SARS-cov-2 vaccine compositions and related methods

Abstract

Provided herein are SARS-CoV-2 spike proteins and polypeptides (e.g., SARS-CoV-2 spike proteins and polypeptide immunogens (and immunogenic fragments and immunogenic variants thereof)) comprising at least one non-naturally occurring glycosylation site, and nucleic acid molecules encoding the same. Further provided herein are compositions (e.g., pharmaceutical compositions) and vaccines comprising the same for use in e.g., the prevention, treatment, and / or amelioration of a SARS-CoV-2 infection.

Description

[0001]Attorney Docket No.62801.28WO01 SARS-CoV-2 VACCINE COMPOSITIONS AND RELATED METHODS RELATED APPLICATIONS This application claims priority to U.S. Serial No.: 63 / 580,865, filed September 6, 2023; and U.S. Serial No.: 63 / 604,285, filed November 30, 2023, the entire contents of each of which is incorporated herein by reference. 1. FIELD This disclosure relates to SARS-CoV-2 spike proteins and polypeptides (e.g., SARS- CoV-2 spike protein and polypeptide immunogens (and immunogenic fragments and / or immunogenic variants thereof)), that comprise at least one non-naturally occurring glycosylation site (described herein) and nucleic acid molecules encoding the same. The disclosure further relates to compositions comprising of the same (e.g., vaccine compositions, pharmaceutical compositions) and methods of making and utilizing the same. 2. BACKGROUND Coronaviruses are a family of enveloped, positive-sense, single stranded RNA viruses that infect a wide variety of mammalian and avian species. The viral genome is packaged into a capsid that is comprised of the viral nucleocapsid protein and surrounded by a lipid envelope. Embedded in the lipid envelope are several proteins, including, the membrane protein, the envelope small membrane protein, hemagglutinin-esterase, and the spike protein. Human coronaviruses typically cause respiratory illnesses, and include, e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), severe acute respiratory syndrome coronavirus 1 (SARS- CoV-1), and Middle East respiratory syndrome (MERS-CoV). SARS-Cov-2 emerged in humans in 2019, spread rapidly, and led to a global pandemic. SARS-CoV-2 is the cause of the coronavirus disease 2019 (COVID-19). COVID-19 caused a continuing public health crisis, with millions of deaths and severe illness attributed to COVID-19 worldwide. Protection against COVID-19 is mediated in large part by an immune response directed against the SARS-CoV-2 spike protein, a main target of SARS-CoV-2 vaccines. The spike protein mediates binding and entry into host cells, through binding of the receptor binding domain (RBD) to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Attorney Docket No.62801.28WO01 3. SUMMARY Provided herein are, inter alia, SARS-CoV-2 spike proteins and polypeptides (e.g., SARS-CoV-2 spike protein and polypeptide immunogens (and immunogenic fragments and / or immunogenic variants thereof)), nucleic acid molecules encoding the same, compositions (e.g., vaccine compositions, pharmaceutical compositions) comprising the SARS-CoV-2 spike proteins and polypeptides (e.g., SARS-CoV-2 spike protein and polypeptide immunogens (and immunogenic fragments and / or immunogenic variants thereof)) or nucleic acids encoding the same, methods of manufacturing, and methods of use including, e.g., methods of preventing, reducing, or treating a SARS-CoV-2 infection, methods of vaccination against a SARS-CoV-2 infection, etc. In one aspect, provided herein are nucleic acid molecules comprising at least one coding region encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)), wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369, 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV- 2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) is hyper-glycosylated relative to a reference SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) (e.g., the SARS-CoV-2 spike protein set forth in SEQ ID NO: 1). In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, or more non-naturally occurring glycosylation motifs each comprising a non-naturally occurring glycosylation site, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the glycosylation motif is an N-linked glycosylation motif. In some embodiments, the N-linked glycosylation motif is an NXT sequence, wherein X is any amino Attorney Docket No.62801.28WO01 acid except for proline. In some embodiments, the N-linked glycosylation motif is an NXS sequence, wherein X is any amino acid except for proline. In some embodiments, the glycosylation site is an N-linked glycosylation site. In some embodiments, the glycosylation motif is an O-linked glycosylation motif. In some embodiments, the O-linked glycosylation motif is a serine or threonine. In some embodiments, the glycosylation site is an O-linked glycosylation site. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and an N-linked glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and an N- glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and an N- glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or Attorney Docket No.62801.28WO01 immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N- linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N- linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID Attorney Docket No.62801.28WO01 NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and an N- glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. Attorney Docket No.62801.28WO01 In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 354, 370, 394, 415, 428, 448, 468, 494, and / or 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the glycosylation motif is an N-linked glycosylation motif. In some embodiments, the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline. In some embodiments, the glycosylation site is an N-linked glycosylation site. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and an N-glycosylation site at amino acid Attorney Docket No.62801.28WO01 position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N- linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and an N-glycosylation site at amino acid position 448, Attorney Docket No.62801.28WO01 amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N- linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N- linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and an N- Attorney Docket No.62801.28WO01 glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and an N-glycosylation site at amino acid position 448, amino acid Attorney Docket No.62801.28WO01 numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 383, 441, 477, 517, and / or 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the glycosylation motif is an N-linked glycosylation motif. In some embodiments, the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline. In some embodiments, the glycosylation site is an N-linked glycosylation site. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N-glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine or a serine at position 443 and an N-glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine or a serine at position 479 and an N-glycosylation Attorney Docket No.62801.28WO01 site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine or a serine at position 519 and an N- glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N-linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine or a serine at position 520 and an N-glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N-glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine at position 443 and an N-glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N- linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine at position 479 and an N-glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine at position 519 and an N-glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N- linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine at position 520 and an N-glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more naturally occurring glycosylation sites. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike Attorney Docket No.62801.28WO01 protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a naturally occurring glycosylation site) at one or more of amino acid positions 331 and / or 343, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) relative the reference sequence (e.g., SEQ ID NO: 1). In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) )) in a prefusion state relative the reference sequence (e.g., SEQ ID NO: 1). In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an inactive furin cleavage site. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least one amino acid variation in the furin cleavage site that inactivates the furin cleavage site. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or Attorney Docket No.62801.28WO01 immunogenic variant thereof)) comprises a proline at one or more of position 817, 892, 899, 986, and / or 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 986 and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 817, 892, 899, 986, and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N- linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: Attorney Docket No.62801.28WO01 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N- linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to Attorney Docket No.62801.28WO01 the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic Attorney Docket No.62801.28WO01 acid at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an Attorney Docket No.62801.28WO01 asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions Attorney Docket No.62801.28WO01 set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to Attorney Docket No.62801.28WO01 the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a Attorney Docket No.62801.28WO01 threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an Attorney Docket No.62801.28WO01 asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions Attorney Docket No.62801.28WO01 set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a Attorney Docket No.62801.28WO01 serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions Attorney Docket No.62801.28WO01 set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino Attorney Docket No.62801.28WO01 acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an Attorney Docket No.62801.28WO01 asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif Attorney Docket No.62801.28WO01 comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to Attorney Docket No.62801.28WO01 the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at Attorney Docket No.62801.28WO01 position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at Attorney Docket No.62801.28WO01 position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set Attorney Docket No.62801.28WO01 forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N- linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at Attorney Docket No.62801.28WO01 position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position Attorney Docket No.62801.28WO01 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering Attorney Docket No.62801.28WO01 relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N- linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike Attorney Docket No.62801.28WO01 protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or Attorney Docket No.62801.28WO01 immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to Attorney Docket No.62801.28WO01 the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 502 and a glycosylation site at position 504, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496, and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504, and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. Attorney Docket No.62801.28WO01 In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, or 6) of (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, and / or 22) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, Attorney Docket No.62801.28WO01 a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, and / or 10) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and / or a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and / or 12) of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a Attorney Docket No.62801.28WO01 serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of the SARS-CoV-2 spike protein receptor binding domain (RBD). In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of a full-length SARS-CoV-2 spike protein. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises from about 10-15, 10-20, 10-30, 10-40, 10-50, 10-60, 10-70, 10-80, 10-90, 10- 100, 10-200, 10-300, 10-400, 10-500, 10-600, 10-700, 10-800, 10-900, 10-1000, 10-1100, 10- 1200, 10-1300, 100-200, 100-300, 100-400, 100-500, 100-600, 100-700, 100-800, 100-900, 100- 1000, 100-1100, 100-1200, or 100-1300 amino acids. Attorney Docket No.62801.28WO01 In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids set forth in any one of SEQ ID NOS: 11-76. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 11-76. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids set forth in any one of SEQ ID NOS: 55-76. In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1). In some embodiments, the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1). In some embodiments, the encoded SARS-CoV-2 spike protein is an immunogen (or Attorney Docket No.62801.28WO01 an immunogenic fragment and / or immunogenic variant thereof). In some embodiments, the nucleic acid molecule is RNA or DNA. In some embodiments, the RNA is messenger ribonucleic acid (mRNA). In some embodiments, the nucleic acid molecule comprises at least one modified nucleotide. In some embodiments, the nucleic acid molecule comprises N1-methyl-pseudouridine, cytosine, adenine, and guanine. In some embodiments, the nucleic acid molecule comprises a heterologous 5’- untranslated region (UTR), 3’-UTR, or both a 5’-UTR and 3’-UTR. In some embodiments, the nucleic acid molecule comprises a poly(A) sequence. In some embodiments, the nucleic acid molecule comprises a 5’cap structure. In some embodiments, the nucleotide sequence of the nucleic acid molecule is codon optimized. In some embodiments, the nucleic acid molecule further encodes a heterologous polypeptide or protein. In some embodiments, the nucleic acid molecule is recombinant. In some embodiments, the nucleic acid molecule is isolated. In some embodiments, the nucleic acid molecule encodes a signal peptide. In some embodiments, the nucleic acid molecule encodes a homologous or heterologous signal peptide. In some embodiments, the nucleic acid molecule does not encode a signal peptide. In one aspect, provided herein are vectors comprising a nucleic acid molecule described herein. In some embodiments, the vector is a non-viral vector (e.g., a plasmid) or a viral vector. In one aspect, provided herein are conjugates comprising a nucleic acid molecule described herein operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous moiety (e.g., a heterologous polypeptide or protein). In one aspect, provided herein are fusion proteins comprising the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) encoded by a nucleic acid molecule described herein operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous protein. In some embodiments, the heterologous protein is a trimerization domain. In some embodiments, the trimerization domain is operably connected to the encoded SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic Attorney Docket No.62801.28WO01 variant thereof)) via a peptide linker. In one aspect, provided herein are compositions comprising at least one nucleic acid molecule described herein, a vector