Antibody-auristatin drug conjugates and methods of making and using thereof

Auristatin-based ADCs with improved linkers address neurotoxicity and plasma instability issues, achieving effective tumor inhibition with lower doses and reduced side effects.

WO2025151684A1PCT designated stage expired Publication Date: 2025-07-17SYSTIMMUNE INC
View PDF 4 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/011010
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2025-01-07
Filing Date
2025-01-10
Publication Date
2025-07-17

AI Technical Summary

Technical Problem

Current antibody-drug conjugates (ADCs) using auristatins as warheads face issues such as neurotoxicity, hematotoxicity, ophthalmotoxicity, and instability of linkers, leading to off-target toxicity and reduced efficacy due to hydrolysis in human plasma.

Method used

Development of auristatin-based ADCs with improved linkers that connect to the hydroxyl group of auristatin through an amino-methylene structure, enhancing DAR to 8, improving hydrophilicity, plasma stability, and reducing neurotoxicity and hepatotoxicity.

Benefits of technology

The new ADCs achieve similar tumor inhibitory effects with lower doses, significantly improved maximum tolerated dose, and reduced side effects, demonstrating enhanced safety and efficacy.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2025011010_17072025_PF_FP_ABST
    Figure US2025011010_17072025_PF_FP_ABST
Patent Text Reader

Abstract

The application provides antibody-drug conjugates (ADCs) comprising an antibody moiety having a binding affinity to HER2 and a drug moiety derived from auristatin, and methods of making and using such ADCs for treating cancer. The disclosure further provides linker-drug compounds comprising auristatin derivatives, and methods of making and using thereof.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] ANTIBODY-AURISTATIN DRUG CONJUGATES AND METHODS OF MAKING AND USING THEREOF

[0002] CROSS-REFERENCE TO RELATED APPLICATIONS

[0003] This application claims the benefit of the filing date of CN 202410042571.5, filed January 11, 2024, and CN202510016135.5, field January 06, 2025, the disclosures of which are herein incorporated by reference in its entirety.

[0004] TECHNICAL FIELD

[0005] The application relates to the field of biopharmaceutical technology, and specifically, to liganddrug conjugates, linker-drug compounds, methods of preparation and uses thereof.

[0006] BACKGROUND

[0007] Antibody-Drug Conjugates (ADCs) are a new type of targeted therapy that combine the advantages of high selectivity of antibodies and high activity of cytotoxic drugs. With their "high efficiency and low toxicity" characteristics, ADCs have become a research hotspot in the field of targeted cancer therapy. In recent years, the rapid development has led to the three generations of ADCs. At present, 14 ADCs have been approved for marketing, including Gemtuzumab ozogamicin (Mylotarg®, Pfizer), Brentuximab vedotin (Adcetris®, Seagen and Millennium), Trastuzumab emtansine (Kadcyla®, Genetech), Inotuzumab ozogamicin (Besponsa®, Pfizer), Moxetumomab pasudotox (Lumoxiti®, AstraZeneca AB), Polatuzumab vedotin (Polivy®, Genetech), Trastuzumab deruxtecan (Enhertu®, AstraZeneca and Daiichi Sankyo), Enfortumab vedotin (Padcev®, Astellas), Sacituzumab govitecan (Trodelvy®, Gilead), Belantamab mafodotin (Blenrep®, GSK), Loncastuximab tesirine (Zynlonta®, ADC Therapeutics SA), Disitamab vedotin (Aidixi®, RemeGen), Tisotumab vedotin (Tivdak®, Genmab), and Mirvetuximab soravtansine (Elahere®, Abb Vie), and more than 200 ADC drug candidates have entered clinical trials. ADCs are playing an increasingly important role in the field of targeted tumor therapy.

[0008] Antibody-drug conjugates (ADCs) are composed of three components; a high specificity and affinity antibody (mAb), a stable linker, and a small-molecule cytotoxic drug (payload / warhead, warhead). The antibody in ADCs is most commonly immunoglobulin G1 or IgGl, and the warhead part is generally a cytotoxic drug that acts on microtubules, DNA or RNA, such as maytansinoids, auristatins, calicheamicins, camptothecins, pyrrolobenzodiazepines and amatoxins. There are two types of linkers; one is a cleavable linker and the other is a non-cleavable linker.

[0009] Auristatins are a class of microtubule inhibitors that block microtubule from binding to GTP and block microtubule binding to the vincristine binding site, thereby inducing cell apoptosis and inhibiting tumor growth. MMAE and MMAF are currently used as ADC warheads (see US6884869 and US7498298, respectively), both of which are pentapeptides derived from Dolastatin 10. Both MMAE and MMAF show good anti-tumor activity, however, due to the lack of selectivity and low therapeutic index, they cannot be used clinically as a single drug. Five ADCs on the market use MMAE as their warhead and one ADC drug uses MMAF as its warhead, namely, Adcetris, Polivy, Padcev, Edexil, Tivdak and Blenrep. These ADCs with auristatins as payloads all have some shortcomings. For example, ADCs with MMAE have adverse effects including neurotoxicity (peripheral neuropathy) and hematotoxicity (thrombocytopenia and neutropenia), and ADCs with MMAF could develop ophthalmotoxicity. In addition, the linkers often used in these ADCs are VClinker, and the highest DAR is 4 because VClinkers are highly hydrophobic. High DAR may lead to the precipitation and aggregation of ADCs, therefore increasing DAR may not enhance its efficacy.

[0010] Furthermore, most of the current ADCs that use MMAE as their warhead introduce the linker from the secondary amine at the N-terminus of MMAE. There are few examples of introducing the linker from the hydroxyl group of MMAE, which have only been reported by Seagen, the Technical University of Denmark, Mersana, and Shanghai New Concept Company.

[0011] Seagen introduced a linker with a hydrazone bond after esterification of the hydroxyl group of the MMAE analog Auristatin E (see US2005009751A1). Such linkers with ester and hydrazone bonds are unstable in human plasma and will undergo a certain degree of hydrolysis, resulting in partial off-target toxicity (see Nat Biotechnol. 2003 Jul;21(7):778-84). Seagen also introduced a self-eliminating group, methylene alkoxy carbamate (MAC), into the hydroxyl group of MMAE and then introduced a |3-glucuronic acid glycoside linker (see CN105813653). Although the ADC with such a linker has good stability in human plasma, the release of its warhead involves the catalysis of P-glucuronidase and the subsequent self-elimination process, which is relatively complicated.

