ventricles for repeated T-cell dosing (weekly for 4 weeks) (6 mice per treatment arm) (FIG. 4E). Again, we observe potent extension of survival. GD2-BiTEs potently kill glioblastoma in vitro: Depending on the growth properties of our cells, we use either a spheroid or a 2D monolayer Incucyte killing assay. Glioblastoma cells (10,000 cells, expressing nuclear RFP) are plated together with bispecific engager expressing cells (2,000 cells, targeting or control engager) in triplicate. The following day 50k T-cells are added and each well is imaged every 8h. The number of glioblastoma cells is counted (2D assay) or inferred (spheroid assay) using the Incucyte software. The bispecific engagers were assessed in a 2-stage process, where our engagers are initially expressed in easy to manipulate 293T cells, which allows us to quickly assess the engager’s ability to eliminate glioblastoma in vitro. When successful glioblastoma killing is observed, we repeat our killing assay with bispecific engager expressing MIPs. Bispecific engager MIP cells are generated by infecting our LHX6 ES line with lentivirus, delivering the bispecific engager under a CAG promotor, selecting transduced cells with puromycin and subsequently differentiating these ES cells to MIPs. FIGS. 4F and 4G show the killing induced by a GD2 BiTE of tumor 1769. Three of the 4 lines showed potent killing and include 1763 and 1746. >GD2-BiTE protein sequence METDTLLLWVLLLWVPGSTGDDILLTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLH WYLQKPGQSPKLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHV PPLTFGAGTKLELKGSTSGSGKPGSGEGSTKGEVKLQQSGPSLVEPGASVMISCKASGSS FTGYNMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRATLTVDKSSSTAYMHLKSL TSEDSAVYYCVSGMEYWGQGTSVTVSSGSTSGSGKPGSGEGSTKGDIKLQQSGAELARP GASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLT TDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGG SGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTS KVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKHHHH HH* (SEQ ID NO:66) Example II Identification of novel chemoattractants of MIPs It is very well documented that MIPs are in part guided in their migration by CXCL12 activating the CXCR4 and CXCR7 receptor pathway. In recent years, it has become clear that HMGB1 and MIF bind CXCR4 and CXCR7 as well25,26. Both play a role in the chemoattraction of other CXCR4 expressing cells (dendritic cells, CD4+ T-cells and macrophages)25,38. We hypothesized that MIF and HMGB1 could contribute to MIP-to-glioblastoma migration as they are highly expressed in many glioblastoma (FIG. 1B) and other brain tumors. These factors have not been identified as chemoattractants of MIPs during development. Other “general” chemoattractants, expressed by glioblastoma, can also be evaluated for their effects on MIP migration, thereby identifying new agents stimulating MIP migration during fetal brain development. CXCL12 is one of the most prominent MIP chemoattractants20,21,47. MIPs migrate to a source of CXCL12 in vitro. Additionally, when Li et al.48placed CXCL12 loaded beads on brain slices of 13.5-day old mouse embryos, they observed MIP migration to these beads within 12h48(Fig. 5). Upon binding of CXCL12 to CXCR4, CXCR4 becomes phosphorylated and activates a number of downstream pathways including the RAS pathway. However, phosphorylated CXCR4 binds Arrestin which stimulates degradation of CXCR4 through endocytosis22,49(Fig 1A). If the C-terminal end of CXCR4 is truncated (S338X), Arrestin can no longer bind and CXCR4 remains active on the cell surface, enhancing CXCR4 signaling and enhancing effects of CXCL12 driven migration.50,51Other factors / ligands that guide / support MIP migration are NRG1, HGF, BDNF and GDNF.12Intriguingly, these ligands all activate the RAS- MAPK signaling pathway downstream of their respective receptors (NRG1-EBB4, HGF-MET, BDNF-TRK-B, GDNF-RET), suggesting that RAS-MAPK pathway is central for MIP migration. After activation CXCR7 is degraded in a similar way to CXCR4, if the C-terminal arrestin binding domain is removed (S352X) degradation is reduced. We observed that the majority of glioblastoma cell lines attract MIPs, despite the fact that canonical MIP chemoattractants like CXCL12 and NRG1 are often lowly expressed in these lines. We therefore reason that several ligands, secreted by glioblastoma, induce, support, and guide MIP migration. We can also alter the CXCR4 receptor to enhance MIP sensitivity for and ability to migrate to glioblastoma. To identify biomarkers that will help us define the patient population that could be helped with MIP based therapeutic strategies, the chemoattractants important for MIP-to-glioblastoma migration were assessed. The following data demonstrate the feasibility of identifying and elucidating the role of these ligands / biomarkers. Glioblastoma highly express CXCR4 ligands: As noted above, the CXCL12-CXCR4 axis is one of the best characterized MIP chemoattractant pathways. Analysis of the CBTN and GTex databases show that 34% of pediatric glioblastoma express higher levels of CXCL12 than the surrounding cortex (Fig 1B, Table 1). In recent years other CXCR4 ligands have been identified (HMGB1 and MIF). Excitingly, both are highly expressed in glioblastoma (HMGB1 median expression=99TPM or transcripts per million vs the 95thpercentile normal cortex expression=58.7TPM; MIF median expression =187TPM vs the 95thpercentile normal cortex expression of 10.2TPM). Analysis of both pediatric low and high grade glioma and brain metastases (lung, breast) shows high CXCL12, HMGB1 and / or MIF expression (Fig 1B, C, D and Table 1). Excitingly, 80% (HMGB1) and 100% (MIF) of glioblastomas express higher levels than normal cortex. Because MIF requires binding of CXCR4 or CXCR7 to CD74, expressing CD74 isoforms (sequences provided above) could drive MIP migration to MIF expressing tumors. Similarly, expression of CD44 alone or in combination with CD74, CXCR4 and / or CXCR7 could drive MIP migration to glioblastoma more potently.