described herein, a conjugate described herein, or a fusion protein described herein. In some embodiments, the composition is monovalent or polyvalent. In some embodiments, the composition is polyvalent. In some embodiments, the composition comprises a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the composition comprises a plurality of nucleic acid molecules described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the nucleic acid molecule(s) are comprised in one or more vectors. In some embodiments, the nucleic acid molecule(s) or the one or more vectors are formulated in one or more carrier. In some embodiments, the carrier is a lipid nanoparticle (LNP), liposome, lipoplex, or nanoliposome. In some embodiments, the carrier is an LNP. In some embodiments, the LNP comprises a cationic lipid, a neutral lipid, a cholesterol, and / or a PEG lipid. In some embodiments, the LNP has a mean particle size of between 80 nm and 160 nm. In some embodiments, the composition is a pharmaceutical composition comprising a pharmaceutically acceptable excipient or a vaccine composition. In some embodiments, the composition comprises an adjuvant. In one aspect, provided herein are SARS-CoV-2 spike proteins (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)), wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369 , 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike Attorney Docket No.62801.28WO01 protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) is hyper- glycosylated relative to a reference SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) (e.g., the SARS-CoV-2 spike protein set forth in SEQ ID NO: 1). In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, or more non-naturally occurring glycosylation motifs each comprising a non-naturally occurring glycosylation site, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the glycosylation motif is an N-linked glycosylation motif. In some embodiments, the N-linked glycosylation motif is an NXT sequence, wherein X is any amino acid except for proline. In some embodiments, the N-linked glycosylation motif is an NXS sequence, wherein X is any amino acid except for proline. In some embodiments, the glycosylation site is an N-linked glycosylation site. In some embodiments, the glycosylation motif is an O-linked glycosylation motif. In some embodiments, the O-linked glycosylation motif is a serine or threonine. In some embodiments, the glycosylation site is an O-linked glycosylation site. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and an N-linked glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N- linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and an N- glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at Attorney Docket No.62801.28WO01 position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N- linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N- linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N- linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., Attorney Docket No.62801.28WO01 the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and an N- glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and an Attorney Docket No.62801.28WO01 N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 354, 370, 394, 415, 428, 448, 468, 494, and / or 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the glycosylation motif is an N-linked glycosylation motif. In some embodiments, N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline. In some embodiments, the glycosylation site is an N-linked glycosylation site. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth Attorney Docket No.62801.28WO01 in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative Attorney Docket No.62801.28WO01 to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N- linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid Attorney Docket No.62801.28WO01 position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and an N- glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and an N- glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth Attorney Docket No.62801.28WO01 in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 383, 441, 477, 517, and / or 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the glycosylation motif is an N-linked glycosylation motif. In some embodiments, the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline. In some embodiments, the glycosylation site is an N-linked glycosylation site. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif Attorney Docket No.62801.28WO01 comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N-glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine or a serine at position 443 and an N-glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine or a serine at position 479 and an N-glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine or a serine at position 519 and an N-glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N-linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine or a serine at position 520 and an N- glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N-glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine at position 443 and an N-glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine at position 479 and an N-glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine at position 519 and an N-glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N- Attorney Docket No.62801.28WO01 linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine at position 520 and an N-glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more naturally occurring glycosylation sites. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a naturally occurring glycosylation site) at one or more of amino acid positions 331 and / or 343, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the SARS-CoV-2 spike protein (e.g., the SARS-CoV- 2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) relative the reference sequence (e.g., SEQ ID NO: 1). In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the SARS-CoV-2 spike protein (e.g., the SARS-CoV- 2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) )) in a prefusion state relative the reference sequence (e.g., SEQ ID NO: 1). In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic Attorney Docket No.62801.28WO01 variant thereof)) comprises an inactive furin cleavage site. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least one amino acid variation in the furin cleavage site that inactivates the furin cleavage site. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at one or more of position 817, 892, 899, 986, and / or 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 986 and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 817, 892, 899, 986, and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS- CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a Attorney Docket No.62801.28WO01 threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS- CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at Attorney Docket No.62801.28WO01 position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and a Attorney Docket No.62801.28WO01 glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N- linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a Attorney Docket No.62801.28WO01 glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked Attorney Docket No.62801.28WO01 glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising Attorney Docket No.62801.28WO01 an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, Attorney Docket No.62801.28WO01 amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N- linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a Attorney Docket No.62801.28WO01 glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked Attorney Docket No.62801.28WO01 glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino Attorney Docket No.62801.28WO01 acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. Attorney Docket No.62801.28WO01 In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N- linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N- linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif Attorney Docket No.62801.28WO01 comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a Attorney Docket No.62801.28WO01 glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine Attorney Docket No.62801.28WO01 at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising Attorney Docket No.62801.28WO01 an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N- linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic Attorney Docket No.62801.28WO01 variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 Attorney Docket No.62801.28WO01 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. Attorney Docket No.62801.28WO01 In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N- linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set Attorney Docket No.62801.28WO01 forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at Attorney Docket No.62801.28WO01 position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising Attorney Docket No.62801.28WO01 an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N- linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an Attorney Docket No.62801.28WO01 N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a Attorney Docket No.62801.28WO01 glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., Attorney Docket No.62801.28WO01 the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 502 and a glycosylation site at position 504, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496, and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at Attorney Docket No.62801.28WO01 position 503, and a threonine at position 504, and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, or 6) of (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, and / or 22) of a cysteine at position 379, a tyrosine at position 380, a proline at Attorney Docket No.62801.28WO01 position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, and / or 10) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and / or a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and / or 12) of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic Attorney Docket No.62801.28WO01 variant thereof)) comprises of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of the SARS-CoV-2 spike protein receptor binding domain (RBD). In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of a full-length SARS-CoV-2 spike protein. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises from about 10-15, 10- 20, 10-30, 10-40, 10-50, 10-60, 10-70, 10-80, 10-90, 10-100, 10-200, 10-300, 10-400, 10-500, 10- 600, 10-700, 10-800, 10-900, 10-1000, 10-1100, 10-1190, 10-1300, 100-200, 100-300, 100-400, 100-500, 100-600, 100-700, 100-800, 100-900, 100-1000, 100-1100, 100-1190, or 100-1300 Attorney Docket No.62801.28WO01 amino acids. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids set forth in any one of SEQ ID NOS: 11-76. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 11- 76]. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids set forth in any one of SEQ ID NOS: 55-76. In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1). In some embodiments, the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1). Attorney Docket No.62801.28WO01 In some embodiments, the SARS-CoV-2 spike protein is an immunogen (or an immunogenic fragment and / or immunogenic variant thereof). In some embodiments, the SARS-CoV-2 spike protein is recombinant. In some embodiments, the SARS-CoV-2 spike protein is isolated. In some embodiments, the SARS-CoV-2 spike protein comprises a signal peptide. In some embodiments, the SARS-CoV-2 spike protein comprises a homologous or heterologous signal peptide. In some embodiments, the SARS-CoV-2 spike protein does not comprise a signal peptide. In one aspect, provided herein are conjugates comprising a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) described herein operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous moiety (e.g., a heterologous polypeptide or protein). In one aspect, provided herein are fusion proteins comprising a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) described herein operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous protein. In some embodiments, the heterologous protein is a trimerization domain. In some embodiments, the trimerization domain is operably connected to the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) via a peptide linker. In one aspect, provided herein are compositions comprising at least one SARS-CoV-2 spike proteins (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) described herein, a conjugate described herein, or a fusion protein described herein. In some embodiments, the composition is monovalent or polyvalent. In some embodiments, the composition is polyvalent. In some embodiments, the composition comprises a plurality SARS-CoV-2 spike proteins (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)), wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) of the plurality is different. In some embodiments, the composition comprises a plurality of SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic Attorney Docket No.62801.28WO01 variant thereof)) described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) of the plurality is different. In some embodiments, the SARS-CoV-2 spike protein(s) (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) are formulated in one or more carrier. In some embodiments, the carrier is a lipid nanoparticle (LNP), liposome, lipoplex, or nanoliposome. In some embodiments, the carrier is an LNP. In some embodiments, the LNP comprises a cationic lipid, a neutral lipid, a cholesterol, and / or a PEG lipid. In some embodiments, the LNP has a mean particle size of between 80 nm and 160 nm. In some embodiments, the composition is a pharmaceutical composition comprising a pharmaceutically acceptable excipient or a vaccine composition. In some embodiments, the composition further comprises an adjuvant. In one aspect, provided herein are nucleic acid molecules encoding a SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein. In one aspect, provided herein are SARS-CoV-2 spike proteins (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) encoded by a nucleic acid molecule described herein. In one aspect, provided herein are carriers comprising a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein. In some embodiments, the carrier is monovalent or polyvalent. In some embodiments, the carrier is polyvalent. In some embodiments, the composition comprises a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the composition comprises a plurality of nucleic acid molecules described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein Attorney Docket No.62801.28WO01 immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)), wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different. In some embodiments, the composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different. In some embodiments, the carrier is a lipid nanoparticle (LNP), liposome, lipoplex, or nanoliposome. In some embodiments, the carrier is an LNP. In some embodiments, the LNP comprises a cationic lipid, a neutral lipid, a cholesterol, and / or a PEG lipid. In some embodiments, the LNP has a mean particle size of between 80 nm and 160 nm. In one aspect, provided herein are vaccine compositions comprising a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, or a pharmaceutical composition described herein. In some embodiments, the vaccine composition is a prime vaccine composition. In some embodiments, the vaccine composition is a boost vaccine composition. In some embodiments, the