[0012] The Technical University of Denmark introduced linker from the hydroxyl group of MMAE analogs (see W02020260597A1). In a way like the esterification reaction for introducing linker by Seagen, the ester bond was more difficult to be hydrolyzed by enzyme after the introduction of linker, and it was not easy to release the warhead. Mersana’s method for introducing the linker from the hydroxyl group of MMAE analogs (see CN110234357A) is like that of Seagen. By introducing ester bond or carbonate structure, the ester bond is more difficult to be hydrolyzed by enzyme, and the carbonate plasma stability is poorer, which leads to the reduction of the drug’s efficacy. Shanghai New Idea Company disclosed the method of introducing a carbamate to the hydroxyl group of MMAE analog to introduce a Mc-Vc-PAB linker (see CN106279352 A), which again is less stable in plasma and has a potential off-target risk.

[0013] Thus, it is of great clinical importance to develop new strategies of introducing linkers to obtain Auristatin-based ADCs with higher safety and efficacy.

[0014] SUMMARY

[0015] The following summary is illustrative only and is not intended to be in any way limiting. In addition to the illustrative aspects, embodiments, and features described above, further aspects, embodiments, and features will become apparent by reference to the drawings and the following detailed description.

[0016] The application provides, among others, better anti-tumor auristatin ADCs with higher safety and efficacy to meet the clinical needs, linker-drug compounds, and its use to generate ADCs, methods for making the linker-drug compounds and ADCs, pharmaceutical compositions or formulations comprising ADCs or the linker-drug compounds, methods for treating or preventing diseases such as cancer using the ADCs, the linker-drug compounds, or pharmaceutical compositions or formulations as disclosed herein.

[0017] For example, the application provides, among others, compositions and methods for connecting auristatin or its derivatives at its hydroxyl group to an enzymatically cleavable peptide unit through an amino-methylene structure to form corresponding linker-payload compound. The method shows the significant advantage over the existing ADCs with increased the DAR value of ADC to as much as 8. In addition, the resulting ADCs have better hydrophilicity at high loading, better plasma stability at high drug loading values, and significantly more advantages in terms of drug efficacy. Compared with existing drugs, such as ADCs with Vc-MMAE as the linker-payload, the ADCs disclosed herein show superiority over the existing drugs by achieving similar tumor inhibitory effect with much lower doses, with significantly improved MTD while with significantly reduced neurotoxicity and hepatotoxicity.

[0018] In one aspect, the application provides antibody-drug conjugates (ADCs) as shown in General Formula I, or pharmaceutically acceptable salts or solvates thereof: wherein,

[0019] Ab is an antibody or its antigen-binding fragment that binds specifically to HER2; In one embodiment, said antibody or its antigen-binding fragment comprises a light chain and a heavy chain; in one embodiment, the light chain comprises complementarity-determining regions (CDRs), CDR-L1, CDR-L2, and CDR-L3 with the amino acid sequences shown in SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively; and, in certain embodiments, said heavy chain comprises CDR-H1, CDR-H2, and CDR-H3, the amino acid sequences thereof are shown in SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, respectively;

[0020] M is a linker unit connected to Ab;

[0021] A is a peptide consisting of 2 to 7 amino acids, wherein, optionally, each of said amino acids may be independently substituted by one or more substituents comprising deuterium, halogen, hydroxyl, cyano, amino, nitro, alkyl, substituted alkyl, alkoxyl, cycloalkyl, substituted cycloalkyl;

[0022] W represents an amino methylene oxide structural unit as shown in formula (i): wherein, the wavy line on the left side represents the site of attachment between the nitrogen atom and A in formula (i), the wavy line on the right side represents the site of attachment between the oxygen atom and the drug D in formula (i), and the oxygen atom is a common group of the drug D and W;

[0023] Ri, R2 and R3 are each independently hydrogen, deuterium, alkyl, or substituted alkyl; p is an integer or decimal between 1 to 20 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20); and

[0024] D is an auristatin having the structure shown in Formula D, its isomers, endo-, racemates, enantiomers, or mixtures thereof, or a pharmaceutically acceptable salt thereof; wherein, are each independently hydrogen, deuterium, alkyl and a deuterated alkyl group; or, in one embodiment, R4, Rs may be linked to form the following structure: -(CRnRi2)n-B-(CRi3Ri4)m-, wherein , and R14 are independently hydrogen, deuterium, alkyl, and a deuteroalkyl group; B is O, N or , wherein are independently hydrogen, deuterium, and alkyl; n and m are independently an integer number from 0 to 8 ( e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8); in one embodiment, the nitrogen atom bonded to R4 and Rs may form a ring with - R9 are each independently hydrogen, deuterium, halogen, an azide group, alkyl, or , or, in one embodiment, any two of Re, R?, Rs, R9 together with the atom to which they are bonded form a cycloalkyl group, and the remaining two groups are each independently hydrogen, halogen, an azide group, alkyl, and NisRig, wherein Ris and R19 are independently hydrogen, or alkyl;

[0025] Rio is aryl, or heteroaryl, and said aryl or heteroaryl may be optionally substituted with one or more substituents independently: hydrogen, halogen, alkyl, an alkoxy group, an amino group, or a nitro group;

[0026] The wavy line in formula D represents the site of attachment between the oxygen atom at position 1 in the structure of drug D to W. Said oxygen atom is a group commonly shared between drug D and W.

[0027] In certain embodiments, said light chain comprises a light chain variable region having an amino acid sequence of SEQ ID NO: 7.

[0028] In certain embodiments, said light chain further comprises a light chain constant region of amino acid sequence SEQ ID NO: 8.

[0029] In certain embodiments, the amino acid sequence of said light chain is SEQ ID NO: 9.

[0030] In certain embodiments, said heavy chain comprises a heavy chain variable region having an amino acid sequence of SEQ ID NO: 10.

[0031] In certain embodiments, said heavy chain further comprises a heavy chain constant region of amino acid sequence SEQ ID NO: 11.

[0032] In certain embodiments, the amino acid sequence of said heavy chain is SEQ ID NO: 12.

[0033] In certain embodiments, said light chain comprises CDR-L1, CDR-L2, and CDR-L3, the nucleotide sequences of which are shown in SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, respectively.

[0034] In certain embodiments, said heavy chain comprises CDR-H1, CDR-H2, CDR-H3, the nucleotide sequences of which are shown in SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, respectively.

[0035] In certain embodiments, said light chain comprises a light chain variable region having a nucleotide sequence of SEQ ID NO: 19.

[0036] In certain embodiments, said light chain further comprises a light chain constant region having a nucleotide sequence of SEQ ID NO: 20.