[0002] Table 1: Ligands / Receptors which Induce MIP Migration Ligand Fold vs pHGG 80th receptor cortex perc (TPM) Genbank numbe are CCL2 NM_002982; WNT5A NM_001256105, NM_001377271, NM_001377272, NM_003392; CCL3 NM_002983; NTN1 NM_004822; SEMA3A NM_006080; HGF NM_000601; NM_001010931; NM_001010932; NM_001010933; NM_001010934; GPNMB NM_001005340; NM_002510; BMP2 NM_001200; PGF NM_001207012; NM_001293643, NM_002632; HMGB2 NM_001130688; NM_001130689; NM_002129; IL32 NM_001012631; TGFB1 NM_000660; CXCL2 NM_002089; CHI3L2 NM_001025197, NM_001025197, NM_004000; MIF NM_002415; IGF2 NM_000612, NM_001007139, NM_001127598, NM_001291861, NM_001291862; SPP1 NM_000582, NM_001040058, NM_001040060, NM_001251829, NM_001251830; IGFBP2 NM_000597, NM_001313990, NM_001313992, NM_001313993; THBS1 NM_003246; MDK NM_001012333, NM_001012334, NM_001270550, NM_001270551, NM_001270552, NM_002391; IGFBP5 NM_000599; RGMA NM_001166283, NM_001166286, NM_001166287, NM_001166288, NM_001166289, NM_020211; PDGFC NM_016205; IGFBP7 NM_001253835, NM_001553, GRN NM_002087 Exposing MIPs to glioblastoma-conditioned MIP media or recombinant CXCR4 ligands activates the RAS signaling pathway: When we performed a time course experiment and exposed MIPs to U87 conditioned MIP media, we observed potent activation of the RAS-MAPK signaling pathway (pERK activation, (Fig. 6) which is consistent with CXCR4 activation. Next, we found that the RAS- MAPK pathway was indeed activated within 5 minutes by exposure of MIPs to the recombinant CXCR4 ligands CXCL12, HMGB1 and MIF and a combination of CXCL12 and HMGB1 (Fig. 6). CXCL12 and HMGB1 have been shown to bind to CXCR4 together. This implicates HMGB1 and MIF as inducers of MIP migration. By exposure to CXCL12, CXCR4 becomes rapidly phosphorylated and degraded (FIG. 6). Glioblastoma express ligands of migratory receptors expressed on MIPs: Glioblastoma secrete ligands / factors that induce migration of various cell types, including those that create an immune suppressive TME. Here we assessed whether any of these play a role in MIP-to-glioblastoma migration. We analyzed publicly available pHGG (133 tumors, CBTN, pedcibioportal.org), interneuron52and normal cortex (Gtex) expression data. Receptors that play a role in cellular migration and are expressed in MIPs were identified. Subsequently, we evaluated if their ligand expression is at least 2-fold higher than median expression in normal cortex in at least 20% of pHGG samples. Table 1 lists 25 MIP-to- glioblastoma chemoattractants / mitogens which satisfy these criteria, their respective receptors expressed on MIPs, the signaling pathway they activate and the fold change expression (80thpercentile in tumor vs median expression in normal cortex). We can also evaluate if recombinant ligands activate their respective signaling pathways in MIPs, indicating that they play a role in migration. Our preliminary results show that treating MIPs with recombinant ligands as expected activates downstream signaling pathways. We will starve our MIPs for 8h of GDNF and BDNF (standard in MIP media) and subsequently expose them to recombinant ligand for 5, 15 and 60 minutes, harvest protein lysates and determine signaling pathway activation by western blot (see Table 1 for specific targets). Ligands that potently activates their downstream pathway can be evaluated further to assess their chemoattractant properties. Notably, we already have identified 3 ligands that activate their downstream pathways (CXCL12, HMGB1 and MIF) in MIPs (FIG. 6). We use our transwell migration assay to identify how efficient MIPs migrate to recombinant ligand (FIG. 3F). With our in vitro spheroid migration assay (Fig 3D), how well a glioblastoma sphere attracts MIPs can be quantified by identifying the migration front of guided MIPs. Each ligand that was able to activate their signaling pathways in MIPs can then be transiently knocked down in 3 glioblastoma cell lines using siRNAs (On-Target smartpool from Horizon Discovery) and any changes in MIP migration assessed (in triplicate). Non-targeting siRNAs can be used as a negative control. Ligand knockdown can be further evaluated with qPCR. Ligands that significantly reduce MIP-to-glioblastoma migration will be further analyzed in our in vivo assay. Ligands in a glioblastoma cell line can be knocked out using CRISPR, and, or RNAi silencing, and evaluated when MIPs are no longer attracted to the tumors in vivo. Following knockout of the desired target, cells will be single cell cloned and knockout of the target gene can be validated with qPCR and genomic sequencing. Of note, we have already generated single cell knock-out lines of CXCL12 and in vivo MIP migration can be evaluated. For each ligand that passes our criteria, we can inject three single cell knockout and control clones in duplicate (6 control and 6 experimental mice) and evaluate MIP migration in our in vivo migration assay. Briefly, MIPs (200k) will be injected 2mm from the tumor injection site and allowed to migrate for 2 weeks, as shown in Fig. 3F. Animals will be sacrificed, and the number of MIPs (Citrine expression) can be quantified in serial sections present at the tumor. Any ligand that significantly reduces the number (2-fold) of MIPs that arrive within 2 weeks at the tumor site are implicated as biomarkers for MIP-to-glioblastoma attraction. Finally, the identified ligands can be expressed under 3 different promotors that induce varying levels of expression (promotor PGK: low, EIF1a: medium CAG: high expression) in the LN229 glioblastoma cell line that fails to attract