vaccine composition is a prime vaccine composition and a boost vaccine composition. In some embodiments, the vaccine composition can be utilized as a prime vaccine composition and / or a booster vaccine composition in a homologous or heterologous prime boost vaccine regimen. In some embodiments, the vaccine composition is monovalent or polyvalent. In some embodiments, the vaccine composition is polyvalent. In some embodiments, the vaccine composition comprises a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., Attorney Docket No.62801.28WO01 SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the vaccine composition comprises a plurality of nucleic acid molecules described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS- CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the vaccine composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)), wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different. In some embodiments, the vaccine composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different. In some embodiments, the vaccine composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein, comprising a trimer of a SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein. In some embodiments, the vaccine composition further comprises an adjuvant. In one aspect, provided herein are vaccine compositions comprising a messenger ribonucleic acid (mRNA) encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) that comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369 , 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1, formulated in a lipid nanoparticle, the vaccine composition having the following characteristics: (a) the LNPs comprise a cationic lipid, a neutral lipid, a cholesterol, and a PEG lipid, (b) the LNPs have a mean particle size of between 80 nm and 160 nm, and (c) the mRNA comprises: (i) a 5'-cap structure; (ii) a 5'-UTR; (iii) N1-methyl-pseudouridine, cytosine, adenine, and guanine; (iv) a 3'-UTR; and (v) a poly-A region. Attorney Docket No.62801.28WO01 In one aspect, provided herein are pharmaceutical compositions comprising a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, or a vaccine composition described herein, and a pharmaceutically acceptable excipient. In some embodiments, the pharmaceutical composition is monovalent or polyvalent. In some embodiments, the pharmaceutical composition is polyvalent. In some embodiments, the pharmaceutical composition comprises a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the pharmaceutical composition comprises a plurality of nucleic acid molecules described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different. In some embodiments, the pharmaceutical composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)), wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different. In some embodiments, the pharmaceutical composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS- Co described herein V-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different. In some embodiments, the pharmaceutical composition comprises a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein, comprising a trimer of a SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) described herein. In some embodiments, the pharmaceutical composition further comprises an adjuvant. Attorney Docket No.62801.28WO01 In one aspect, provided herein are pharmaceutical compositions comprising a messenger ribonucleic acid (mRNA) encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV- 2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) that comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369 , 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1, formulated in a lipid nanoparticle, the pharmaceutical composition having the following characteristics: (a) the LNPs comprise a cationic lipid, a neutral lipid, a cholesterol, and a PEG lipid, (b) the LNPs have a mean particle size of between 80 nm and 160 nm, and (c) the mRNA comprises: (i) a 5'-cap structure; (ii) a 5'-UTR; (iii) N1-methyl-pseudouridine, cytosine, adenine, and guanine; (iv) a 3'-UTR; and (v) a poly-A region; and a pharmaceutically acceptable excipient. In one aspect, provided herein are host cells comprising a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein. In one aspect, provided herein are kits comprising a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein. In some embodiments, the kit comprises instructions for use of the nucleic acid molecule, vector, protein (or immunogenic fragment or immunogenic variant thereof), conjugate, fusion protein, carrier, composition, vaccine composition, or pharmaceutical composition. In one aspect, provided herein are methods of delivering a nucleic acid molecule, vector, protein (or immunogenic fragment or immunogenic variant thereof), conjugate, fusion protein, host cell, carrier, composition, vaccine composition, or pharmaceutical composition to a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or Attorney Docket No.62801.28WO01 immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby deliver the nucleic acid molecule, the vector, the SARS- CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the host cell, the carrier, the composition, the vaccine composition, or the pharmaceutical composition to the subject. In one aspect, provided herein are methods of inducing or enhancing an immune response in a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby induce or enhance an immune response in the subject. In one aspect, provided herein are methods of inducing or enhancing an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby induce or enhance an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject. In one aspect, provided herein are methods of preventing or decreasing an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical Attorney Docket No.62801.28WO01 composition described herein, to thereby prevent or decrease an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject. In one aspect, provided herein are methods of inducing or enhancing an immune response against a plurality of strains of SARS-CoV-2 virus in a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS- CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby induce or enhance an immune response against a plurality of strains of SARS-CoV-2 virus in the subject. In one aspect, provided herein are methods of preventing, ameliorating, or treating a SARS-CoV-2 infection in a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby prevent, ameliorate, or treat the SARS-CoV-2 infection in the subject. In one aspect, provided herein are methods of preventing, ameliorating, or treating an infection by a plurality of SARS-CoV-2 strains in a subject in need thereof, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby prevent, ameliorate, or treat an infection by a plurality of SARS-CoV-2 strains in the subject. In one aspect, provided herein are methods of vaccinating a subject against SARS- CoV-2, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described Attorney Docket No.62801.28WO01 herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby vaccinate the subject against SARS-CoV-2. In one aspect, provided herein are methods of vaccinating a subject against SARS- CoV-2, the method comprising administering to the subject (a) an mRNA molecule (e.g., an mRNA molecule described herein) encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein or polypeptide immunogen (or immunogenic fragment and / or immunogenic variant thereof)) described herein (or a conjugate or fusion protein thereof), (b) a vector comprising the mRNA molecule, (c) a carrier comprising the mRNA molecule or the vector, (d) a vaccine composition comprising the mRNA molecule, the vector, or the carrier, or (e) a pharmaceutical composition comprising the mRNA molecule, the vector, the carrier, or the vaccine composition, to thereby vaccinate the subject against SARS-CoV-2, to thereby vaccinate the subject against SARS-CoV-2. In one aspect, provided herein are methods of vaccinating a subject against SARS- CoV-2, the method comprising administering to the subject a vaccine composition described herein or a pharmaceutical composition described herein, to thereby vaccinate the subject against SARS-CoV-2. In one aspect, provided herein are methods of vaccinating a subject against a plurality of strains of SARS-CoV-2, the method comprising administering to the subject a nucleic acid molecule described herein, a SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) described herein, a vector described herein, a conjugate described herein, a fusion protein described herein, a host cell described herein, a carrier described herein, a composition described herein, a vaccine composition described herein, or a pharmaceutical composition described herein, to thereby vaccinate the subject against a plurality of strains of SARS-CoV-2. For the sake of clarity, it should be understood that the following embodiments relate to any of the above forementioned methods. In some embodiments, the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the carrier, the composition, the vaccine composition, or the pharmaceutical composition is administered to the subject at least Attorney Docket No.62801.28WO01 twice. In some embodiments, the subject is a human. In some embodiments, the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the carrier, the composition, the vaccine composition, or the pharmaceutical composition is administered as a prime and / or a boost in a homologous or heterologous prime- boost regimen. In some embodiments, the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the carrier, the composition, the vaccine composition, or the pharmaceutical composition is administered as a boost in a heterologous prime-boost regimen. 4. BRIEF DESCRIPTION OF THE FIGURES FIGS. 1A-1C depicts a sequence alignment of the amino acid sequence of a reference SARS-CoV-2 spike protein Wuhan-Hu-1 Spike protein sequence (SEQ ID NO: 1) and a variant thereof (SEQ ID NO: 9). 5. DETAILED DESCRIPTION SARS-CoV-2 continues to evolve into new variants comprising a variety of amino acid variations, e.g., substitutions, deletions, and insertions. Many of the variations are found in the RBD of the spike protein, which is vital for SARS-CoV-2 entry into the cell. As most of the SARS- CoV-2 vaccines and current antibody therapies target the RBD of the spike protein, this creates the potential for the evolution of SARS-CoV-2 variants that evade vaccine-induced immunity, infection-induced immunity, and / or current antibody therapies. The inventors have identified novel engineered glycosylation sites within the SARS-CoV-2 spike protein (e.g., in the RBD) that shield select epitopes from immune recognition, while leaving target epitopes (e.g., evolutionary conserved epitopes) exposed. Accordingly, novel SARS-CoV-2 spike proteins (e.g., SARS-CoV- 2 spike protein immunogens (and immunogenic fragments and / or immunogenic variants thereof)) (or nucleic acid molecules, e.g., mRNAs, encoding such SARS-CoV-2 spike proteins) comprising at least one such non-naturally occurring glycosylation site are good candidates for variant-proof or variant-resistant pan-SARS-CoV-2 vaccines. As such, the current disclosure provides, inter alia, novel immunogens for use in pharmaceutical compositions and vaccines to induce a desired Attorney Docket No.62801.28WO01 immune response against one or more (e.g., multiple) variants of SARS-CoV-2. TABLE OF CONTENTS 5.1 Definitions 5.2 Glycoengineered SARS-CoV-2 Spike Proteins (e.g., Immunogens) & Fragments Thereof (e.g., RBDs) 5.2.1 Engineered Glycosylation Sites 5.2.2 Engineered Glycosylation Motifs 5.2.3 Exemplary Sets of Engineered Glycosylation Sites & Motifs 5.2.4 Exemplary Glycoengineered SARS-CoV-2 Spike Proteins (e.g., Immunogens) & Fragments Thereof 5.2.5 Structure of SARS-CoV-2 Spike Proteins (e.g., Immunogens) 5.2.6 Exemplary Additional Features of SARS-CoV-2 Spike Proteins (e.g., Immunogens) 5.2.6.1 Hyperglycosylation 5.2.6.2 Stabilization 5.6.3.2 Multimerization (e.g., Trimerization) Domains 5.2.6.4 Variations from Different Strains of SARS-CoV-2 5.2.6.5 Conserved Structural Elements 5.3 Nucleic Acid Molecules 5.3.1 DNA Nucleic Acids 5.3.2 RNA Nucleic Acids 5.4 Fusions & Conjugates 5.5 Compositions (e.g., Vaccine Compositions) 5.5.1 Peptide and Protein-Based Vaccines 5.5.2 Nucleic Acid-Based Vaccines 5.6 Vectors 5.7 Carriers 5.7.1 Lipid Based Carriers / Lipid Nanoformulations 5.7.1.1 Cationic Lipids (Positively Charged) and Ionizable Lipids 5.7.1.2 Non-Cationic Lipids (e.g., Phospholipids) 5.7.1.3 Structural Lipids Attorney Docket No.62801.28WO01 5.7.1.4 Polymers and Polyethylene Glycol (PEG) - Lipids 5.7.1.5 Percentages of Lipid Nanoformulation Components 5.8 Pharmaceutical Compositions 5.9 Adjuvants 5.10 Methods of Use 5.10.1 Methods of Delivery 5.10.2 Manufacture of a Medicament 5.10.3 Methods of Inducing or Enhancing an Immune Response 5.10.4 Methods of Preventing or Decreasing an Immune Response 5.10.5 Methods of Preventing, Ameliorating, and / or Treating Infection 5.10.6 Methods of Vaccination against SARS-CoV-2 5.10.6.1 Methods of Vaccinating a Subject against SARS-CoV-2 5.10.6.2 Methods of Vaccinating a Subject Utilizing a SARS-CoV-2 mRNA Vaccine 5.11 Kits 5.1 Definitions The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which the claimed subject matter belongs. It is to be understood that the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of any subject matter claimed. In this application, the use of the singular includes the plural unless specifically stated otherwise. For example, as used in the specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Furthermore, use of the term “including” as well as other forms, such as “include,” “includes,” and “included,” is not limiting. It is understood that wherever aspects are described herein with the language “comprising,” otherwise analogous aspects described in terms of “consisting of” and “consisting essentially of” are also provided. Attorney Docket No.62801.28WO01 The term “and / or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term “and / or” as used in a phrase such as “A and / or B” herein is intended to include “A and B,” “A or B,” “A” (alone), and “B” (alone). Likewise, the term “and / or” as used in a phrase such as “A, B, and / or C” is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone). As described herein, any concentration range, percentage range, ratio range or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. The terms “about” or “comprising essentially of” refer to a value or composition that is within an acceptable error range for the particular value or composition as determined by one of ordinary skill in the art, which will depend in part on how the value or composition is measured or determined, i.e., the limitations of the measurement system. When particular values or compositions are provided in the application and claims, unless otherwise stated, the meaning of “about” or “comprising essentially of” should be assumed to be within an acceptable error range for that particular value or composition. Where proteins and / or polypeptides are described herein, it is understood that polynucleotides (e.g., RNA (e.g., mRNA) or DNA nucleic acid molecules) encoding the protein or polypeptide are also provided herein. Where proteins, polypeptides, nucleic acid molecules, vectors, carriers, etc. are described herein, it is understood that isolated forms of the proteins, polypeptides, nucleic acid molecules, vectors, carriers, etc. are also provided herein. Where proteins, polypeptides, nucleic acid molecules, etc. are described herein, it is understood that recombinant forms of the proteins, polypeptides, nucleic acid molecules, etc. are also