[0037] In certain embodiments, the nucleotide sequence of said light chain is SEQ ID NO: 21.

[0038] In certain embodiments, said heavy chain comprises a heavy chain variable region having a nucleotide sequence of SEQ ID NO: 22.

[0039] In certain embodiments, said heavy chain further comprises a heavy chain constant region having a nucleotide sequence of SEQ ID NO: 23.

[0040] In certain embodiments, the nucleotide sequence of said heavy chain is SEQ ID NO: 24.

[0041] In some embodiments, R4 and R? are each independently hydrogen, C1-C4 alkyls.

[0042] In some embodiments, R4 and Rs are linked to form the following structure: -(CH2)2-B-(CH2)2-, B is independently O, NH, and said nitrogen atom bonded to R4 and Rs forms a ring with -(CH2)2- B-(CH2)2-.

[0043] In some embodiments, in Formula D are each hydrogen atoms.

[0044] In certain embodiments, one of in formula D is independently halogen, an azido group, an amino, and the remaining three are each hydrogen.

[0045] In some embodiments, any two of the groups Re, R?, Rs, R9 in formula D form a cyclopropyl group together with the atom to which it is bonded, and the remaining two groups are each independently hydrogen atoms.

[0046] In certain embodiments, Rio in formula D is a phenyl group, and, in some embodiment, optionally, said phenyl may be substituted with one or more of substituents. In certain embodiments, said substituent may be amino or nitro.

[0047] Example compounds for drug unit D may be, without limitation, the following:

[0048]

[0049] In the above embodiments, drug D may be linked to W via a hydroxyl group.

[0050] In some embodiments, the linker unit M comprises mal eimide. In these embodiments, said antibody-drug conjugate can be hydrolyzed under hydrolysis conditions. In some embodiments, the site of hydrolysis may be the mal eimide portion of the linker unit. When the antibody contains multiple linker-drugs, the following scenarios may occur depending on with the degree of hydrolysis:

[0051] Maleimides may not hydrolyzed, that is, all maleimides are in closed ring form

[0052] Maleimides may not completely hydrolyzed, that is, part of maleimide is in closed ring form , and the other part of maleimide is in open ring form

[0053] Maleimides may be completely hydrolyzed, that is, all maleimides are in open ring form

[0054] Therefore, when there are multiple maleimide group-containing linker units M in the ADC (i.e., Ab is linked to multiple maleimide group-containing drug-linkers), these maleimide groups may all be in closed-ring form, some in an open-ring form, or all in open-ring form.

[0055] In the above mentioned maleimide structural formulas, the left wavy line represents the linkage site to Ab, and the right wavy line represents other structures in M.

[0056] In certain embodiments, said ligand-drug conjugate has the structure shown in formula la: wherein:

[0057] Z is independently -C1-C10 alkylene-, -C3-C8 cycloalkyl-, -aryl-, -C1-C10 alkylene-aryl-, -aryl- membered heterocyclic-, or wherein X is independently -C1-C10 alkylene-, -Ca-Cg carbocyclic-, -arylidene-, -C1-C10 alkylene -arylene-, - arylene-Cio-alkylene-, -C1-C10 alkylene-(C3-C8carbocyclic)-, -(C3-C8carbocyclic)-Ci-Cio alkylene-, -(3-8-membered heterocyclic)-, -C1-C10 alkylene-(3-8-membered heterocyclic)-, -(3-8- membered heterocyclic)-Ci-Cio alkylene-, is a hydrophilic structure such as a group selected from carboxyl group, phosphoric acid group, polyphosphoric acid group, phosphite group, sulphonic acid group, sulfurous acid group, sulfinic acid group, or poly(ethylene glycol) (PEG) group; in one embodiment, the heterocyclic rings may independently comprise 1 to 3 atoms independently selected from N, O, and S; in one embodiment, said -C1-C10 alkylene-, -C3-C8carbocyclic-, and heterocyclic rings may be each independently substituted with one or more substituents; in one embodiment, the substituents may be independently deuterium, halogen, hydroxyl, a cyano group, a nitro gorup, an amino group, alkyl, heteroalkyl, substituted alkyl, alkoxy group, carboxylic group, or cycloalkyl; the left wavy line i n represents the linkage site to the N on the maleimide, the right wavy line represents the linkage site to the carbonyl group; r is independently the integer numbers between 1 and 10 including, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10); q is independently an integer between 1 and 8, such as 1, 2, 3, 4, 5, 6, 7, 8; n1, n2, n3are independently integers or decimals between 0 and 20, n1, n2, n3are not simultaneously 0, and n1+ n2+ n3< 20, e.g. 1 < n1+ n2+ n3< 2, or 7 < n1+ n2+ n3< 8.

[0058] In some embodiments, n1, n2, n3are independently 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20. For example, , n1, n2, n3may be 0, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9 or 10.

[0059] In certain embodiments, Ain formula I or formula la is independently a peptide residue formed from 2 to 7 amino acid residues. In one embodiment, the amino acid residue may drived from phenylalanine (F), glycine (G), valine (V), lysine (K), alanine (A), citrulline, serine (S), glutamate (E), or aspartic acid (D).

[0060] In certain embodiments, A is a peptide residue formed from 2 to 4 amino acids independently phenylalanine and glycine. In certain embodiments, A is a tetrapeptide residue formed from glycine-glycine-phenylalanine-glycine.

[0061] In some embodiments, Z is -Ci-Cio alkylene-, such as -C4-C6 alkylene- or -C5 alkylene-. In some embodiments, wherein q is independently an integer between 1 and 8; in some embodiments, q may , 5, 6, 7, 8; in some embodiment, q is 1.

[0062] In certain embodiments, Z wherein X is a methylene group, the methylene group is optionally substituted with a carboxyl group, and Y is selected from a carboxyl group, a phosphate group; the left wavy line in represents the attachment site to the N on the maleimide, and the right wavy line represents the attachment site to the carbonyl group.

[0063] In certain embodiments, Ri, R2 and R3 are each independently hydrogen, deuterium, alkyl group, alkyl halide group, alkyl deuteride group, and hydroxyalkyl group.

[0064] In some embodiments, Ri, R2, and R3 may be simultaneously hydrogen or deuterium.

[0065] In some embodiments, Ri, R2, and R3 may be simultaneously hydrogen atoms. In some embodiments, the antibody-drug conjugate has a structure as shown in formula lb, wherein R4, R5, Re, R?, Rs, R9, Rio, n1, n2, n3are as defined above.