MIPs. Of note, the LN229 cell line expresses low levels of CXCL12 and MIF. The in vivo migration assay can be performed with these lines in triplicate (for each promotor both ligand and a control) and the number of MIPs which reach the tumor in 14 days determined. While inducible promoters could be employed, specific promotors are preferred, as it would be difficult to attain and maintain specific and constant expression levels through tetracycline administration to the brain in vivo. IHC staining can be performed on our pediatric HGG Tissue Microarray (TMA) (76 tumors) to evaluate the number of gliomas that are positive for the ligand and classify the expression level, e.g., as low, medium, or high. A TMA of the orthotopic xenograft lines can also be generated to match expression level to chemoattraction. While IHC staining is not ideal for estimating / comparing expression levels; it does enable comparison of protein expression levels of the ligands. Furthermore, IHC used in initial screenings of patient biopsies to determine candidacy for therapy. Expanding the patient population that can be helped with a MIP therapy: CXCR4 and CXCR7 play an essential role for MIP guidance. We have shown that CXCR4 ligands are highly expressed in glioblastoma and that exposure of MIPs to recombinant CXCR4 ligands activates the RAS-MAPK pathway. Moreover, deleting the C-terminal end of CXCR4 or CXCR7 prevents its degradation and leads to aberrant / elevated MIP migration in mice. We hypothesize that MIP with modified or over-expressed CXCR4 or CXCR7 will become more sensitive to CXCR4 ligands and will more rapidly migrate to glioblastoma. Additionally, by glioblastoma highly expressed CXCR4 and CXCR7 ligands (MIF) require binding of CXCR4 or CXCR7 to CD74. MIF also binds the CD74 and CD44 receptors together. These data suggest that the patient population for which MIPs can be a viable therapy can be expanded by expressing the co-receptors CD74 and / or CD44. We found that the CAG promotor drives high expression of a transgene in both ES cells and differentiated MIPs. In our BiTE experiments we successfully introduced transgenes in the ES cells and were able to differentiate these to MIP that retained their migratory capacity. In this example, the same approach can be used to express CXCR4 or a control LACZ construct in ES cells prior to MIP differentiation. In another approach CRISPR technology will be employed (nuclear electroporation of gRNA, Integrated DNA Technologies) to endogenously modify the CXCR4 receptor in the ES cells by introducing a homozygous stop mutation (S338X) that has been shown to prevent degradation of CXCR450,51. After nuclear electroporation, single cell clone ES cells can be isolated and differentiated into MIPs (3 clones). Three control single cell clones will be generated using a control gRNA. Of note, we have successfully introduced endogenous mutations in other genes using this technology. The migratory capacity of the modified MIPs can be evaluated in the following assays: (1) Western blot kinetic experiment: The modified MIPs can be contacted with CXCR4 ligands (CXCL12, HMGB1, MIF) and a western blot kinetic experiment performed to assess prolonged RAS-MAPK pathway activation and CXCR4 phosphorylation (0, 1, 5, 10, 15, 30 and 60 min exposure). We have already shown that pERK is upregulated within 5 min of ligand exposure, and importantly that, as expected, pERK returns to baseline after 15min due to CXCR4 degradation (FIG. 1A, FIG. 6). (2) In vitro spheroid migration assay: The modified MIPs can be assessed for altered migration to glioblastoma spheres in our in vitro migration assay. Migratory capacity of modified and control MIPs can then be determined in all of our glioblastoma lines (triplicates). (3) Transwell migration assay: The modified MIPs can be assessed for altered migration to glioblastoma conditioned media or chemokine supplemented media. The migratory capacity of modified and control MIPs will be determined in triplicate for all of our glioblastoma cell lines. (4) In vivo migration assay: The number of modified and unmodified MIPs that can reach a glioblastoma in our in vivo migration assays (evaluated in 1 line) can then be compared in vivo. Three mice can be injected per single cell clone (3 single cell clones: 9 control and 9 experimental mice for over-expression and endogenously modified CXCR4 S338X or CXCR7 S352X). A modification of the CXCR4 / 7 receptor can be considered successful if the modification significantly and substantially enhances (2-fold) the migration of MIPs to glioblastoma in 2 weeks). Additionally, MIPs expressing sequences for modification, which include CXCR4 variants, CXCR4 S338X variant, CXCR7 variant, CXCR7 S352X variants, CD44 variants, CD74 variants and other sequences listed throughout this application. References 1. Ostrom QT, Patil N, Cioffi G, Waite K, Kruchko C, Barnholtz-Sloan JS. CBTRUS Statistical Report: Primary Brain and Other Central Nervous System Tumors Diagnosed in the United States in 2013-2017. Neuro Oncol. 2020;22(12 Suppl 2):iv1-iv96. doi: 10.1093 / neuonc / noaa200. PubMed PMID: 33123732; PMCID: PMC7596247. 2. Jones C, Perryman L, Hargrave D. Paediatric and adult malignant glioma: close relatives or distant cousins? Nat Rev Clin Oncol. 2012;9(7):400-13. doi: 10.1038 / nrclinonc.2012.87. PubMed PMID: 22641364. 3. Wu W, Klockow JL, Zhang M, Lafortune F, Chang E, Jin L, Wu Y, Daldrup-Link HE. Glioblastoma multiforme (GBM): An overview of current therapies and mechanisms of resistance. Pharmacol Res. 2021;171:105780. doi: 10.1016 / j.phrs.2021.105780. PubMed PMID: 34302977; PMCID: PMC8384724. 