provided herein. Where polypeptides or sets of polypeptides are described herein, it is understood that proteins comprising the polypeptides or sets of polypeptides folded into their three-dimensional structure (i.e., tertiary or quaternary structure) are also provided herein and vice versa. As used herein, the term “adjuvant” refers to a substance that causes stimulation of the immune system of a subject when administered to the subject. Attorney Docket No.62801.28WO01 As used herein, the term “administering” refers to the physical introduction of an agent, e.g., a vaccine or therapeutic agent (or a precursor of the therapeutic agent that is metabolized or altered (e.g., translation of a nucleic acid molecule) within the body of the subject to produce the therapeutic agent in vivo) to a subject, using any of the various methods and delivery systems known to those skilled in the art. Administering can also be performed, for example, once, a plurality of times, and / or over one or more extended periods. The term administering includes self- administration. As used herein, the term “agent” is used generically to describe any macro or micro molecule. Exemplary moieties include, but are not limited to polypeptides, proteins, peptides, nucleic acid molecules (e.g., DNA, RNA), small molecules, carbohydrates, lipids, synthetic polymers (e.g., polymers of PEG). As used herein, the term “derived from,” with reference to a polynucleotide refers to a polynucleotide that has at least 70% sequence identity to a reference polynucleotide (e.g., a naturally occurring polynucleotide) or a fragment thereof. The term “derived from,” with reference to a polypeptide or protein refers to a polypeptide or protein that comprises an amino acid sequence that has at least 70% sequence identity to the amino acid sequence of a reference polypeptide or protein (e.g., a naturally occurring polypeptide or protein). The term “derived from” as used herein does not denote any specific process or method for obtaining the polynucleotide, polypeptide, or protein. For example, the polynucleotide, polypeptide, or protein can be recombinant produced or chemically synthesized. As used herein, the term “disease” refers to any abnormal condition that impairs physiological function. The term is used broadly to encompass any disorder, illness, abnormality, pathology, sickness, condition, or syndrome in which physiological function is impaired, irrespective of the nature of the etiology. The term disease includes infection (e.g., a viral (e.g., a SARS-Cov-2 infection), bacterial, fungal, protozoal infection). The terms “DNA” and “polydeoxyribonucleotide” are used interchangeably herein and refer to macromolecules that include multiple deoxyribonucleotides that are polymerized via phosphodiester bonds. Deoxyribonucleotides are nucleotides in which the sugar is deoxyribose. As used herein, the term “full-length” with reference to a SARS-CoV-2 spike protein refers to a SARS-CoV-2 spike protein, wherein the amino acid sequence of the SARS-CoV-2 spike protein comprises substantially the same number of amino acids as a reference SARS-CoV-2 spike Attorney Docket No.62801.28WO01 protein. As used herein, the term “fuse” and grammatical equivalents thereof refer to the operable connection of at least a first polypeptide or protein to a second polypeptide or protein, wherein the first and second polypeptides or proteins are not naturally found operably connected together. For example, the first and second polypeptides or proteins are derived from different proteins. The term fuse encompasses both a direct connection of the at least two polypeptides or proteins through a peptide bond, and the indirect connection through a linker (e.g., a peptide linker). As used herein, the term “glycosylation site” refers to the amino acid residue of a protein or peptide which is the attachment point for a glycan. For example, in N-linked glycosylation, the glycosylation site will be the asparagine residue to which the glycan is attached. For further example, in O-linked glycosylation, the glycosylation site will be the serine or threonine residue to which the glycan is attached. The term “non-naturally occurring glycosylation site” within a protein or peptide refers to a glycosylation site that is not found in a specific protein or peptide in nature. The non-naturally occurring glycosylation site can be generated by creating a non-naturally occurring glycosylation motif, which does not necessarily require varying the amino acid of the glycosylation site. For example, a non-naturally occurring glycosylation site would include a glycosylation site generated from the variation of a N-A-P amino acid sequence of a protein to a N-A-T amino acid sequence (creating an N-linked glycosylation motif) even though the amino acid that mediates attachment of the glycan (N) was not varied. As used herein, the term “glycosylation motif” refers to the amino acid or sequence of amino acids that comprises the glycosylation site and facilities glycosylation. For example, in N- linked glycosylation, the canonical glycosylation motifs are NXT and NXS, wherein X is any amino acid except for proline and the asparagine (N) residue is the glycosylation site. For further example, in O-linked glycosylation, the glycosylation motif is a S or T residue that also serves as the glycosylation site. As used herein, the term “fusion protein” and grammatical equivalents thereof refers to a protein that comprises at least one polypeptide operably connected to another polypeptide, wherein the first and second polypeptides are not naturally found operably connected together. For example, the first and second polypeptides of the fusion protein are each derived from different proteins. The at least two polypeptides of the fusion protein can be directly operably connected Attorney Docket No.62801.28WO01 through a peptide bond; or can be indirectly operably connected through a linker (e.g., a peptide linker). Therefore, for example, the term fusion polypeptide encompasses embodiments, wherein Polypeptide A is directly operably connected to Polypeptide B through a peptide bond (Polypeptide A – Polypeptide B), and embodiments, wherein Polypeptide A is operably connected to Polypeptide B through a peptide linker (Polypeptide A – peptide linker – Polypeptide B). As used herein, the term “half-life extension protein or “half-life extension polypeptide” refers to a polypeptide or protein that when operably connected to another moiety (e.g., a subject moiety) (e.g., a protein), increases the half-life of the subject moiety (e.g., the subject protein) in vivo when administered to a subject (e.g., a human subject). The pharmacokinetic properties of the protein can be evaluated utilizing in vivo models known in the art. As used herein, the term “heterologous”, when used to describe a first element in reference to a second element means that the first element and second element do not exist in nature disposed as described. For example, a polypeptide comprising a “heterologous moiety” means a polypeptide that is joined to a moiety (e.g., small molecule, polypeptide, polynucleotide, carbohydrate, lipid, synthetic polymer (e.g., polymers of PEG), etc.) that is not joined to the polypeptide in nature. As used, herein the term “heterologous signal peptide” refers to a signal peptide that is not operably connected to a subject polypeptide or protein in nature. For example, in reference to a polypeptide comprising a signal peptide from human IL-2 operably connected to human IL-12, the human IL-2 signal peptide would constitute a heterologous signal peptide. As used herein, the term “heterologous prime boost” refers to a prime boost vaccine regimen wherein the prime vaccine composition and the boost (or booster) vaccine composition are different (e.g., the immunogen is different, the form of the immunogen is different (e.g., a nucleic acid (e.g., mRNA) molecule-based vaccine versus a protein-based vaccine), the immunogen is expressed from a different vector (e.g., plasmid, viral vector), the method of delivering the immunogen to the subject is different, etc.). As used herein, the term “homologous signal peptide” refers to a signal peptide that is operably connected to a subject polypeptide or protein in nature. For example, in reference to a polypeptide comprising a signal peptide from human IL-2 operably connected to human IL-2, the human IL-2 signal peptide would constitute a homologous signal peptide. Attorney Docket No.62801.28WO01 As used herein, the term “homologous prime boost” refers to a prime boost vaccine regimen wherein the prime vaccine composition and the boost (or booster) vaccine composition are the same. As used herein, the term “immunogen” refers to a substance that is capable of inducing an immune response (e.g., an adaptive immune response) in a subject (e.g., a human subject). As used herein, the term “immunogenic fragment” refers to a fragment of a reference substance (e.g., a reference polypeptide or protein) that retains an immunogen. As used herein, the term “immunogenic variant” refers to a variant of a reference substance (e.g., a reference polypeptide or protein) that retains an immunogen. In some embodiments, the immunogenic variant is a polypeptide or protein that comprises at least one but no more than 25%, (e.g., no more than 20%, no more than 15%, no more than 12%, no more than 10%, no more than 8%) amino acid variation (e.g., substitutions, deletions, additions) compared to the amino acid sequence of a reference polypeptide or protein. As used herein, the term “in combination with” means that two (or more) different agents or treatments are administered to a subject as part of a defined treatment regimen for a particular disease. The treatment regimen defines the doses and periodicity of administration of each agent such that the effects of the separate agents on the subject overlap. In some embodiments, the delivery of the two or more agents is simultaneous or concurrent and the agents may be co- formulated. In other embodiments, the two or more agents are not co-formulated and are administered in a sequential manner as part of a prescribed regimen (e.g., a prime-boost vaccine regimen). In some embodiments, administration of two or more agents or treatments in combination is such that the reduction in a symptom, or other parameter related to the disease is greater than what would be observed with one agent or treatment delivered alone or in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive (e.g., synergistic). Sequential or substantially simultaneous administration of each agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues. The agents can be administered by the same route or by different routes. As used herein, the term “isolated” with reference to an agent (e.g., a polypeptide, protein, or nucleic acid molecule) refers to the agent (e.g., the polypeptide, protein, or nucleic acid molecule) that is substantially free of other cellular components with which it is associated in the Attorney Docket No.62801.28WO01 natural state. As used herein, the term “modification” in reference to a nucleic acid sequence refers to a nucleic acid molecule that comprises at least one nucleotide comprising a chemical modification, e.g., a modified sugar moiety, a modified nucleobase, and / or a modified internucleotide linkage, or any combination thereof. Exemplary nucleotide modifications are provided herein, see, e.g., § 5.3 (e.g., § 5.3.2). In certain embodiments of the instant disclosure, inclusion of a deoxynucleotide - which is acknowledged as a naturally occurring form of nucleotide - if present within an RNA molecule (e.g., an mRNA molecule) is considered to constitute a modified nucleotide. The terms “nucleic acid molecule” and “polynucleotide” are used interchangeably herein and refer to a polymer of DNA or RNA. The nucleic acid molecule can be single-stranded or double-stranded; contain natural, non-natural, or altered nucleotides; and contain a natural, non- natural, or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified nucleic acid molecule. Nucleic acid molecules include, but are not limited to, all nucleic acid molecules which are obtained by any means available in the art, including, without limitation, recombinant means, e.g., the cloning of nucleic acid molecules from a recombinant library or a cell genome, using ordinary cloning technology and polymerase chain reaction, and the like, and by synthetic means. The skilled artisan will appreciate that, except where otherwise noted, nucleic acid sequences set forth in the instant application will recite thymidine (T) in a representative DNA sequence but where the sequence represents RNA (e.g., mRNA), the thymidines (Ts) would be substituted for uracils (Us). Thus, any of the RNA polynucleotides encoded by a DNA identified by a particular sequence identification number may also comprise the corresponding RNA (e.g., mRNA) sequence encoded by the DNA, where each thymidine (T) of the DNA sequence is substituted with uracil (U). As used herein, the term “operably connected” refers to the linkage of two moieties in a functional relationship. For example, a polypeptide is operably connected to another polypeptide when they are linked (either directly or indirectly via a peptide linker) in frame such that both polypeptides are functional (e.g., a fusion protein described herein). Or for example, a transcription regulatory polynucleotide e.g., a promoter, enhancer, or other expression control element is operably connected to a polynucleotide that encodes a protein if it affects the transcription of the Attorney Docket No.62801.28WO01 polynucleotide that encodes the protein. The term “operably connected” can also refer to the conjugation of a moiety to e.g., a polynucleotide or polypeptide (e.g., the conjugation of a PEG polymer to a protein). As used herein, the term “peptide” refers to a polymer of at least two amino acids linked by peptide bonds. The term “peptide” does not limit the length of the polymer chain of amino acids. It is common in the art to refer to shorter polymers of amino acids (e.g., approximately 2- 50 amino acids) as peptides; and to refer to longer polymers of amino acids (e.g., approximately over 50 amino acids) as polypeptides. However, the terms “peptide” and “polypeptide” are used interchangeably herein. The determination of “percent identity” between two sequences (e.g., peptide or protein (amino acid sequences) or nucleic acid sequences)) can be accomplished using a mathematical algorithm. A specific, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin S & Altschul SF (1990) PNAS 87: 2264- 2268, modified as in Karlin S & Altschul SF (1993) PNAS 90: 5873-5877, each of which is herein incorporated by reference in its entirety. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul SF et al., (1990) J Mol Biol 215: 403, which is herein incorporated by reference in its entirety. BLAST nucleotide searches can be performed with the NBLAST nucleotide program parameters set, e.g., for score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid molecule described herein. BLAST protein searches can be performed with the XBLAST program parameters set, e.g., to score 50, wordlength=3 to obtain amino acid sequences homologous to a protein molecule described herein. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul SF et al., (1997) Nuc Acids Res 25: 3389-3402, which is herein incorporated by reference in its entirety. Alternatively, PSI BLAST can be used to perform an iterated search which detects distant relationships between molecules (Id.). When utilizing BLAST, Gapped BLAST, and PSI Blast programs, the default parameters of the respective programs (e.g., of XBLAST and NBLAST) can be used (see, e.g., National Center for Biotechnology Information (NCBI) on the worldwide web, ncbi.nlm.nih.gov). Another specific, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4:11-17, which is herein incorporated by reference in its entirety. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. Attorney Docket No.62801.28WO01 When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. The percent identity between two sequences can be determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted. As used herein the term “pharmaceutical composition” means a composition that is suitable for administration to an animal, e.g., a human subject, and comprises a therapeutic agent and a pharmaceutically acceptable carrier or diluent. A “pharmaceutically acceptable carrier or diluent” means a substance for use in contact with the tissues of human beings and / or non-human animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable therapeutic benefit / risk ratio. As used herein, the term “plurality” means 2 or more (e.g., 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 9 or more, or 10 or more). As used herein, the term “poly(A) sequence,” refers to a sequence of adenosine nucleotides, typically located at the 3’-end of a linear RNA (or in a circular RNA), of up to about 1000 adenosine nucleotides. In some embodiments, the poly(A) sequence is essentially homopolymeric, e.g., a poly(A) sequence of e.g., 100 adenosine nucleotides has essentially the length of 100 nucleotides. In other embodiments, the poly(A) sequence may be interrupted by at least one nucleotide different from an adenosine nucleotide, e.g., a poly(A) sequence of e.g., 100 adenosine nucleotides may have a length of more than 100 nucleotides (comprising 100 adenosine nucleotides and in addition said at least one nucleotide - or a stretch of nucleotides - different from an adenosine nucleotide). It has to be understood that “poly(A) sequence” as defined herein typically relates to RNA - however in the context of the invention, the term likewise relates to corresponding sequences in a DNA molecule (e.g. a “poly(T) sequence”). As used herein, the term “polyvalent vaccine” refers to a vaccine that contains a plurality of different immunogens. In some embodiments, the polyvalent vaccine comprises a plurality of immunogens from more than one strain of a virus, different immunogens from the same strain of a virus, or any combination thereof. In some embodiments, the polyvalent vaccine comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more different Attorney Docket No.62801.28WO01 immunogens or nucleic acid molecules encoding the immunogens. As used herein, the term “prime boost” refers to a vaccine regimen comprising at least an initial vaccine dose and one or more subsequent vaccine doses. The initial vaccine dose comprises the prime vaccine composition and the one or more subsequent vaccine doses are referred to as boost (or booster) vaccine compositions. Prime boost vaccine regimens can comprise more than one booster (e.g., 2, 3, 4, 5, 6, or more, etc.). A “prophylactic” treatment is a treatment administered to a subject who does not exhibit signs of a disease or exhibits only early signs for the purpose of decreasing the risk of developing pathology. As used herein, the term “protein” refers to a one or more peptides folded into its three- dimensional structure. As used herein, the term “receptor binding domain” or “RBD” in reference to the SARS-CoV-2 spike protein refers to a functional fragment of a SARS-CoV-2 spike protein that is capable of binding to ACE2. The amino acid sequence of an exemplary reference SARS-CoV-2 spike protein RBD is set forth in SEQ ID NO: 3. The terms “RNA” and “polyribonucleotide” are used interchangeably herein and refer to macromolecules that include multiple ribonucleotides that are polymerized via phosphodiester bonds. Ribonucleotides are nucleotides in which the sugar is ribose. RNA may contain modified nucleotides; and contain natural, non-natural, or altered internucleotide linkages, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified nucleic acid molecule. As used herein, the term “SARS-CoV-2 spike protein” refers to the SARS-CoV-2 protein that mediates binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). An exemplary amino acid sequence of a reference full-length SARS-CoV-2 spike protein is set forth in SEQ ID NO: 1. The term SARS-CoV-2 spike protein includes naturally occurring and engineered variants. As used herein, the term “set” with reference to glycosylation sites (e.g., non-naturally occurring glycosylation sites) does not require more than glycosylation site (e.g., non-naturally occurring glycosylation site). For example, Table 2 herein describe “sets” glycosylation sites (e.g., non-naturally occurring glycosylation sites), some sets have only one glycosylation site (e.g., non- naturally occurring glycosylation site) and some sets have more than one glycosylation site (e.g., Attorney Docket No.62801.28WO01 non-naturally occurring glycosylation site). As used herein, the term “signal peptide” or “signal sequence” refers to a sequence (e.g., an amino acid sequence) that can direct the transport or localization of a protein to a certain organelle, cell compartment, or extracellular export. The term encompasses both the signal peptide (the amino acid sequence of the signal peptide) and the nucleic acid sequence encoding the signal peptide. Thus, references to a signal peptide in the context of a nucleic acid molecule refers to the nucleic acid sequence encoding the signal peptide. As used herein, the term “subject” includes any animal, such as a human or other animal. In embodiments, the subject is a vertebrate animal (e.g., mammal, bird, fish, reptile, or amphibian). In embodiments, the subject is a human. In embodiments, the method subject is a non- human mammal. In embodiments, the subject is a non-human mammal is such as a non-human primate (e.g., monkeys, apes), ungulate (e.g., cattle, buffalo, sheep, goat, pig, camel, llama, alpaca, deer, horses, donkeys), carnivore (e.g., dog, cat), rodent (e.g., rat, mouse), or lagomorph (e.g., rabbit). In embodiments, the subject is a bird, such as a member of the avian taxa Galliformes (e.g., chickens, turkeys, pheasants, quail), Anseriformes (e.g., ducks, geese), Paleaognathae (e.g., ostriches, emus), Columbiformes (e.g., pigeons, doves), or Psittaciformes (e.g., parrots). A “therapeutically effective amount” of an agent (e.g., a therapeutic agent, a vaccine) refers to any amount of the agent (e.g., the therapeutic agent, the vaccine) that, when used alone or in combination with another agent (e.g., a therapeutic agent, a vaccine), protects a subject against the onset of a disease (e.g., an infection), ameliorates the severity of a disease (e.g., an infection), and / or promotes disease (e.g., infection) regression evidenced by a decrease in severity of disease (e.g., infection) symptoms, an increase in frequency and duration of disease (e.g., infection) symptom-free periods, or a prevention of impairment or disability due to the disease (e.g., infection) affliction. The ability of an agent (e.g., a therapeutic agent, a vaccine) to do any of the foregoing (or any combination thereof) can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays. As used herein, the term “translatable RNA” refers to any RNA that encodes at least one polypeptide or protein and can be translated to produce the encoded polypeptide or protein in vitro, in vivo, in situ or ex vivo. A translatable RNA may be an mRNA or a circular RNA encoding a polypeptide or protein. Attorney Docket No.62801.28WO01 As used herein, the terms “treat,” treating,” “treatment,” and the like refer to reducing or ameliorating a disease or infection and / or symptom(s) associated therewith or obtaining a desired pharmacologic and / or physiologic effect. It will be appreciated that, although not precluded, treating a disease or infection does not require that the disease or infection, or symptom(s) associated therewith be completely eliminated. In some embodiments, the effect is therapeutic, i.e., without limitation, the effect partially or completely reduces, diminishes, abrogates, abates, alleviates, decreases the intensity of, or cures a disease and / or adverse symptom attributable to the disease or infection. In some embodiments, the effect is preventative, i.e., the effect protects or prevents an occurrence or reoccurrence of a disease or infection. To this end, the presently disclosed methods comprise administering a therapeutically effective amount of a compositions as described herein. As used herein, the term “variant” or “variation” with reference to a nucleic acid molecule, refers to a nucleic acid molecule that comprises at least one substitution, alteration, inversion, addition, or deletion of nucleotide compared to a reference nucleic acid molecule. As used herein, the term “variant” or “variation” with reference to a peptide or protein refers to a peptide or protein that comprises at least one substitution, alteration, inversion, addition, or deletion of an amino acid residue compared to a reference peptide or protein. As used herein, the term “5’-untranslated region” or “5’-UTR” refers to a part of a nucleic acid molecule located 5’ (i.e., “upstream”) of a coding sequence and which is not translated into protein. Typically, a 5’-UTR starts with the transcriptional start site and ends before the start codon of the coding sequence. A 5’-UTR may comprise elements for controlling gene expression, also called regulatory elements. Such regulatory elements may be, e.g., ribosomal binding sites, miRNA binding sites etc. The 5’-UTR may be post-transcriptionally modified, e.g., by enzymatic or post-transcriptional addition of a 5’-cap structure. As used herein the term “3’-untranslated region” or “3’-UTR” refers to a part of a nucleic acid molecule located 3’ (i.e., downstream) of a coding sequence and which is not translated into protein. A 3’-UTR may located between a coding sequence and an (optional) terminal poly(A) sequence of a nucleic acid sequence. A 3'-UTR may comprise elements for controlling gene expression, also called regulatory elements. Such regulatory elements may be, e.g., ribosomal binding sites, miRNA binding sites etc. 5.2 Glycoengineered SARS-CoV-2 Spike Proteins (e.g., Immunogens) & Fragments Attorney Docket No.62801.28WO01 Thereof (e.g., RBDs) Provided herein are, inter alia, SARS-CoV-2 spike proteins and polypeptides (e.g., SARS-CoV-2 spike protein and polypeptide immunogens (and immunogenic fragments and / or immunogenic variants thereof (e.g., receptor binding domains thereof))) and nucleic acid molecules encoding the same, that comprise one or more non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site (e.g., a non-naturally occurring glycosylation site at one or more of positions 369, 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1). The SARS-CoV-2 spike glycoprotein mediates viral entry into host cells. The spike protein comprises two functional subunits responsible for binding to the host cell receptor (S1 subunit) and fusion of the viral and cellular membranes (S2 subunit). The SARS-CoV-2 spike protein is cleaved at the boundary between the S1 and S2 subunits, which remain non-covalently associated in the prefusion conformation. The distal S1 subunit comprises the RBD and contributes to stabilization of the prefusion state of the membrane anchored S2 subunit that contains the fusion machinery. The RBD mediates binding to the host cell receptor ACE2. The spike protein is cleaved by host proteases at the so-called S2' site located immediately upstream of the fusion peptide. This cleavage has been proposed to activate the protein for membrane fusion via extensive irreversible conformational changes. (See, e.g., Walls, Alexandra C et al. “Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein.” Cell vol. 181,2 (2020): 281-292.e6. doi:10.1016 / j.cell.2020.02.058, the entire contents of which is incorporated herein by reference for all purposes). The amino acid sequence of a first reference immature SARS-CoV-2 spike protein (Wuhan-Hu-1) is provided in SEQ ID NO: 1. The signal peptide is underlined (amino acids 1-13 of SEQ ID NO: 1); the amino acid sequence of the corresponding mature first reference SARS- CoV-2 spike protein lacking the native signal peptide is provided in SEQ ID NO: 2. The amino acid sequence of a RBD of the first reference SARS-CoV-2 spike protein is set forth in SEQ ID NO: 3 and SEQ ID NO: 4. The amino acid sequence of a second reference immature SARS-CoV-2 spike protein is provided in SEQ ID NO: 5. The signal peptide is underlined (amino acids 1-13 of SEQ ID NO: 5); the amino acid sequence of the corresponding mature second reference SARS-CoV-2 spike protein lacking the native signal peptide is provided in SEQ ID NO: 6. The amino acid sequence Attorney Docket No.62801.28WO01 of the second reference SARS-CoV-2 spike protein comprises a glycine at position 614 and a proline at each of positions 817, 892, 899, 942, 986, and 987, amino acid numbering relative to SEQ ID NO: 1 (the Wuhan-Hu-1 Spike Numbering System described herein). The amino acid sequence of a second reference immature SARS-CoV-2 spike protein is provided in SEQ ID NO: 7. The signal peptide is underlined (amino acids 1-13 of SEQ ID NO: 7); the amino acid sequence of the corresponding mature second reference SARS-CoV-2 spike protein lacking the native signal peptide is provided in SEQ ID NO: 8. The amino acid sequence of the second reference SARS-CoV-2 spike protein comprises a proline at each of positions 817, 892, 899, 942, 986, and 987, amino acid numbering relative to SEQ ID NO: 1. The amino acid sequence of a fourth reference immature SARS-CoV-2 spike protein is provided in SEQ ID NO: 9. The signal peptide is underlined (amino acids 1-13 of SEQ ID NO: 9); the amino acid sequence of the corresponding mature second reference SARS-CoV-2 spike protein lacking the native signal peptide is provided in SEQ ID NO: 10. Table 1. Reference SARS-CoV-2 Spike Proteins and RBDs Thereof. Description Amino Acid Sequence SEQ ID NO Attorney Docket No.62801.28WO01 ATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVT YVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQR NFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSF Attorney Docket No.62801.28WO01 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDK VFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNP Attorney Docket No.62801.28WO01 PIKDFGGFNFSQILPDPSKPSKRSPIEDLLFNKVTLADAGF IKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYT SALLAGTITSGWTFGAGPALQIPFPMQMAYRFNGIGVTQNV Attorney Docket No.62801.28WO01 peptideGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT AGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEV Attorney Docket No.62801.28WO01 AEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKM SECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPA QEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYE t s stan ar n t e art to num er t e am no ac pos t ons w t n a g ven - oV- 2 spike protein according to the corresponding amino acid position in the Wuhan-Hu-1 Spike reference sequence (SEQ ID NO: 1). As such, unless otherwise indicated, the designation of amino acid positions in the amino acid sequence of a SARS-Cov-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) herein is relative to the amino acid sequence of SEQ ID NO: 1. A person of ordinary skill in the art can determine the corresponding amino acid for a Attorney Docket No.62801.28WO01 given amino acid position in any query spike protein by (i) aligning the amino acid sequence of the Wuhan-Hu-1 Spike reference sequence (SEQ ID NO: 1) to the amino acid sequence of the query spike protein, (ii) locating the relevant amin...