[0066] In certain embodiments, said antibody-drug conjugate has a structure as shown in formula Ic,

[0067] wherein are as defined above.

[0068] In one embodiment, said antibody-drug conjugate has a structure as shown in Formula Id, wherein are as defined above.

[0069] In one embodiment, said antibody-drug conjugate has a structure as shown in Formula le,

[0070] wherein are as defined above. wherein Ac is a hydrophilic structural unit having the structure shown in formula c:

[0071] Ac is linked to methylene carbon at the position-2 as labeled in Formula Ic, Id or le via an amino functional group, X, Y, R4, Rs, Re, R?, Rs, R9, Rio, n1, n2, n3are as defined above.

[0072] In certain embodiments, said Ac may be derived from glycine, (D / L) alanine, (D / L) leucine, (D / L) isoleucine, (D / L) valine, (D / L) phenylalanine, (D / L) proline, (D / L) tryptophan, (D / L) serine, (D / L) tyrosine, (D / L) cysteine, (D / L) cystine, (D / L) arginine, (D / L) histidine, (D / L) methionine, (D / L) asparagine, (D / L) glutamine, (D / L) threonine, (D / L) aspartic acid, (D / L) glutamic acid, natural or non-natural amino acid derivatives, or the following structures:

[0073] The antibody-drug conjugate of the present disclosure may be non-limitingly selected from the following structures:

[0074]

[0075] 12

[0076]

[0077]

[0078]

[0079]

[0080] 22

[0081] (X o O M

[0082] HN, 'O^HN

[0083] N .’LH-Y o ^V0-^ HN Y o-J H° i HO'd<O

[0084] 24

[0085] 25

[0086] 28

[0087] 29

[0088] 32

[0089] 33

[0090] 34

[0091] 35

[0092] wherein the configuration of the chiral carbon at the position-2 is of either R-type or S-type.

[0093] In another aspect, the application provides a linker-drug compound. In some embodiment, the linker-drug compound is as shown in formula II, or a pharmaceutically acceptable salt or solvate thereof, wherein,

[0094] Z, A, Ri, R2, R3, R4, Rs, R11, R12, R13, RU, B, R15, Rie, R17, n, m, Re, R?, Rs, R9, Ris, R19, Rio as defined in any of the above.

[0095] In certain embodiments, said linker-drug compound has the structure shown in formula Ila.

[0096] In certain embodiments, said linker-drug compound has the structure shown in formula lib,

[0097] In certain embodiment, said linker-drug compound has the structure shown in Formula lie,

[0098] In certain embodiment, said linker-drug compound has the structure shown in Formula lid, wherein Ac is a hydrophilic structural unit having the structure shown in formula c: wherein X, Y are as defined above, and Ac is linked to methylene carbon at the position-2 already labeled in formula lib, Formula lie or Formula lid via -NH-.

[0099] Example linker-drug compounds may include the following structures:

[0100] 41

[0101] 42

[0102] 43

[0103] 45

[0104] 46

[0105] wherein the configuration of the chiral carbon at the position-2 is of either R-type or S-type.

[0106] In further aspect, the application provides the use of the antibody-drug conjugate or pharmaceutically acceptable salts or solvates thereof, or the linker-drug compound, its isomer, mesomorph, racemate, enantiomer or a mixture thereof, or a pharmaceutically acceptable salt or solvate thereof for preparing a drug for treating or preventing tumors. In certain embodiments, said tumor expresses HER2.

[0107] In certain embodiments, said tumor is cancer.

[0108] In certain embodiments, said tumor may be solid or non-solid tumors, such as breast cancer (e.g., triple-negative breast cancer), ovarian cancer, cervical cancer, uterine cancer, prostate cancer, renal cancer, urothelial cancer, bladder cancer, hepatocellular carcinoma, gastric cancer (e.g., gastric adenocarcinoma), endometrial carcinoma, salivary gland carcinoma, esophageal carcinoma, lung cancer (e.g., non-small-cell lung cancer and small-cell lung cancer), colon cancer, rectal cancer, colorectal cancer, bone cancer, skin cancer (e.g., squamous skin cancer), thyroid cancer, pancreatic cancer, melanoma, glioma, neuroblastoma, glioblastoma multiforme, sarcoma, lymphoma, and leukemia.

[0109] In a further aspect, the application provides a pharmaceutical composition comprising an effective amount of an antibody-drug conjugate of the present disclosure, a pharmaceutically acceptable salt or solvate thereof, a linker-drug compound of the present disclosure or its isomer, mesomorph, racemate, enantiomer or a mixture thereof, a pharmaceutically acceptable salt or solvate thereof, or a pharmaceutically acceptable carriers, diluents or excipients.

[0110] In a further aspect, the application provides a pharmaceutical formulation comprising an effective amount of a ligand-drug conjugants or a pharmaceutically acceptable salt or solvate thereof, or a linker-drug compound, its isomer, mesomorph, racemate, enantiomer or a mixture thereof, or a pharmaceutically acceptable salt or solvate thereof.

[0111] In a further aspect, the application provides methods of treating or preventing a tumor. In one embodiment, the method comprises administering to a subject in need thereof an effective amount of an antibody-drug conjugate of the present disclosure, or a pharmaceutically acceptable salt or solvate thereof, or a linker-dmg compound of the present disclosure, or its isomer, mesomorph, racemate, enantiomer or a mixture thereof, or a pharmaceutically acceptable salts or solvates. In certain embodiments, said subject is a mammal, such as a human.

[0112] In a further aspect, the application provides the use of said linker drug compounds, their isomers, meso-, endo-, racemates, enantiomers or mixture thereof, or its pharmaceutically acceptable salt or solvate, for preparing an antibody-dmg conjugate or its pharmaceutically acceptable salt or solvate. In certain embodiments, the antibody-drug conjugate may be the auristatin ligand-drug compound as disclosed herein.