4. Badie B, Schartner J, Prabakaran S, Paul J, Vorpahl J. Expression of Fas ligand by microglia: possible role in glioma immune evasion. J Neuroimmunol. 2001;120(1-2):19-24. doi: 10.1016 / s0165-5728(01)00361-7. PubMed PMID: 11694315. 5. Roesch S, Rapp C, Dettling S, Herold-Mende C. When Immune Cells Turn Bad-Tumor- Associated Microglia / Macrophages in Glioma. Int J Mol Sci. 2018;19(2). doi: 10.3390 / ijms19020436. PubMed PMID: 29389898; PMCID: PMC5855658. 6. Tseng D, Volkmer JP, Willingham SB, Contreras-Trujillo H, Fathman JW, Fernhoff NB, Seita J, Inlay MA, Weiskopf K, Miyanishi M, Weissman IL. Anti-CD47 antibody-mediated phagocytosis of cancer by macrophages primes an effective antitumor T-cell response. Proc Natl Acad Sci U S A. 2013;110(27):11103-8. doi: 10.1073 / pnas.1305569110. PubMed PMID: 23690610; PMCID: PMC3703977 Stem Cells, Inc. 7. Feng M, Jiang W, Kim BYS, Zhang CC, Fu YX, Weissman IL. Phagocytosis checkpoints as new targets for cancer immunotherapy. Nat Rev Cancer. 2019;19(10):568-86. doi: 10.1038 / s41568-019-0183-z. PubMed PMID: 31462760; PMCID: PMC7002027. 8. Maggs L, Cattaneo G, Dal AE, Moghaddam AS, Ferrone S. CAR T Cell-Based Immunotherapy for the Treatment of Glioblastoma. Front Neurosci. 2021;15:662064. doi: 10.3389 / fnins.2021.662064. PubMed PMID: 34113233; PMCID: PMC8185049. 9. Anderson SA, Eisenstat DD, Shi L, Rubenstein JL. Interneuron migration from basal forebrain to neocortex: dependence on Dlx genes. Science. 1997;278(5337):474-6. 10. Hansen DV, Lui JH, Flandin P, Yoshikawa K, Rubenstein JL, Alvarez-Buylla A, Kriegstein AR. Non-epithelial stem cells and cortical interneuron production in the human ganglionic eminences. Nature neuroscience. 2013. Epub 2013 / 10 / 08. doi: 10.1038 / nn.3541. PubMed PMID: 24097039. 11. Lim L, Mi D, Llorca A, Marin O. Development and Functional Diversification of Cortical Interneurons. Neuron. 2018;100(2):294-313. Epub 2018 / 10 / 26. doi: 10.1016 / j.neuron.2018.10.009. PubMed PMID: 30359598; PMCID: PMC6290988. 12. Chu J, Anderson SA. Development of cortical interneurons. Neuropsychopharmacology. 2015;40(1):16-23. doi: 10.1038 / npp.2014.171. PubMed PMID: 25103177; PMCID: PMC4262895. 13. Kim JY, Paredes MF. Implications of Extended Inhibitory Neuron Development. Int J Mol Sci. 2021;22(10). Epub 2021 / 06 / 03. doi: 10.3390 / ijms22105113. PubMed PMID: 34066025; PMCID: PMC8150951. 14. Li D, Wu Q, Han X. Application of Medial Ganglionic Eminence Cell Transplantation in Diseases Associated With Interneuron Disorders. Front Cell Neurosci. 2022;16:939294. Epub 2022 / 07 / 23. doi: 10.3389 / fncel.2022.939294. PubMed PMID: 35865112; PMCID: PMC9294455. 15. Wichterle H, Garcia-Verdugo JM, Herrera DG, Alvarez-Buylla A. Young neurons from medial ganglionic eminence disperse in adult and embryonic brain. Nature neuroscience. 1999;2(5):461-6. 16. Rolando C, Gribaudo S, Yoshikawa K, Leto K, De Marchis S, Rossi F. Extracerebellar progenitors grafted to the neurogenic milieu of the postnatal rat cerebellum adapt to the host environment but fail to acquire cerebellar identities. Eur J Neurosci. 2010;31(8):1340-51. Epub 2010 / 04 / 14. doi: 10.1111 / j.1460-9568.2010.07167.x. PubMed PMID: 20384777. 17. Braz JM, Sharif-Naeini R, Vogt D, Kriegstein A, Alvarez-Buylla A, Rubenstein JL, Basbaum AI. Forebrain GABAergic neuron precursors integrate into adult spinal cord and reduce injury- induced neuropathic pain. Neuron. 2012;74(4):663-75. Epub 2012 / 05 / 29. doi: 10.1016 / j.neuron.2012.02.033. PubMed PMID: 22632725; PMCID: 3361692. 18. Fitzgerald M, Sotuyo N, Tischfield DJ, Anderson SA. Generation of cerebral cortical GABAergic interneurons from pluripotent stem cells. Stem Cells. 2020;38(11):1375-86. Epub 2020 / 07 / 09. doi: 10.1002 / stem.3252. PubMed PMID: 32638460. 19. Zhu Q, Mishra A, Park JS, Liu D, Le DT, Gonzalez SZ, Anderson-Crannage M, Park JM, Park GH, Tarbay L, Daneshvar K, Brandenburg M, Signoretti C, Zinski A, Gardner EJ, Zheng KL, Abani CP, Hu C, Beaudreault CP, Zhang XL, Stanton PK, Cho JH, Velisek L, Veliskova J, Javed S, Leonard CS, Kim HY, Chung S. Human cortical interneurons optimized for grafting specifically integrate, abort seizures, and display prolonged efficacy without over-inhibition. Neuron. 2022. Epub 2023 / 01 / 11. doi: 10.1016 / j.neuron.2022.12.014. PubMed PMID: 36626901. 20. Tiveron MC, Rossel M, Moepps B, Zhang YL, Seidenfaden R, Favor J, Konig N, Cremer H. Molecular interaction between projection neuron precursors and invading interneurons via stromal-derived factor 1 (CXCL12) / CXCR4 signaling in the cortical subventricular zone / intermediate zone. J Neurosci. 2006;26(51):13273-8. PubMed PMID: 17182777. 21. Stumm RK, Zhou C, Ara T, Lazarini F, Dubois-Dalcq M, Nagasawa T, Hollt V, Schulz S. CXCR4 regulates interneuron migration in the developing neocortex. J Neurosci. 2003;23(12):5123-30. PubMed PMID: 12832536. 22. Cojoc M, Peitzsch C, Trautmann F, Polishchuk L, Telegeev GD, Dubrovska A. Emerging targets in cancer management: role of the CXCL12 / CXCR4 axis. Onco Targets Ther. 2013;6:1347-61. doi: 10.2147 / OTT.S36109. PubMed PMID: 24124379; PMCID: PMC3794844. 23. Wurth R, Bajetto A, Harrison JK, Barbieri F, Florio T. CXCL12 modulation of CXCR4 and CXCR7 activity in human glioblastoma stem-like cells and regulation of the tumor microenvironment. Frontiers in cellular neuroscience. 2014;8:144. Epub 2014 / 06 / 07. doi: 10.3389 / fncel.2014.00144. PubMed PMID: 24904289; PMCID: 4036438. 