Claims

Attorney Docket No.62801.28WO01 CLAIMS What is claimed is:

1. A nucleic acid molecule comprising at least one coding region encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)), wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a non-naturally occurring glycosylation motif comprising a non- naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369, 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

2. The nucleic acid molecule of claim 1, wherein the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) is hyper-glycosylated relative to a reference SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) (e.g., the SARS-CoV-2 spike protein set forth in SEQ ID NO: 1).

3. The nucleic acid molecule of claim 1 or 2, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, or more non-naturally occurring glycosylation motifs each comprising a non-naturally occurring glycosylation site, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

4. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation motif is an N-linked glycosylation motif.

5. The nucleic acid molecule of any one of the preceding claims, wherein the N-linked glycosylation motif is an NXT sequence, wherein X is any amino acid except for proline.

6. The nucleic acid molecule of any one of the preceding claims, wherein the N-linked glycosylation motif is an NXS sequence, wherein X is any amino acid except for proline.

7. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation site is an N-linked glycosylation site.Attorney Docket No.62801.28WO01 8. The nucleic acid molecule of any one of claims 1-3, wherein the glycosylation motif is an O-linked glycosylation motif.

9. The nucleic acid molecule of claim 8, wherein the O-linked glycosylation motif is a serine or threonine.

10. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation site is an O-linked glycosylation site.

11. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and an N-linked glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and an N- glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and an N- glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and an N- glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and an N- glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / orAttorney Docket No.62801.28WO01 (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and an N- glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

12. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and an N-glycosylation site at aminoAttorney Docket No.62801.28WO01 acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

13. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 14. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

15. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of aminoAttorney Docket No.62801.28WO01 acid positions 354, 370, 394, 415, 428, 448, 468, 494, and / or 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

16. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation motif is an N-linked glycosylation motif.

17. The nucleic acid molecule of any one of the preceding claims, wherein the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline.

18. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation site is an N-linked glycosylation site.

19. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and an N- glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and an N- glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and an N- glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and an N- glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and an N-Attorney Docket No.62801.28WO01 glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and an N- glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and an N- glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and an N- glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N- glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

20. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N- glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

21. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike proteinAttorney Docket No.62801.28WO01 immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

22. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and an N-glycosylation site at amino acidAttorney Docket No.62801.28WO01 position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

23. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 383, 441, 477, 517, and / or 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

24. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation motif is an N-linked glycosylation motif.

25. The nucleic acid molecule of any one of the preceding claims, wherein the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline.

26. The nucleic acid molecule of any one of the preceding claims, wherein the glycosylation site is an N-linked glycosylation site.

27. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following:Attorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N- glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine or a serine at position 443 and an N- glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine or a serine at position 479 and an N- glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine or a serine at position 519 and an N- glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N-linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine or a serine at position 520 and an N- glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

28. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N- glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine at position 443 and an N-glycosylation site atAttorney Docket No.62801.28WO01 position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine at position 479 and an N-glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine at position 519 and an N-glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N-linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine at position 520 and an N-glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

29. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more naturally occurring glycosylation sites.

30. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a naturally occurring glycosylation site) at one or more of amino acid positions 331 and / or 343, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

31. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 32. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) relative the reference sequence (e.g., SEQ ID NO: 1).

33. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) )) in a prefusion state relative the reference sequence (e.g., SEQ ID NO: 1).

34. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an inactive furin cleavage site.

35. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least one amino acid variation in the furin cleavage site that inactivates the furin cleavage site.

36. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at one or more of position 817, 892, 899, 986, and / or 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

37. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises aAttorney Docket No.62801.28WO01 proline at positions 986 and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

38. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 817, 892, 899, 986, and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

39. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

40. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

41. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

42. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at positionAttorney Docket No.62801.28WO01 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

43. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

44. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

45. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

46. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

47. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and aAttorney Docket No.62801.28WO01 glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

48. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

49. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site atAttorney Docket No.62801.28WO01 position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

50. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

51. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

52. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 53. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

54. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

55. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and aAttorney Docket No.62801.28WO01 glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

56. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

57. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site atAttorney Docket No.62801.28WO01 position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

58. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

59. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

60. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; andAttorney Docket No.62801.28WO01 (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

61. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 62. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

63. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and aAttorney Docket No.62801.28WO01 glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

64. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

65. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

66. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

67. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and aAttorney Docket No.62801.28WO01 glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

68. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

69. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site atAttorney Docket No.62801.28WO01 position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

70. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

71. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 502 and a glycosylation site at position 504, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

72. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

73. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

74. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496, and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504, and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

75. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, or 6) of (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

76. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

77. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

78. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, and / or 22) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

79. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, and / or 10) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and / or a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 80. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

81. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and / or 12) of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

82. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

83. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438,Attorney Docket No.62801.28WO01 an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

84. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of the SARS-CoV-2 spike protein receptor binding domain (RBD).

85. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of a full-length SARS-CoV-2 spike protein.

86. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.

87. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises from about 10-15, 10-20, 10-30, 10-40, 10-50, 10-60, 10-70, 10-80, 10-90, 10-100, 10-200, 10-300, 10-400, 10-500, 10-600, 10-700, 10-800, 10-900, 10-1000, 10-1100, 10-1200, 10-1300, 100-200, 100-300, 100-400, 100-500, 100-600, 100-700, 100-800, 100-900, 100-1000, 100-1100, 100- 1200, or 100-1300 amino acids.

88. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids set forth in any one of SEQ ID NOS: 11-76.Attorney Docket No.62801.28WO01 89. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 11-76].

90. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids set forth in any one of SEQ ID NOS: 55-76.

91. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1).

92. The nucleic acid molecule of any one of the preceding claims, wherein the amino acid sequence of the encoded SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1).

93. The nucleic acid molecule of any one of the preceding claims, wherein the encoded SARS-CoV-2 spike protein is an immunogen (or an immunogenic fragment and / or immunogenic variant thereof).Attorney Docket No.62801.28WO01 94. The nucleic acid molecule of claim 93, wherein the nucleic acid molecule is RNA or DNA.

95. The nucleic acid molecule of any one of claim 93-94, wherein the RNA is messenger ribonucleic acid (mRNA).

96. The nucleic acid molecule of any one of claims 93-95, wherein the nucleic acid molecule comprises at least one modified nucleotide.

97. The nucleic acid molecule of any one of claims 93-96, wherein the nucleic acid molecule comprises N1-methyl-pseudouridine, cytosine, adenine, and guanine.

98. The nucleic acid molecule of any one of claims 93-97, wherein the nucleic acid molecule comprises a heterologous 5’-untranslated region (UTR), 3’-UTR, or both a 5’-UTR and 3’-UTR.

99. The nucleic acid molecule of any one of claims 93-98, wherein the nucleic acid molecule comprises a poly(A) sequence.

100. The nucleic acid molecule of any one of claims 93-99, wherein the nucleic acid molecule comprises a 5’cap structure.

101. The nucleic acid molecule of any one of claims 93-100, wherein the nucleotide sequence of the nucleic acid molecule is codon optimized.

102. The nucleic acid molecule of any one of claims 93-101, wherein the nucleic acid molecule further encodes a heterologous polypeptide or protein.

103. The nucleic acid molecule of any one of claims 93-102, wherein the nucleic acid molecule encodes a signal peptide.

104. The nucleic acid molecule of any one of claims 93-103, wherein the nucleic acid molecule encodes a homologous or heterologous signal peptide.

105. The nucleic acid molecule of any one of claims 93-104, wherein the nucleic acid molecule does not encode a signal peptide.

106. A vector comprising the nucleic acid molecule of any one of claims 1-105.

107. The vector of claim 106, wherein the vector is a non-viral vector (e.g., a plasmid) or a viral vector.

108. A conjugate comprising the nucleic acid molecule of any one of claims 1-105 operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous moiety (e.g., a heterologous polypeptide or protein).Attorney Docket No.62801.28WO01 109. A fusion protein comprising the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) encoded by the nucleic acid molecule of any one of claims 1-105 operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous protein.

110. The fusion protein of claim 109, wherein the heterologous protein is a trimerization domain.

111. The fusion protein of claim 110, wherein the trimerization domain is operably connected to the encoded SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) via a peptide linker.

112. A composition comprising at least one of the nucleic acid molecules set forth in any one of claims 1-105, the vector of any one of any one of claims 106-107, the conjugate of claim 108, or the fusion protein of any one of claims 109-111.

113. The composition of claim 112, wherein the composition is monovalent or polyvalent.

114. The composition of claim 112 or 113, wherein the composition is polyvalent.

115. The composition of any one of claims 112-114, comprising a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

116. The composition any one of claims 112-115, comprising a plurality of nucleic acid molecules set forth in any one of claims 1-105, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

117. The composition of any one of claims 112-116, wherein the nucleic acid molecule(s) are comprised in one or more vectors.

118. The composition of any one of claims 112-117, wherein the nucleic acid molecule(s) or the one or more vectors are formulated in one or more carrier.

119. The composition of claim 118, wherein the carrier is a lipid nanoparticle (LNP), liposome, lipoplex, or nanoliposome.

120. The composition of claim 118 or 119, wherein the carrier is an LNP.Attorney Docket No.62801.28WO01 121. The composition of any one of claims 118-120, wherein the LNP comprises a cationic lipid, a neutral lipid, a cholesterol, and / or a PEG lipid.

122. The composition of any one of claims 118-121, wherein the LNP has a mean particle size of between 80 nm and 160 nm.

123. The composition of any one of claims 112-122, wherein the composition is a pharmaceutical composition comprising a pharmaceutically acceptable excipient or a vaccine composition.

124. The composition of any one of claims 112-123, further comprising an adjuvant.

125. A SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)), wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369 , 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

126. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of claim 125, wherein the SARS- CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) is hyper-glycosylated relative to a reference SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) (e.g., the SARS-CoV-2 spike protein set forth in SEQ ID NO: 1).

127. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of claim 125 or 126, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, or more non-naturally occurring glycosylation motifs each comprising a non-naturally occurring glycosylation site, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 128. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-127, wherein the glycosylation motif is an N-linked glycosylation motif.

129. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-128, wherein the N-linked glycosylation motif is an NXT sequence, wherein X is any amino acid except for proline.

130. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-129, wherein the N-linked glycosylation motif is an NXS sequence, wherein X is any amino acid except for proline.

131. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-130, wherein the glycosylation site is an N-linked glycosylation site.

132. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-131, wherein the glycosylation motif is an O-linked glycosylation motif.

133. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of claim 132, wherein the O-linked glycosylation motif is a serine or threonine.

134. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-133, wherein the glycosylation site is an O-linked glycosylation site.

135. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-134, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and an N-linkedAttorney Docket No.62801.28WO01 glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and an N- glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and an N- glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and an N- glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and an N- glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and an N- glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

136. The nucleic acid molecule of any one of claims 125-135, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

137. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-136, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and an N-glycosylation site atAttorney Docket No.62801.28WO01 amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

138. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-137, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and an N-glycosylation site at amino acid position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and an N-glycosylation site at amino acid position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and an N-glycosylation site at amino acid position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and an N-glycosylation site at amino acid position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and an N-glycosylation site at amino acid position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and an N-glycosylation site at amino acid position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

139. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-138, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 354, 370, 394, 415, 428, 448, 468, 494, and / or 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

140. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-139, wherein the glycosylation motif is an N-linked glycosylation motif.

141. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-140, wherein the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline.Attorney Docket No.62801.28WO01 142. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-141, wherein the glycosylation site is an N-linked glycosylation site.

143. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-142, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and an N- glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and an N- glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and an N- glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and an N- glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and an N- glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and an N-Attorney Docket No.62801.28WO01 glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and an N- glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and an N- glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N- glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

144. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-143, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 504 and an N- glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

145. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-144, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and an N-glycosylation site atAttorney Docket No.62801.28WO01 amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / orAttorney Docket No.62801.28WO01 (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

146. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-145, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and an N-glycosylation site at amino acid position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and an N-glycosylation site at amino acid position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and an N-glycosylation site at amino acid position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and an N-glycosylation site at amino acid position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and an N-glycosylation site at amino acid position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and an N-glycosylation site at amino acid position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (g) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and an N-glycosylation site at amino acid position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and an N-glycosylation site at amino acid position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (i) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and an N-glycosylation site at amino acid position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

147. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-146, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a non-naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a non-naturally occurring glycosylation site) at one or more of amino acid positions 383, 441, 477, 517, and / or 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

148. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-147, wherein the glycosylation motif is an N-linked glycosylation motif.

149. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-148, wherein the N-linked glycosylation motif is an NXT or NXS, wherein X is any amino acid except for proline.

150. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-149, wherein the glycosylation site is an N-linked glycosylation site.

151. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-150,Attorney Docket No.62801.28WO01 wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N- glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine or a serine at position 443 and an N- glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine or a serine at position 479 and an N- glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine or a serine at position 519 and an N- glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N-linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine or a serine at position 520 and an N- glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

152. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-151, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more of the following: (a) an N-linked glycosylation motif comprising an asparagine at position 383, any amino acid except proline at position 384, and a threonine or a serine at position 385 and an N-Attorney Docket No.62801.28WO01 glycosylation site at position 383, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 441, any amino acid except proline at position 442, and a threonine at position 443 and an N-glycosylation site at position 443, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 477, any amino acid except proline at position 478, and a threonine at position 479 and an N-glycosylation site at position 477, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 517, any amino acid except proline at position 518, and a threonine at position 519 and an N-glycosylation site at position 517, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (e) an N-linked glycosylation motif comprising an asparagine at position 518, any amino acid except proline at position 519, and a threonine at position 520 and an N-glycosylation site at position 518, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

153. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-152, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more naturally occurring glycosylation sites.

154. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-153, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycosylation motif (e.g., a naturally occurring glycosylation motif) comprising a glycosylation site (e.g., a naturally occurring glycosylation site) at one or more of amino acidAttorney Docket No.62801.28WO01 positions 331 and / or 343, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

155. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-154, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

156. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-155, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) relative the reference sequence (e.g., SEQ ID NO: 1).

157. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-156, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises one or more amino acid variation relative to a reference sequence (e.g., SEQ ID NO: 1) that enhances the stability of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) )) in a prefusion state relative the reference sequence (e.g., SEQ ID NO: 1).

158. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-157, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an inactive furin cleavage site.

159. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-158,Attorney Docket No.62801.28WO01 wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises at least one amino acid variation in the furin cleavage site that inactivates the furin cleavage site.

160. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-159, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at one or more of position 817, 892, 899, 986, and / or 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

161. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-160, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 986 and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

162. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-161, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a proline at positions 817, 892, 899, 986, and 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

163. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-162, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 164. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-163, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine or a serine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

165. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-164, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, any amino acid except proline at position 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

166. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-165, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 369, an asparagine at position 370, and a threonine at position 371 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

167. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-166, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 168. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-167, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine or a serine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

169. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-168, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, any amino acid except proline at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

170. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-170, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises an N-linked glycosylation motif comprising an asparagine at position 447, an asparagine at position 448, and a threonine at position 449 and a glycosylation site at position 447, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

171. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-170, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and aAttorney Docket No.62801.28WO01 glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; andAttorney Docket No.62801.28WO01 (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

172. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-171, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

173. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-172, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

174. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-173, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

175. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-175, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and aAttorney Docket No.62801.28WO01 glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

176. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-175, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

177. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-176, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 369, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

178. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-177, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (j) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 179. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-178, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine or a serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine or a serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine or a serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and aAttorney Docket No.62801.28WO01 glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

180. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-179, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine or serine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine or serine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine or serine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; andAttorney Docket No.62801.28WO01 (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

181. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-180, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 354, any amino acid except proline at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, any amino acid except proline at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, any amino acid except proline at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site atAttorney Docket No.62801.28WO01 position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (k) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

182. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-181, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 354, an arginine at position 355, and a threonine at position 356 and a glycosylation site at position 354, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 370, a serine at position 371, and a threonine at position 372 and a glycosylation site at position 370, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 388, an aspartic acid at position 389, and a threonine at position 390 and a glycosylation site at position 388, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (i) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (j) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (k) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (l) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

183. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-182, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; andAttorney Docket No.62801.28WO01 (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

184. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-183, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

185. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-184, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spikeAttorney Docket No.62801.28WO01 protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

186. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-185, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

187. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-186, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

188. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-187, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

189. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-188, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site atAttorney Docket No.62801.28WO01 position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

190. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-189, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (g) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

191. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-190, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine or a serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine or a serine at position 430 and aAttorney Docket No.62801.28WO01 glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine or a serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine or a serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine or a serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine or a serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

192. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-191, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprisesAttorney Docket No.62801.28WO01 (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine or serine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine or a serine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine or a serine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine or serine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine or a serine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine or serine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine or serine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine or serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine or serine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

193. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-192, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spikeAttorney Docket No.62801.28WO01 protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, any amino acid except proline at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, any amino acid except proline at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, any amino acid except proline at position 429, and a threonine at position 430 and a glycosylation site at position 428, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, any amino acid except proline at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, any amino acid except proline at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, any amino acid except proline at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (g) an N-linked glycosylation motif comprising an asparagine at position 476, any amino acid except proline at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (h) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, any amino acid except proline at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

194. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-194, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 394, a valine at position 395, and a threonine at position 396 and a glycosylation site at position 394, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) an N-linked glycosylation motif comprising an asparagine at position 415, a glycine at position 416, and a threonine at position 417 and a glycosylation site at position 415, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) an N-linked glycosylation motif comprising an asparagine at position 428, a phenylalanine at position 429, and a threonine at position 430 and a glycosylation site at position 429, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) an N-linked glycosylation motif comprising an asparagine at position 448, a tyrosine at position 449, and a threonine at position 450 and a glycosylation site at position 448, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) an N-linked glycosylation motif comprising an asparagine at position 460, a leucine at position 461, and a threonine at position 462 and a glycosylation site at position 460, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (f) an N-linked glycosylation motif comprising an asparagine at position 468, a serine at position 469, and a threonine at position 470 and a glycosylation site at position 468, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1;Attorney Docket No.62801.28WO01 (g) an N-linked glycosylation motif comprising an asparagine at position 476, a serine at position 477, and a threonine at position 478 and a glycosylation site at position 476, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (h) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (i) an N-linked glycosylation motif comprising an asparagine at position 529, a serine at position 530, and a threonine at position 531 and a glycosylation site at position 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

195. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-194, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine or a serine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine or a serine at position 502 and a glycosylation site at position 504, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

196. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-195, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; andAttorney Docket No.62801.28WO01 (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

197. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-196, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, any amino acid except proline at position 495, and a threonine at position 496 and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, any amino acid except proline at position 503, and a threonine at position 504 and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

198. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-197, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) an N-linked glycosylation motif comprising an asparagine at position 494, a tyrosine at position 495, and a threonine at position 496, and a glycosylation site at position 494, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (b) an N-linked glycosylation motif comprising an asparagine at position 502, a valine at position 503, and a threonine at position 504, and a glycosylation site at position 502, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

199. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-198, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spikeAttorney Docket No.62801.28WO01 protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, or 6) of (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and / or (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

200. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-199, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises (a) a proline at position 817, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (b) a proline at position 892, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (c) a proline at position 899, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (d) a proline at position 942, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; (e) a proline at position 986, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1; and (f) a proline at position 987, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1.Attorney Docket No.62801.28WO01 201. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-200, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a glycine at position 614, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

202. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-201, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, and / or 22) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431, an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

203. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-202, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, and / or 10) of a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and / or a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

204. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-203, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spikeAttorney Docket No.62801.28WO01 protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, and a glycine at position 431, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

205. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-204, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises any one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and / or 12) of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

206. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-205, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises of an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and / or an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

207. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-206, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises a cysteine at position 379, a tyrosine at position 380, a proline at position 412, an asparagine at position 422, a tyrosine at position 423, a lysine at position 424, a leucine at position 425, a proline at position 426, a phenylalanine at position 429, a glycine at position 431,Attorney Docket No.62801.28WO01 an alanine at position 435, a tryptophan at position 436, an asparagine at position 437, a serine at position 438, an aspartic acid at position 442, a serine at position 443, a glycine at position 447, a tyrosine at position 495, a phenylalanine at position 497, a glutamic acid at position 506, a proline at position 507, and an arginine at position 509, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO:

1.

208. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-207, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of the SARS-CoV-2 spike protein receptor binding domain (RBD).

209. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-208, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises or consists of a full-length SARS-CoV-2 spike protein.

210. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-209, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids.

211. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-210, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) comprises from about 10-15, 10-20, 10-30, 10-40, 10-50, 10-60, 10-70, 10-80, 10-90, 10-100, 10-200, 10- 300, 10-400, 10-500, 10-600, 10-700, 10-800, 10-900, 10-1000, 10-1100, 10-1190, 10-1300, 100-200, 100-300, 100-400, 100-500, 100-600, 100-700, 100-800, 100-900, 100-1000, 100- 1100, 100-1190, or 100-1300 amino acids.

212. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-211,Attorney Docket No.62801.28WO01 wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids set forth in any one of SEQ ID NOS: 11-76.

213. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-212, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 11-76.

214. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-213, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids set forth in any one of SEQ ID NOS: 55-76.

215. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-214, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous stretch of at least 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1190, or 1300 amino acids set forth in any one of SEQ ID NOS: 1-10 (e.g., SEQ ID NO: 1).Attorney Docket No.62801.28WO01 216. The SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-215, wherein the amino acid sequence of the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)) is less than 100% identical to but at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOS: 1- 10 (e.g., SEQ ID NO: 1).

217. A conjugate comprising the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-216 operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous moiety (e.g., a heterologous polypeptide or protein).

218. A fusion protein comprising the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-217 operably connected (e.g., directly or indirectly (e.g., via a linker)) to a heterologous protein.

219. The fusion protein of claim 218, wherein the heterologous protein is a trimerization domain.

220. The fusion protein of claim 219, wherein the trimerization domain is operably connected to the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) via a peptide linker.

221. A composition comprising at least one of the SARS-CoV-2 spike proteins (e.g., a SARS- CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) set forth in any one of claims 125-216, the conjugate of claim 217, or the fusion protein of any one of claims 218-220.

222. The composition of claim 221, wherein the composition is monovalent or polyvalent.

223. The composition of claim 221 or 222, wherein the composition is polyvalent.

224. The composition of any one of claims 221-223, comprising a plurality SARS-CoV-2 spike proteins (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)), wherein the amino acid sequence of each of the SARS-Attorney Docket No.62801.28WO01 CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) of the plurality is different.