[0113] In an further aspect, the application provides methods for preparing an antibody-drug conjugate compound or a pharmaceutically acceptable salt or solvate thereof, said method comprising: coupling a reduced antibody or an antigen-binding fragment thereof with a linker-drug compound as disclosed herein, its an isomer, meso-, endo-, racemate, enantiomer or a mixture thereof, or a pharmaceutically acceptable salt or solvate thereof, to obtain the ligand-drug conjugate. In one embodiment, the antibody or its antigen-binding fragment can be reduced by a thiol reducing agent such as tris(2-carboxyethyl)phosphine (TCEP). BRIEF DESCRIPTION OF THE DRAWINGS

[0114] The foregoing and other features of this disclosure may become more fully apparent from the following description and appended claims, taken in conjunction with the accompanying drawings. Understanding that these drawings depict only several embodiments arranged in accordance with the disclosure and are, therefore, not to be considered limiting of its scope, the disclosure may be described with additional specificity and detail through use of the accompanying drawings, in which:

[0115] Figure 1 shows the LC-MS spectrum of compound LP-la;

[0116] Figure 2 shows the LC-MS spectrum of VcMMAE;

[0117] Figure 3 shows the RP-HPLC results of ADC-l-la (3 A), ADC-C-la (3B), FITC-IgGl -LP-la (3C), ADC-Dxd (3D), ADC-l-lb (3E), ADC-l-lc (3F), ADC-l-ld (3G), ADC-l-le (3H), and RC-48 (31);

[0118] Figure 4 shows the SEC-HPLC results of ADC-l-la (4A), ADC-C-la (4B), and RC-48 (4C), ADC-l-lb (4D), ADC-l-lc (4E), ADC-l-ld (4F), ADC-l-le (4G);

[0119] Figure 5 shows the in vitro efficacy of HER2-ADC in NCI-N87 cells (5A), HER2-ADC in SK- OV-3 cells (5B), HER2-ADC in Calu-3 cells (5C), HER2-ADC in JIMT-1 cells (5D), HER2- ADC in A431 cells (5E), HER2-ADC in MDA-MB-468 cells (5F), and HER2-ADC in a cell model of mixed tumor cells, JIMT-l+MDA-MB-468 (5G);

[0120] Figure 6 shows the in vivo efficacy of HER2-ADC in JIMT-1;

[0121] Figure 7 shows the in vivo efficacy of HER2-ADC in mixed tumors (JIMT-l+MDA-MB-468); Figure 8 shows the in vitro efficacy of ADC-l-la and RC-48 in NCI-N87 cells (8A), ADC-l- la and RC-48 in SK-OV-3 cells (8B), ADC-l-la and RC-48 in Calu-3 cells (8C), ADC-l-la and RC-48 in JIMT-1 cells (8D), ADC-l-la and RC-48 in NCLH1975 cells (8E), ADC-l-la and RC-48 in A431 cells (8F), ADC-l-la and RC-48 in MDA-MB-468 cells (8G), and ADC- l-la and RC-48 in the mixed tumor cell model JIMT-l+MDA-MB-468 (8H);

[0122] Figure 9 shows the in vivo efficacy of ADC-l-la and RC-48 in JIMT-1;

[0123] Figure 10 shows the in vivo efficacy of ADC-l-la and RC-48 in mixed tumors (JIMT-l+MDA- MB-468);

[0124] Figure 11 shows the in vivo efficacy of ADC-l-la and RC-48 in NCI-N87; and Figure 12 shows the in vivo efficacy of ADC-l-la and RC-48 in NCLH1975.

[0125] DETAILED DESCRIPTION

[0126] In the following detailed description, reference is made to the accompanying drawings, which form a part hereof. In the drawings, similar symbols typically identify similar components, unless context dictates otherwise. The illustrative embodiments described in the detailed description, drawings, and claims are not meant to be limiting. Other embodiments may be utilized, and other changes may be made, without departing from the spirit or scope of the subject matter presented herein. It will be readily understood that the aspects of the disclosure, as generally described herein, and illustrated in the Figures, can be arranged, substituted, combined, separated, and designed in a wide variety of different configurations, all of which are explicitly contemplated herein.

[0127] The disclosure provides, among others, antibodies including for example bispecific Dialed antibodies, methods of making such antibodies, monoclonal and / or recombinant antibodies, linkers, payloads, toxins, ligand-drug conjugates, antibody-drug conjugates, antibody-drug conjugates and / or immuno-conjugates derived from such antibodies, linkers, toxins, pharmaceutical compositions containing the antibodies, monoclonal and / or recombinant bispecific antibodies, antibody-drug conjugates and / or immuno-conjugates, the methods for making the antibodies, linkers, antibody-drug conjugates, and compositions, and the methods for treating cancer using the antibody-drug conjugates and / or immuno-conjugates and compositions.

[0128] Unless otherwise indicated, the following terms and phrases, as used herein, are intended to have the meanings set forth below. When a trade name is used herein, unless otherwise indicated in the context, the trade name includes the product formulation, generic drug and active ingredient of said trade name product.

[0129] Unless stated to the contrary, terms used in the claims and specification herein have the meanings set forth below.

[0130] The term "ligand" is a targeting agent that binds specifically to a target component. Said ligand is capable of binding specifically to the cellular component or to other target molecules of interest. The target portion or target is typically on the surface of the cell. In some aspects, the ligand serves to deliver the drug unit to a specific target cell population with which the ligand unit interacts. Ligands include, but are not limited to, proteins, polypeptides and peptides, and non-proteins such as sugars. Suitable ligand units include, for example, antibodies, such as full-length (intact) antibodies and antigen-binding fragments thereof. In embodiments where the ligand unit is a non-antibody targeting reagent, it may be a peptide or polypeptide, or a non-protein molecule. Examples of such targeting reagents include interferons, lymphokines, hormones, growth and colony stimulating factors, vitamins, nutrient transporter molecules, or any other cell-binding molecule or substance. In some embodiments, the linker is covalently attached to the sulfur atom of the ligand. In some aspects, the sulfur atom is a sulfur atom of a cysteine residue that forms an interchain disulfide bond of the antibody. In another aspect, the sulfur atom is a sulfur atom of a cysteine residue that has been imported into the ligand unit, which forms the interchain disulfide bond of the antibody. In another aspect, the sulfur atom is a sulfur atom that has been introduced into a cysteine residue of the ligand unit by, for example, targeted mutagenesis or chemical reaction.

[0131] The term "drug" refers to cytotoxic drugs, i.e., molecules that have a strong ability to disrupt the normal growth of tumor or cancer cells within the cell. Cytotoxic drugs can, in principle, kill tumor cells at sufficiently high concentrations, but because of their lack of specificity, they kill tumor or cancer cells while also causing apoptosis of normal cells, which can lead to serious side effects.

[0132] The term "ligand-drug conjugate" refers to a molecule in which a ligand is attached to a drug by means of a stabilizing linker unit. In the present invention, "ligand-drug coupling" is preferably an antibody drug conjugate (ADC), which refers to the attachment of a monoclonal antibody or a functional antibody fragment or a targeted protein, etc., to a cytotoxic payload, toxin, or drug by means of a stabilized linkage unit.