24. Gagliardi F, Narayanan A, Reni M, Franzin A, Mazza E, Boari N, Bailo M, Zordan P, Mortini P. The role of CXCR4 in highly malignant human gliomas biology: current knowledge and future directions. Glia. 2014;62(7):1015-23. Epub 2014 / 04 / 10. doi: 10.1002 / glia.22669. PubMed PMID: 24715652. 25. Schiraldi M, Raucci A, Munoz LM, Livoti E, Celona B, Venereau E, Apuzzo T, De Marchis F, Pedotti M, Bachi A, Thelen M, Varani L, Mellado M, Proudfoot A, Bianchi ME, Uguccioni M. HMGB1 promotes recruitment of inflammatory cells to damaged tissues by forming a complex with CXCL12 and signaling via CXCR4. J Exp Med. 2012;209(3):551-63. doi: 10.1084 / jem.20111739. PubMed PMID: 22370717; PMCID: PMC3302219. 26. Bernhagen J, Krohn R, Lue H, Gregory JL, Zernecke A, Koenen RR, Dewor M, Georgiev I, Schober A, Leng L, Kooistra T, Fingerle-Rowson G, Ghezzi P, Kleemann R, McColl SR, Bucala R, Hickey MJ, Weber C. MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. Nat Med. 2007;13(5):587-96. doi: 10.1038 / nm1567. PubMed PMID: 17435771. 27. Hagemeyer CE, von Zur Muhlen C, von Elverfeldt D, Peter K. Single-chain antibodies as diagnostic tools and therapeutic agents. Thromb Haemost. 2009;101(6):1012-9. PubMed PMID: 19492141. 28. Krishnamurthy A, Jimeno A. Bispecific antibodies for cancer therapy: A review. Pharmacol Ther. 2018;185:122-34. doi: 10.1016 / j.pharmthera.2017.12.002. PubMed PMID: 29269044. 29. Goebeler ME, Bargou RC. T cell-engaging therapies - BiTEs and beyond. Nat Rev Clin Oncol. 2020;17(7):418-34. doi: 10.1038 / s41571-020-0347-5. PubMed PMID: 32242094. 30. Goebeler ME, Knop S, Viardot A, Kufer P, Topp MS, Einsele H, Noppeney R, Hess G, Kallert S, Mackensen A, Rupertus K, Kanz L, Libicher M, Nagorsen D, Zugmaier G, Klinger M, Wolf A, Dorsch B, Quednau BD, Schmidt M, Scheele J, Baeuerle PA, Leo E, Bargou RC. Bispecific T-Cell Engager (BiTE) Antibody Construct Blinatumomab for the Treatment of Patients With Relapsed / Refractory Non-Hodgkin Lymphoma: Final Results From a Phase I Study. J Clin Oncol. 2016;34(10):1104-11. doi: 10.1200 / JCO.2014.59.1586. PubMed PMID: 26884582. 31. Choi BD, Yu X, Castano AP, Bouffard AA, Schmidts A, Larson RC, Bailey SR, Boroughs AC, Frigault MJ, Leick MB, Scarfo I, Cetrulo CL, Demehri S, Nahed BV, Cahill DP, Wakimoto H, Curry WT, Carter BS, Maus MV. CAR-T cells secreting BiTEs circumvent antigen escape without detectable toxicity. Nat Biotechnol. 2019;37(9):1049-58. doi: 10.1038 / s41587-019- 0192-1. PubMed PMID: 31332324. 32. Gleason MK, Verneris MR, Todhunter DA, Zhang B, McCullar V, Zhou SX, Panoskaltsis- Mortari A, Weiner LM, Vallera DA, Miller JS. Bispecific and trispecific killer cell engagers directly activate human NK cells through CD16 signaling and induce cytotoxicity and cytokine production. Mol Cancer Ther. 2012;11(12):2674-84. doi: 10.1158 / 1535-7163.MCT-12-0692. PubMed PMID: 23075808; PMCID: PMC3519950. 33. Capuano C, Pighi C, Battella S, De Federicis D, Galandrini R, Palmieri G. Harnessing CD16- Mediated NK Cell Functions to Enhance Therapeutic Efficacy of Tumor-Targeting mAbs. Cancers (Basel). 2021;13(10). doi: 10.3390 / cancers13102500. PubMed PMID: 34065399; PMCID: PMC8161310. 34. Depil S, Duchateau P, Grupp SA, Mufti G, Poirot L. 'Off-the-shelf' allogeneic CAR T cells: development and challenges. Nat Rev Drug Discov. 2020;19(3):185-99. doi: 10.1038 / s41573- 019-0051-2. PubMed PMID: 31900462. 35. O'Rourke DM, Nasrallah MP, Desai A, Melenhorst JJ, Mansfield K, Morrissette JJD, Martinez-Lage M, Brem S, Maloney E, Shen A, Isaacs R, Mohan S, Plesa G, Lacey SF, Navenot JM, Zheng Z, Levine BL, Okada H, June CH, Brogdon JL, Maus MV. A single dose of peripherally infused EGFRvIII-directed CAR T cells mediates antigen loss and induces adaptive resistance in patients with recurrent glioblastoma. Sci Transl Med. 2017;9(399). doi: 10.1126 / scitranslmed.aaa0984. PubMed PMID: 28724573; PMCID: PMC5762203. 36. Lam RS, O'Brien-Simpson NM, Holden JA, Lenzo JC, Fong SB, Reynolds EC. Unprimed, M1 and M2 Macrophages Differentially Interact with Porphyromonas gingivalis. PLoS One. 2016;11(7):e0158629. doi: 10.1371 / journal.pone.0158629. PubMed PMID: 27383471; PMCID: PMC4934774. 37. Schulz D, Severin Y, Zanotelli VRT, Bodenmiller B. In-Depth Characterization of Monocyte-Derived Macrophages using a Mass Cytometry-Based Phagocytosis Assay. Sci Rep. 2019;9(1):1925. doi: 10.1038 / s41598-018-38127-9. PubMed PMID: 30760760; PMCID: PMC6374473. 38. Pacheco-Fernandez T, Juarez-Avelar I, Illescas O, Terrazas LI, Hernandez-Pando R, Perez- Plasencia C, Gutierrez-Cirlos EB, Avila-Moreno F, Chirino YI, Reyes JL, Maldonado V, Rodriguez-Sosa M. Macrophage Migration Inhibitory Factor Promotes the Interaction between the Tumor, Macrophages, and T Cells to Regulate the Progression of Chemically Induced Colitis-Associated Colorectal Cancer. Mediators Inflamm. 2019;2019:2056085. doi: 10.1155 / 2019 / 2056085. PubMed PMID: 31360118; PMCID: PMC6652048. 39. Ijaz H, Koptyra M, Gaonkar KS, Rokita JL, Baubet VP, Tauhid L, Zhu Y, Brown M, Lopez G, Zhang B, Diskin SJ, Vaksman Z, Children's Brain Tumor Tissue C, Mason JL, Appert E, Lilly J, Lulla R, De Raedt T, Heath AP, Felmeister A, Raman P, Nazarian J, Santi MR, Storm PB, Resnick A, Waanders AJ, Cole KA. Pediatric high-grade glioma resources from the Children's Brain Tumor Tissue Consortium. Neuro Oncol. 2020;22(1):163-5. doi: 10.1093 / neuonc / noz192. PubMed PMID: 31613963; PMCID: PMC6954395. 