225. The composition any one of claims 221-224, comprising a plurality of SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-216, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) of the plurality is different.

226. The composition of any one of claims 221-225, wherein the SARS-CoV-2 spike protein(s) (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) are formulated in one or more carrier.

227. The composition of claim 226, wherein the carrier is a lipid nanoparticle (LNP), liposome, lipoplex, or nanoliposome.

228. The composition of claim 226 or 227, wherein the carrier is an LNP.

229. The composition of claim 228, wherein the LNP comprises a cationic lipid, a neutral lipid, a cholesterol, and / or a PEG lipid.

230. The composition of any one of claims 227-229, wherein the LNP has a mean particle size of between 80 nm and 160 nm.

231. The composition of any one of claims 221-230, wherein the composition is a pharmaceutical composition comprising a pharmaceutically acceptable excipient or a vaccine composition.

232. The composition of any one of claims 221-231, further comprising an adjuvant.

233. A nucleic acid molecule encoding the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-216.

234. A SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) encoded by the nucleic acid molecule of any one of claims 1-105.

235. A carrier comprising the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one ofAttorney Docket No.62801.28WO01 claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109- 111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221- 232, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269.

236. The carrier of claim 235, wherein the carrier is monovalent or polyvalent.

237. The carrier of any one of claims 235-236, wherein the carrier is polyvalent.

238. The carrier of any one of claims 235-237, comprising a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

239. The carrier of any one of claims 235-238, comprising a plurality of nucleic acid molecules set forth in any one of claims 1-205 or 233, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

240. The carrier of any one of claims 235-239, comprising a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)), wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different.

241. The carrier of any one of claims 235-240, comprising a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different.

242. The carrier of any one of claims 235-241, wherein the carrier is a lipid nanoparticle (LNP), liposome, lipoplex, or nanoliposome.

243. The carrier of any one of claims 235-242, wherein the carrier is an LNP.

244. The carrier of claim 242 or 243, wherein the LNP comprises a cationic lipid, a neutral lipid, a cholesterol, and / or a PEG lipid.Attorney Docket No.62801.28WO01 245. The carrier of any one of claims 242-244, wherein the LNP has a mean particle size of between 80 nm and 160 nm.

246. A vaccine composition comprising the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112- 124 or 221-232, the carrier of any one of claims 235-245, or the pharmaceutical composition of any one of claims 260-269.

247. The vaccine composition of claim 246, wherein the vaccine composition is a prime vaccine composition.

248. The vaccine composition of claim 246 or 247, wherein the vaccine composition is a boost vaccine composition.

249. The vaccine composition of any one of claims 246-248, wherein the vaccine composition is a prime vaccine composition and a boost vaccine composition.

250. The vaccine composition of any one of claims 246-249, wherein the vaccine composition can be utilized as a prime vaccine composition and / or a booster vaccine composition in a homologous or heterologous prime boost vaccine regimen.

251. The vaccine composition of any one of claims 246-250, wherein the vaccine composition is monovalent or polyvalent.

252. The vaccine composition of any one of claims 246-251, wherein the vaccine composition is polyvalent.

253. The vaccine composition of any one of claims 246-252, comprising a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

254. The vaccine composition of any one of claims 246-253, comprising a plurality of nucleic acid molecules set forth in any one of claims 1-105 or 233, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.Attorney Docket No.62801.28WO01 255. The vaccine composition of any one of claims 246-254, comprising a plurality of SARS- CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)), wherein the amino acid sequence of each of the SARS- CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different.

256. The vaccine composition of any one of claims 246-255, comprising a plurality of SARS- CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different.

257. The vaccine composition of any one of claims 246-256, comprising a plurality of SARS- CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234, comprising a trimer of a SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234.

258. A vaccine composition comprising a messenger ribonucleic acid (mRNA) encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) that comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369 , 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1, formulated in a lipid nanoparticle, the vaccine composition having the following characteristics: (a) the LNPs comprise a cationic lipid, a neutral lipid, a cholesterol, and a PEG lipid, (b) the LNPs have a mean particle size of between 80 nm and 160 nm, and (c) the mRNA comprises: (i) a 5'-cap structure; (ii) a 5'-UTR; (iii) N1-methyl-pseudouridine, cytosine, adenine, and guanine; (iv) a 3'- UTR; and (v) a poly-A region.

259. The vaccine composition of any one of claims 246-258, wherein the vaccine composition further comprises an adjuvant.Attorney Docket No.62801.28WO01 260. A pharmaceutical composition comprising the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112- 124 or 221-232, the carrier of any one of claims 235-245, or the vaccine composition of any one of claims 246-259, or the vaccine composition of any one of claims 246-259, and a pharmaceutically acceptable excipient.

261. The pharmaceutical composition of claim 260, wherein the pharmaceutical composition is monovalent or polyvalent.

262. The pharmaceutical composition of any one of claims 260-261, wherein the pharmaceutical composition is polyvalent.

263. The pharmaceutical composition of any one of claims 260-262, comprising a plurality of nucleic acid molecules, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

264. The pharmaceutical composition of any one of claims 260-263, comprising a plurality of nucleic acid molecules set forth in any one of claims 1-105 or 223, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) encoded by each nucleic acid molecule of the plurality is different.

265. The pharmaceutical composition of any one of claims 260-264, comprising a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)), wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different.

266. The pharmaceutical composition of any one of claims 260-265, comprising a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234, wherein the amino acid sequence of each of the SARS-CoV-2 spike proteins (e.g., SARS-CoV-2Attorney Docket No.62801.28WO01 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) is different.

267. The pharmaceutical composition of any one of claims 260-266, comprising a plurality of SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234, comprising a trimer of a SARS-CoV-2 spike proteins (e.g., SARS-CoV-2 spike protein immunogens (or immunogenic fragments and / or immunogenic variants thereof)) set forth in any one of claims 125-226 or 234.

268. A pharmaceutical composition comprising a messenger ribonucleic acid (mRNA) encoding a SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein immunogen (or an immunogenic fragment and / or immunogenic variant thereof)) that comprises a non-naturally occurring glycosylation motif comprising a non-naturally occurring glycosylation site at one or more (e.g., 1, 2, 3, 4, 5, and / or 6) of amino acid positions 369 , 388, 447, 460, 476, and / or 529, amino acid numbering relative to the amino acid positions set forth in SEQ ID NO: 1, formulated in a lipid nanoparticle, the pharmaceutical composition having the following characteristics: (a) the LNPs comprise a cationic lipid, a neutral lipid, a cholesterol, and a PEG lipid, (b) the LNPs have a mean particle size of between 80 nm and 160 nm, and (c) the mRNA comprises: (i) a 5'- cap structure; (ii) a 5'-UTR; (iii) N1-methyl-pseudouridine, cytosine, adenine, and guanine; (iv) a 3'-UTR; and (v) a poly-A region; and a pharmaceutically acceptable excipient.

269. The pharmaceutical composition of any one of claims 260-268, wherein the pharmaceutical composition further comprises an adjuvant.

270. A host cell comprising the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109- 111 or 218-220, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269.

271. A kit comprising the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one ofAttorney Docket No.62801.28WO01 claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109- 111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221- 232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246- 259, or the pharmaceutical composition of any one of claims 260-269.

272. The kit of claim 271, comprising instructions for use of the nucleic acid molecule, vector, protein (or immunogenic fragment or immunogenic variant thereof), conjugate, fusion protein, carrier, composition, vaccine composition, or pharmaceutical composition.

273. A method of delivering a nucleic acid molecule, vector, protein (or immunogenic fragment or immunogenic variant thereof), conjugate, fusion protein, host cell, carrier, composition, vaccine composition, or pharmaceutical composition to a subject in need thereof, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby deliver the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the host cell, the carrier, the composition, the vaccine composition, or the pharmaceutical composition to the subject.

274. A method of inducing or enhancing an immune response in a subject in need thereof, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112- 124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby induce or enhance an immune response in the subject.Attorney Docket No.62801.28WO01 275. A method of inducing or enhancing an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject in need thereof, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby induce or enhance an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject.

276. A method of preventing or decreasing an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject in need thereof, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby prevent or decrease an immune response to one or more predetermined epitopes of a SARS-CoV-2 spike protein antigen in a subject.

277. A method of inducing or enhancing an immune response against a plurality of strains of SARS-CoV-2 virus in a subject in need thereof, the method comprising administering to the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceuticalAttorney Docket No.62801.28WO01 composition of any one of claims 260-269, to thereby induce or enhance an immune response against a plurality of strains of SARS-CoV-2 virus in the subject.

278. A method of preventing, ameliorating, or treating a SARS-CoV-2 infection in a subject in need thereof, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby prevent, ameliorate, or treat the SARS-CoV-2 infection in the subject.

279. A method of preventing, ameliorating, or treating an infection by a plurality of SARS- CoV-2 strains in a subject in need thereof, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby prevent, ameliorate, or treat an infection by a plurality of SARS-CoV-2 strains in the subject.

280. A method of vaccinating a subject against SARS-CoV-2, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109- 111 or 218-220, the host cell of claim 270, the composition of any one of claims 112-124 or 221- 232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246- 259, or the pharmaceutical composition of any one of claims 260-269, to thereby vaccinate the subject against SARS-CoV-2.Attorney Docket No.62801.28WO01 281. A method of vaccinating a subject against SARS-CoV-2, the method comprising administering to the subject (a) an mRNA molecule (e.g., an mRNA molecule described herein) encoding the SARS-CoV-2 spike protein (e.g., a SARS-CoV-2 spike protein or polypeptide immunogen (or immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234 (or a conjugate or fusion protein thereof), (b) a vector comprising the mRNA molecule, (c) a carrier comprising the mRNA molecule or the vector, (d) a vaccine composition comprising the mRNA molecule, the vector, or the carrier, or (e) a pharmaceutical composition comprising the mRNA molecule, the vector, the carrier, or the vaccine composition, to thereby vaccinate the subject against SARS-CoV-2, to thereby vaccinate the subject against SARS-CoV-2.

282. A method of vaccinating a subject against SARS-CoV-2, the method comprising administering to the subject the vaccine composition of any one of claims 246-259 or the pharmaceutical composition of any one of claims 260-269, to thereby vaccinate the subject against SARS-CoV-2.

283. A method of vaccinating a subject against a plurality of strains of SARS-CoV-2, the method comprising administering to the subject the nucleic acid molecule of any one of claims 1-105 or 233, the protein (e.g., the SARS-CoV-2 spike protein immunogen (or the immunogenic fragment and / or immunogenic variant thereof)) of any one of claims 125-226 or 234, the vector of any one of claims 106-107, the conjugate of claim 108 or 217, the fusion protein of any one of claims 109-111 or 218-220, the host cell of claim 270, the composition of any one of claims 112- 124 or 221-232, the carrier of any one of claims 235-245, the vaccine composition of any one of claims 246-259, or the pharmaceutical composition of any one of claims 260-269, to thereby vaccinate the subject against a plurality of strains of SARS-CoV-2.

284. The method of any one of claims 273-283, wherein the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the carrier, the composition, the vaccine composition, or the pharmaceutical composition is administered to the subject at least twice.

285. The method of any one of claims 273-284, wherein the subject is a human.

286. The method of any one of claims 273-285, wherein the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (orAttorney Docket No.62801.28WO01 immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the carrier, the composition, the vaccine composition, or the pharmaceutical composition is administered as a prime and / or a boost in a homologous or heterologous prime-boost regimen.

287. The method of any one of claims 273-286, wherein the nucleic acid molecule, the vector, the SARS-CoV-2 spike protein (e.g., the SARS-CoV-2 spike protein immunogen (or immunogenic fragment and / or immunogenic variant thereof)), the conjugate, the fusion protein, the carrier, the composition, the vaccine composition, or the pharmaceutical composition is administered as a boost in a heterologous prime-boost regimen.

Images