[0133] As used herein, "antibody" or "antibody unit" includes, to the extent thereof, any part of an antibody structure. This unit may bind, reactively associate, or complex with a receptor, antigen, or other receptor unit possessed by the target cell population. The antibody may be protein-like molecule that binds, complexes, or reacts with a portion of the cell population to be treated or biologically modified. The antibodies comprising the antibody-drug coupling compounds of the present application maintain their original antigen-binding capacity in the wild. Thus, the antibodies of the present invention are capable of binding exclusively to antigens. Antigens involved include, for example, tumor-associated antigens (TAA), cell surface receptor proteins and other cell surface molecules, cell survival regulators, cell proliferation regulators, molecules associated with tissue growth and differentiation (such as are known or foreseen to be functional), lymphokines, cytokines, molecules involved in the regulation of cellular cycling, molecules involved in angiogenic molecules (if known or predicted to be functional). Tumor-associated factors may be cluster differentiation factors (e.g., CD proteins).

[0134] Antibodies applied in antibody-drug conjugates include, but are not limited to, antibodies directed against cell surface receptors and tumor-associated antigens. Such tumor-associated antigens are well known in the industry and can be prepared by methods and information for antibody preparation well known in the industry. To develop effective cellular level targets that can be used in cancer diagnosis and therapy, researchers seek to find transmembrane or other tumor-associated peptides. These targets can be specifically expressed on the surface of one or more cancer cells with little or no expression on the surface of one or more non-cancer cells. Typically, such tumor-associated polypeptides are more overexpressed on the surface of cancer cells relative to the surface of non-cancer cells. Identification of such tumor-associated factors can greatly enhance the specific targeting properties of antibody-based cancer therapies. For convenience, information related to antigens known to the industry is labeled below, including name, other names, and genebank accession number. Nucleic acid and protein sequences corresponding to the tumor-associated antigens can be found in publicly available databases, such as Genbank, and the antibody-targeted tumor-associated antigens include all amino acid sequence variants and isoforms having at least 70%, 80%, 85%, 90%, or 95% homology to the sequences identified in the references, or possessing biological properties and characteristics that are identical to the tumor-associated antigen sequences of the cited literature, biological properties and characteristics of the tumor-associated antigen.

[0135] Antibodies of the present invention include, but are not limited to, murine antibodies, chimeric antibodies, humanized antibodies and fully human antibodies, preferably humanized antibodies and fully human antibodies.

[0136] The term "inhibition" or "inhibition of means that a detectable amount is reduced or completely prevented.

[0137] The term "cancer" refers to a physiological condition or disease characterized by dysregulated cell growth. "Tumor" includes cancer cells.

[0138] The term "linker" or "linker fragment" or "linker unit" refers to a fragment or bond of a chemical structure that is attached to a ligand at one end and to the drug at the other end or may be attached to other connectors and then to the drug, or to other connectors and then to the drug.

[0139] Linkers, including extensions, spacers and amino acid units, can be synthesized by methods known in the art, such as those described in US2005-0238649A1. The linkers can be "cleavable linkers" that facilitate the release of the drug in the cell. For example, acid-unstable linkers (e.g., hydrazone), protease-sensitive (e.g., peptidase-sensitive) linkers, photo-unstable linkers, dimethyl linkers, or disulfide-containing linkers can be used (Chari et al. Cancer 27-131, 1992); U.S. Patent No. 5, 208, 020.

[0140] According to the mechanism of intracellular drug release, as used herein, "linkers" or

[0141] II linkers of antibody-drug conjugates" can be categorized into two types: non-cleavable linkers and cleavable linkers. For antibody-drug conjugates containing a non-cleavable linker, the mechanism of drug release is as follows: after the conjugate binds to the antigen and is endocytosed by the cell, the antibody is enzymatically cleaved in the lysosome, releasing an active molecule consisting of the small molecule drug, the linker, and the amino acid residues of the antibody. The resulting change in the structure of the drug molecule does not diminish its cytotoxicity, but because the active molecule is electrically charged (amino acid residues), it cannot penetrate into neighboring cells. Therefore, such active drugs cannot kill neighboring tumor cells that do not express the targeted antigen (antigen-negative cells) (bystander effect) (Ducry et al., 2010, Bioconjugate Chem. 21 : 5-13). For antibody-drug conjugates containing cleavable linkers, the mechanism of drug release is that the conjugate binds to the antigen and is endocytosed by the cell, then breaks and releases the active ingredient (the small-molecule drug itself) in the target cell. Cleavable linkers are mainly categorized into chemical-sensitive linkers and enzyme-sensitive linkers. Chemically sensitive linkers can be selectively broken due to differences in the nature of the plasma and cytoplasm or tumor microenvironment. Such properties include pH, glutathione concentration, etc. pH-sensitive linkers, which are relatively stable in the neutral or weakly alkaline environment of blood (pH 7.3-7.5), will be hydrolyzed within the weakly acidic tumor microenvironment (pH 5.0-6.5) and lysosomes (pH 4.5-5.0), e.g., hydrazones, carbonates, acetals, and ketals. Antibody-drug conjugates based on such linkers typically have a short half-life (2-3 days) due to the limited plasma stability of acid- cleavable linkers. This short half-life has somewhat limited the use of pH-sensitive linkers in the new generation of antibody-drug conjugates. For glutathione-sensitive linkers, also known as disulfide-bonded linkers. Drug release is based on the difference between the high intracellular glutathione concentration (millimolar range) and the relatively low glutathione concentration in the blood (micromolar range). This is particularly true for tumor cells, whose low oxygen content leads to enhanced reductase activity and thus to higher glutathione concentrations. Disulfide bonds are thermodynamically stable and therefore have better stability in plasma. Enzyme-cleavable linkers, such as peptide linkers, provide better control of drug release. Lysosomal-cleavable peptide linkers can be efficiently cleaved by lysosomal proteases such as Cathepsin (Cathepsin B). This peptide linker is thought to be very stable in the plasma circulation due to the unfavorable extracellular pH and serum protease inhibitors resulting in proteases that are normally inactive outside the cell. Given the high plasma stability and good intracellular break selectivity and potency, enzyme-cleavable linkers are widely used as cleavable linkers for antibody-drug conjugates.