40. Ghandi M, Huang FW, Jane-Valbuena J, Kryukov GV, Lo CC, McDonald ER, 3rd, Barretina J, Gelfand ET, Bielski CM, Li H, Hu K, Andreev-Drakhlin AY, Kim J, Hess JM, Haas BJ, Aguet F, Weir BA, Rothberg MV, Paolella BR, Lawrence MS, Akbani R, Lu Y, Tiv HL, Gokhale PC, de Weck A, Mansour AA, Oh C, Shih J, Hadi K, Rosen Y, Bistline J, Venkatesan K, Reddy A, Sonkin D, Liu M, Lehar J, Korn JM, Porter DA, Jones MD, Golji J, Caponigro G, Taylor JE, Dunning CM, Creech AL, Warren AC, McFarland JM, Zamanighomi M, Kauffmann A, Stransky N, Imielinski M, Maruvka YE, Cherniack AD, Tsherniak A, Vazquez F, Jaffe JD, Lane AA, Weinstock DM, Johannessen CM, Morrissey MP, Stegmeier F, Schlegel R, Hahn WC, Getz G, Mills GB, Boehm JS, Golub TR, Garraway LA, Sellers WR. Next-generation characterization of the Cancer Cell Line Encyclopedia. Nature. 2019;569(7757):503-8. doi: 10.1038 / s41586-019- 1186-3. PubMed PMID: 31068700; PMCID: PMC6697103. 41. Schaefer T, Ramadoss A, Leu S, Tintignac L, Tostado C, Bink A, Schurch C, Muller J, Scharer J, Moffa G, Demougin P, Moes S, Stippich C, Falbo S, Neddersen H, Bucher H, Frank S, Jeno P, Lengerke C, Ritz MF, Mariani L, Boulay JL. Regulation of glioma cell invasion by 3q26 gene products PIK3CA, SOX2 and OPA1. Brain Pathol. 2019;29(3):336-50. doi: 10.1111 / bpa.12670. PubMed PMID: 30403311; PMCID: PMC8028334. 42. Zhao Y, Flandin P, Long JE, Cuesta MD, Westphal H, Rubenstein JL. Distinct molecular pathways for development of telencephalic interneuron subtypes revealed through analysis of Lhx6 mutants. The Journal of comparative neurology. 2008;510(1):79-99. Epub 2008 / 07 / 10. doi: 10.1002 / cne.21772. PubMed PMID: 18613121. 43. Tyson JA, Goldberg EM, Maroof AM, Xu Q, Petros TJ, Anderson SA. Duration of culture and sonic hedgehog signaling differentially specify PV versus SST cortical interneuron fates from embryonic stem cells. Development. 2015;142(7):1267-78. Epub 2015 / 03 / 26. doi: 10.1242 / dev.111526. PubMed PMID: 25804737; PMCID: 4378243. 44. Maroof AM, Brown K, Shi SH, Studer L, Anderson SA. Prospective isolation of cortical interneuron precursors from mouse embryonic stem cells. The Journal of neuroscience : the official journal of the Society for Neuroscience. 2010;30(13):4667-75. Epub 2010 / 04 / 02. doi: 10.1523 / JNEUROSCI.4255-09.2010. PubMed PMID: 20357117; PMCID: 2868507. 45. Ni P, Noh H, Shao Z, Zhu Q, Guan Y, Park JJ, Arif F, Park JM, Abani C, Beaudreault C, Park JS, Berry E, Moghadam A, Stanton P, Hutchinson JN, Andrews B, Faux C, Parnevelas J, Eisenberg LM, Park K, Bolshakov VY, Chung S. Large-Scale Generation and Characterization of Homogeneous Populations of Migratory Cortical Interneurons from Human Pluripotent Stem Cells. Mol Ther Methods Clin Dev. 2019;13:414-30. doi: 10.1016 / j.omtm.2019.04.002. PubMed PMID: 31061832; PMCID: PMC6495066. 46. Dougherty J, Harvey K, Liou A, Labella K, Moran D, Brosius S, De Raedt T. Identification of therapeutic sensitivities in a spheroid drug combination screen of Neurofibromatosis Type I associated High Grade Gliomas. Plos One. 2023;18(2):e0277305. Epub Feb 2. doi: 10.1371 / journal.pone.0277305. 47. Flames N, Long JE, Garratt AN, Fischer TM, Gassmann M, Birchmeier C, Lai C, Rubenstein JL, Marin O. Short- and long-range attraction of cortical GABAergic interneurons by neuregulin- 1. Neuron. 2004;44(2):251-61. doi: 10.1016 / j.neuron.2004.09.028. PubMed PMID: 15473965. 48. Li G, Adesnik H, Li J, Long J, Nicoll RA, Rubenstein JL, Pleasure SJ. Regional distribution of cortical interneurons and development of inhibitory tone are regulated by Cxcl12 / Cxcr4 signaling. J Neurosci. 2008;28(5):1085-98. doi: 10.1523 / JNEUROSCI.4602-07.2008. PubMed PMID: 18234887; PMCID: PMC3072297. 49. Busillo JM, Benovic JL. Regulation of CXCR4 signaling. Biochim Biophys Acta. 2007;1768(4):952-63. doi: 10.1016 / j.bbamem.2006.11.002. PubMed PMID: 17169327; PMCID: PMC1952230. 50. Saaber F, Schutz D, Miess E, Abe P, Desikan S, Ashok Kumar P, Balk S, Huang K, Beaulieu JM, Schulz S, Stumm R. ACKR3 Regulation of Neuronal Migration Requires ACKR3 Phosphorylation, but Not beta-Arrestin. Cell Rep. 2019;26(6):1473-88 e9. doi: 10.1016 / j.celrep.2019.01.049. PubMed PMID: 30726732. 51. Balabanian K, Brotin E, Biajoux V, Bouchet-Delbos L, Lainey E, Fenneteau O, Bonnet D, Fiette L, Emilie D, Bachelerie F. Proper desensitization of CXCR4 is required for lymphocyte development and peripheral compartmentalization in mice. Blood. 2012;119(24):5722-30. doi: 10.1182 / blood-2012-01-403378. PubMed PMID: 22438253. 52. Nicholas CR, Chen J, Tang Y, Southwell DG, Chalmers N, Vogt D, Arnold CM, Chen YJ, Stanley EG, Elefanty AG, Sasai Y, Alvarez-Buylla A, Rubenstein JL, Kriegstein AR. Functional maturation of hPSC-derived forebrain interneurons requires an extended timeline and mimics human neural development. Cell Stem Cell. 2013;12(5):573-86. doi: 10.1016 / j.stem.2013.04.005. PubMed PMID: 23642366; PMCID: PMC3699205. 53. Abe P, Mueller W, Schutz D, MacKay F, Thelen M, Zhang P, Stumm R. CXCR7 prevents excessive CXCL12-mediated downregulation of CXCR4 in migrating cortical interneurons. Development. 2014;141(9):1857-63. doi: 10.1242 / dev.104224. PubMed PMID: 24718993. 54. Sanchez-Alcaniz JA, Haege S, Mueller W, Pla R, Mackay F, Schulz S, Lopez-Bendito G, Stumm R, Marin O. Cxcr7 controls neuronal migration by regulating chemokine responsiveness. Neuron. 2011;69(1):77-90. PubMed PMID: 21220100. While certain of the preferred embodiments of the present invention have been described and specifically exemplified above, it is not intended that the invention be limited to such embodiments. It will be apparent to one skilled in the art that various changes and modifications can be made therein without departing from the scope of the present invention, as set forth in the following claims.

Claims

What is claimed is:

1. A composition for the treatment of brain cancer, comprising a) a purified population of engineered post-mitotic migratory interneuron precursor cells (MIPs) chemoattracted to brain cancer cells, said MIPs comprising at least one recombinant nucleic acid expressing a secretable, inhibitory bi-specific antibody having i) a first binding domain which forms a first specific binding pair with a surface ligand on an immune effector cell and ii) a second binding domain which forms a second specific binding pair with a surface ligand on a brain cancer cell; and b) a purified population of immune effector cells comprising said ligand bound by said second binding domain, secretion of said bispecific antibody in proximity of said brain cancer cells and said immune effector cells linking both types of cells, said linking causing activation of said immune effector cell, thereby killing any brain cancer cell in proximity thereof.

2. The composition of claim 1 or claim 12, wherein said MIP cells are LHX6+.

3. The composition of claim 1 or claim 12, wherein said recombinant nucleic acid encodes a bispecific antibody having said first and second binding domains in first and second scFv sequences said scFv sequence being operably linked at coupling sites to a linker peptide.

4. The composition of claim 1 or claim 12, wherein said first or second binding domain binds an antigen selected from CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, MUC17, HER2, EpCAM, B7H3, CD16, EGFR, GD2, and CD3.

5. The composition of claim 1 or claim 12, wherein said brain cancer is a glioblastoma.

6. The composition of claim 1 or claim 12, wherein said cancer is a metastatic cancer.

7. The composition of claim 6, wherein metastatic cancer has metastasized from a tissue selected from brain, lung, breast, kidney, prostate, bone, skin, colon, thyroid gland, liver, genitourinary tract, pancreas, lymph / blood, neuroblastoma, head and neck.

8. The composition of claim 1, claim 3, or claim 12 wherein said immune effector cell is a CD8+ T cell, said first ligand binds CD3 on said T cell and said second ligand binds at least one receptor selected from EGFR CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, MUC17, HER2, EpCAM, B7H3, CD16, EGFR, GD2, and CD3, on said brain cancer cell.