[0142] The term “payload” refers to the pharmaceutically active component of ADC that delivers a toxic cargo to a specific target and elicits the desired therapeutic response. Many of the payloads for oncology ADCs are natural product based with some making covalent interactions with their target. Payloads include the microtubulin inhibitors monomethyl auristatin E (MMAE), monomethyl auristatin F (MMAF) and mertansine, DNA binder calicheamicin and topoisomerase 1 inhibitors SN-38 and exatecan resulting in a renaissance for natural product total synthesis. Glucocorticoid receptor modulators (GRMs) represent to most active payload class for iADCs. Approaches releasing marketed GRM molecules such as dexamethasone and ve been developed. Modified GRM molecules have also been developed that enable the attachment of the linker with the term ADCidified describing the medicinal chemistry process of payload optimization to facilitate linker attachment. Alternatives to small molecule payloads have also been investigated, for example, siRNA. The term "antibodydrug conjugate" refers to the attachment of an antibody to a biologically active drug by means of a stabilized linkage unit. In the present invention, "ligand-drug conjugate" is preferably an antibody drug conjugate (ADC), which refers to the attachment of a monoclonal antibody or antibody fragment to a biologically active toxic drug through a stabilized linkage unit.

[0143] The three-letter codes and single-letter codes for amino acids used in the present invention are as described in J. boil. chem. 1968, 243, 3558.

[0144] The term "natural amino acids" refers to amino acids that can be synthesized biologically. Natural amino acids are generally of the L-type, with a few exceptions, such as glycine, and include both natural and biologically synthesized ones.

[0145] The term "unnatural amino acids" refers to amino acids that can only be synthesized artificially.

[0146] The term "alkyl" refers to a saturated aliphatic hydrocarbon group, which is a straight or branched chain group comprising from 1 to 20 carbon atoms, preferably an alkyl group comprising from 1 to 12 carbon atoms, more preferably an alkyl group comprising from 1 to 10 carbon atoms, and most preferably an alkyl group comprising from 1 to 6 or 1 to 4 carbon atoms. Non-limiting examples include methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, tert-butyl, sec-butyl, n-pentyl, 1 , 1 -dimethylpropyl, 1 , 2-dimethylpropyl, 2, 2-dimethylpropyl, 1 ethylpropyl, 2-methylbutyl, 3 -methylbutyl, n-hexyl, 1 ethyl-2-methylpropyl, 1 , 1 , 2- trimethylpropyl, 1 , 1 -dimethylbutyl 1, 2-dimethylbutyl, 2, 2-dimethylbutyl, 1, 3 -dimethylbutyl,

[0147] 2-ethylbutyl, 2-methylpentyl, 3 -methylpentyl, 4-methylpentyl, 2, 3 -dimethylbutyl, n-heptyl, 2- methylhexyl, 3 -methylhexyl, 4-methylhexyl, 5-methylhexyl, 2, 3 -dimethylpentyl, 2, 4- dimethylpentyl, 2, 2-dimethylpentyl 2, 3 -dimethylpentyl, 3, 3 -dimethylpentyl, 2-ethylpentyl,

[0148] 3 -ethylpentyl, n-octyl, 2, 3 -dimethylhexyl, 2, 4-dimethylhexyl, 2, 5-dimethylhexyl, 2, 2- dimethylhexyl, 3, 3 -dimethylhexyl, 4, 4-dimethylhexyl, 2-ethylhexyl, 3 -ethylhexyl, 4- ethylhexyl, 2-methyl-2-ethylpentyl, 2 -methyl-3 -ethylpentyl, n -nonyl, n-ethylpentyl, 2, 2- ethylpentyl, 4-methylpentyl, 4-methylpentyl, n-nonyl, 2, 2-methylpentyl, 4-methylpentyl, n- nonyl ethylpentyl, n-nonyl, 2-methyl-2-ethylhexyl, 2-methyl-3 -ethylhexyl, 2, 2-di ethylpentyl, n-decyl, 3, 3 -di ethylhexyl, 2, 2-diethylhexyl, and their various branched isomers, and the like. More preferred are lower alkyl groups containing 1 to 6 (e.g., 1 to 4) carbon atoms, and nonlimiting embodiments include methyl, ethyl, n-propyl, isopropyl, n-butyl, iso-butyl, tert-butyl, sec-butyl, n-pentyl, 1, 1 -dimethylpropyl, 1, 2-dimethylpropyl, 2, 2-dimethylpropyl, 1- ethylpropyl, 2-methylbutyl, 3 -methylbutyl, n-hexyl, 1 -ethyl -2-m ethylpropyl, 1 , 1 , 2- trimethylpropyl, 1 , 1 -dimethylbutyl, 1 , 2-dimethylbutyl, 2, 2-dimethylbutyl, 1 , 3- dimethylbutyl, 2-ethylbutyl, 2-methylpentyl, 3 -methylpentyl, 4-methylpentyl, 2, 3- dimethylbutyl and the like. The alkyl group may be substituted or non- substituted, and when substituted, the substituent group may be substituted at any available point of attachment, said substituent group preferably being one or more of the following groups independently selected from alkyl, alkenyl, alkynyl, alkoxy, alkylthio, alkylamino, halogen, mercapto, hydroxy, nitro, cyano, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkoxy, heterocycloalkoxy, cycloalkane thio, heterocycloalkylthio, oxo. i "substituted alkyl" means that the hydrogen in the alkyl group is replaced by a substituent group which, unless otherwise indicated in the text, may be one or more groups selected from the group consisting of: - halogen, -OR', -NR'R' ', -SR', -SiR'R"R'", -OC(O)R', - C(O)R', -CO2R', -CONR'R", -OC(O)NR'R'", -NR"C(O)R", -NR'-C(O)NR"R"", -NR"C(O)2R", -NH-C(NH2)=NH, -NR'C(NH2)=NH, -NH-C(NH2)=NR', -S(O)R', -S(O)2R', -S(O)2NR'R", - NR'S(O)2R", -CN and -NO2, the number of substituents is from 1 to (2m'+l), wherein m' is the total number of carbon atoms in the group, e.g., 1, 2, 3, 4, 5, or 6. r', R" and R'" each designate hydrogen, C1-8 alkyl, aryl, aryl substituted by 1-3 halogens, C1-8 alkyl substituted by 1-3 halogens, C1-8 alkoxy or C1-8 thioalkoxy, or unsubstituted aryl-C 1-4 alkyl. When R' and R" are attached to the same nitrogen atom, they may form a 3-, 4-, 5-, 6-, or 7- meta ring with that nitrogen atom. For example, -NR'R" includes 1-pyrrolidinyl and 4-morpholinyl.

[0149] The term "heteroalkyl" means a group formed by substitution of one or more carbons on an alkyl group by N, O or S.