9. The composition of claim any one of claims 1, 4, 8, 10 or 12, wherein said poly nucleotide is present in an expression vector, selected from lentivirus vectors, gamma retrovirus vectors, foamy virus vectors, adeno associated virus vectors, adenovirus vectors, pox virus vectors, herpes virus vectors, engineered hybrid viruses, and transposon mediated vectors.

10. A post-mitotic migratory interneuron precursor cells (MIPs) population genetically engineered to express a therapeutic agent.

11. The genetically engineered MIP cytotoxic cell of claim 10, wherein said cytotoxic agent is a bispecific antibody which binds brain cancer cells and activates CD8+ T cells.

12. The MIP population of clam 10 or claim 11, wherein said cells are modified to express proteins which enhances or alters chemoattaction.

13. The MIP population of claims 10 to 12, wherein said proteins are isoforms of CXCR4, CXCR4 S338X, CXCR7, CXCR7 S335X, CD74 and / or CD44.

14. The MIP population of any one of claims 10-12, wherein said therapeutic agents are inducible CXCR4 inhibitory molecules.

15. The MIP population of claim 10 or 12, wherein said protein is encoded by a suicide gene selected from thymidine kinase, cytosine deaminase, nitroreductase and purine nucleoside phosphorylase modulated by a cognate prodrug selected from ganciclovir, and 5-fluoro cytosine, 5-aziridin-1-yl)-2,4-dinitrobenzamide and 6-methylpurine deoxyriboside respectively.

16. A method for the treatment of brain cancer, in a patient in need thereof, comprising administration of a) an effective amount of any one of the compositions of claims 1 directly into the cranial cavity said T cells and b) MIPs, delivered simultaneously or sequentially as the composition of step a), said MIPs being chemoattracted to said brain cancer cells and secreting said bispecific antibody in proximity of said brain cancer cells and said T cells, thereby linking both types of cells, said linking causing activation of said T cell, causing cell death in brain cancer cell.

17. The method of claim 16, wherein said brain cancer is a glioblastoma.

18. The method of claim 16, wherein said brain cancer is a metastatic cancer.

19. The method of claim 6, wherein metastatic cancer has metastasized from a tissue selected from lung, breast, kidney, prostate, bone, skin, colon, thyroid gland, liver, genitourinary tract, pancreas, lymph / blood, neuroblastoma, head and neck.

20. The method of claim 16, wherein said first or second binding domain binds an antigen selected from CDH19, MSLN, DLL3, FLT3, EGFRvlll, BCMA, PSMA, CD33, CD19, CD70, CLDN18.2, MUC17, HER2, EpCAM, B7H3, GD2, EGFR, CD16, and CD3, administered with the MIP population of claim 12.

21. The method of claim 16, wherein said composition is administered via a cannula placed anywhere in the brain.

22. The method of claim 16, wherein said composition is administered via repeated dosing though an Ommaya Reservoir directly into the ventricles or regions of the brain harboring tumor cells.

23. The method of claim 16 further comprising assessing said patient prior to treatment of at least one of the prognostic biomarkers listed in Table 1.

24. A method for identifying patients most likely to benefit from treatment with the composition as claimed in claim 1, comprising; a) detecting in a biological sample one or more MIP migration-associated biomarkers listed in Table 1; b) comparing said level of biomarkers with a reference level from subjects who benefitted from said treatment, patients exhibiting equal or higher levels being identified as most likely to benefit from treatment.

25. The post-mitotic MIP cell population of claim 10, wherein said therapeutic agent modulates the tumor microenvironment.

26. The post-mitotic MIP cell population of claim 1, 12, or 16, wherein said therapeutic agent is cytotoxic to brain cancer cells.

27. The post-mitotic MIP cell population of claim any one of claim 10 to 12, further comprising a marker sequence to facilitates the ability to image or detect brain cancer mass.

28. The method of claim 16, wherein said composition is administered into the margin of the surgical cavity.

29. The method of claim 16, wherein said composition is administered into the brain.

30. A method for the treatment of brain cancer, in a patient in need thereof, comprising administration of an effective amount of genetically engineered MIPs of claim 10 directly into the cranial cavity, said MIPs being chemoattracted to said brain cancer cells and secreting a bispecific antibody in proximity of said brain cancer cells and endogenous CD8+ T cells, thereby linking both types of cells, said linking causing activation of said endogenous CD8+ T cell, thereby killing any brain cancer cell in proximity thereof.

31. The method of claim 30, wherein said bispecific antibody has a first ligand and a second ligand, said first ligand binding CD3 on said T cell and said second ligand binding EGFR on said brain cancer cell when said T cell when said brain cell are in proximity to one another.

32. The composition of claim 1, wherein said brain cancer is a low grade.

33. The method of claim 16 or 20, wherein said brain cancer is a low grade.

34. A composition comprising GD2-BiTE in a pharmaceutically acceptable carrier.

35. The composition of claim 34, wherein said GD2-BiTE is encoded by SEQ ID NO:

66.

36. The composition of claim 34, wherein SEQ ID NO: 66 comprises modifications that enhance one or both of stability and bioavailability.

37. A method of administration of the composition of any one of claims 34- 36 to a patient in need thereof comprising direct delivery of said GD2-BiTE through infusion, via a cannula, an Ommaya reservoir, or intravenously for treatment of a brain tumor.

38. The method of claim 37 wherein said composition is administered in combination with a T- cell infusion.

39. A method of administration of the composition of any one of claims 34- 36 to a patient in need thereof comprising direct delivery of said GD2-BiTE through infusion, via a cannula, an Ommaya reservoir, or intravenously, for treatment of any tumor expressing GD2 antigen.

40. The MIP population of claim 10 or 12, wherein said therapeutic protein is encoded by an inducible TRAIL or trimer TRAIL.

Citation Information

Patent Citations

  • Method to isolate, identify, and use embryonic stem cells directed to forebrain interneuron fate

    WO2010141622A2

  • Central nervous system targeting polynucleotides

    WO2016115503A1

  • Chimeric antigen receptor t cells targeting the tumor microenvironment

    WO2018191748A1