[0150] The term "cycloalkyl" refers to a saturated or partially unsaturated monocyclic or polycyclic cyclic hydrocarbon group, the ring of the cycloalkyl group containing from 3 to 20 carbon atoms, preferably from 3 to 12 carbon atoms, more preferably from 3 to 10 carbon atoms, and most preferably from 3 to 8 carbon atoms. Non-limiting examples of monocyclic cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cyclohexadienyl, cycloheptenyl, cycloheptatrienyl, cyclooctyl, and the like; multicyclic cycloalkyl groups include cycloalkyl groups of spirocyclic, thick, and bridged rings.

[0151] The term "alkoxy" refers to -O-(alkyl) and -O-(cycloalkyl), wherein alkyl or cycloalkyl is defined above. Non-limiting examples of alkoxy include: methoxy, ethoxy, propoxy, butoxy, cyclopropoxy, cyclobutoxy, cyclopentyloxy, cyclohexyloxy. The alkoxy group may be optionally substituted or non-substituted, and when substituted, the substituent is preferably one or more of the following groups independently selected from alkyl, alkenyl, alkynyl, alkoxy, alkylthio, alkylamino, halogen, mercapto, hydroxy, nitro, cyano, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkoxy, heterocycloalkoxy, cycloalkylthio, heterocycloalkylthio.

[0152] The term "heterocyclic" refers to saturated or partially unsaturated monocyclic or polycyclic cyclic hydrocarbons comprising from 3 to 20 ring atoms, wherein one or more of the ring atoms (e.g., 1, 2, 3, or 4) is a heteroatom selected from nitrogen, oxygen, or S(O)m(wherein m is 0, 1, or 2), and the remaining ring atoms are carbon. Preferably, it contains from 3 to 12 ring atoms, 1 to 4 of which are heteroatoms; more preferably, it contains from 3 to 10 or 3 to 8 ring atoms. Non-limiting examples of monocyclic heterocyclic groups include pyrrolidinyl, piperidinyl, piperazinyl, morpholinyl, thiomorpholinyl, homopiperazinyl, and the like. Polycyclic heterocyclic groups include spiro, thick and bridged ring heterocyclic groups.

[0153] The term "aryl" refers to a 6- to 14-membered all-carbon monocyclic or densely packed polycyclic (i.e., a ring sharing adjacent pairs of carbon atoms) group having a conjugated 7t- electronic system, preferably from 6 to 10 members, e.g., phenyl. The aryl group may be substituted or non-substituted, and when substituted, the substituent may be one or more of the following groups, non-limitingly selected from alkyl, alkenyl, alkynyl, alkoxy, alkylthio, alkylamino, halogen, deuterium atom, mercapto, hydroxyl, nitro, cyano, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkoxy, heterocycloalkoxy, cycloalkylthio or heterocycloalkylthio. n "heteroaryl" includes 5-8-membered monocyclic heteroaryl and 8-12- membered thick heteroaryl.

[0154] The term "5-8-membered monocyclic heteroaryl" refers to an aromatic monocyclic cyclic group containing 5-8 ring atoms, at least one of which is a heteroatom, such as a nitrogen atom, an oxygen atom or a sulfur atom. Optionally, the ring atoms (e.g., carbon atoms, nitrogen atoms, or sulfur atoms) in the cyclic structure may be substituted with oxygen. "5-8-membered monocyclic heteroaryl" includes, for example, "5-7-membered monocyclic heteroaryl", "5-6- membered monocyclic heteroaryl", "5-6-membered monocyclic nitrogen-containing heteroaryl", nitrogen-containing heteroaryl", "6-membered monocyclic nitrogen-containing heteroaryl", etc. Said "nitrogen-containing heteroaryl" contains heteroatoms which contain at least one nitrogen atom, e.g. only one or two nitrogen atoms, or one nitrogen atom and one or two other nitrogen atoms, and 1 or 2 other heteroatoms (e.g. oxygen and / or sulfur atoms), or 2 nitrogen atoms and 1 or 2 other heteroatoms (e.g. oxygen and / or sulfur atoms). "5-8-membered monocyclic heteroaryl" include but are not limited to furyl, thienyl, pyrrolyl, thiazolyl, isothiazolyl, thiadiazolyl, oxazolyl, isoxazolyl, oxadizoyl azolyl, imidazolyl, pyrazolyl, 1,2,3- triazolyl, 1,2,4-triazolyl, 1,2,3-oxadiazolyl, 1,2,4-oxadiazole base, 1,2,5-oxadiazolyl, 1,3,4- oxadiazolyl, pyridinyl, 2-pyridinone, 4-pyridinone, pyrimidinyl, pyridazinyl, pyrazinyl, 1,2,3- triazinyl, 1,3,5-triazinyl, 1,2,4,5-tetrazinyl, azacycloheptatriene, 1,3-diazacycloheptatriene, azacyclooctatetraenyl, and others.

[0155] The term "8-12-membered heteroaryl" refers to an unsaturated aromatic ring structure containing 8-12 ring atoms (at least one of which is a heteroatom, e.g., a nitrogen atom, an oxygen atom, or a sulfur atom) formed by two or more ring structures sharing two adjacent atoms with each other. Optionally, the ring atoms (e.g., carbon atoms, nitrogen atoms, or sulfur atoms) in the ring structure may be oxidized. "8-12-membered thickened heteroaryl" includes "8-10-membered thickened heteroaryl", "8-9-membered thickened heteroaryl", and the like; specific examples include, but are not limited to: pyrrol o [pyrrole], pyrrolofpyrrole], pyrrolofpyrrole] and pyrrol o-pyrrole, pyrrol o-furan, pyrazolopyrrole, pyrazolothiophene, furothiophene, pyrazolino-oxazole, benzofuranyl, benzisofuranyl, benzothiophene, indolyl, isoindolyl, benzoxazolyl, benzimidazolyl, indazolyl, benzotriazolyl, quinolyl, 2-quinolinone, 4-quinolinone, 1-isoquinolinone, isoquinolyl, acridine, phenanthridine, benzo pyridazine, phthalazine, quinazoline, quinoxaline, quinazolidine, quinazolines, and so on; specific examples include but not limited to quinazolinyl, quinoxalinyl, purinyl, naphthyridinyl, etc.

[0156] The term "haloalkyl" means an alkyl group substituted with one or more halogens, wherein alkyl is as defined above.

[0157] The term "deuteroalkyl" means an alkyl group substituted with one or more deuterium atoms, wherein the alkyl group is as defined above.

[0158] The term "hydroxyl" refers to the -OH group.

[0159] The term "halogen" means fluorine, chlorine, bromine or iodine.

[0160] The term "amino" refers to -NH2.

[0161] The term "nitro" refers to -NO2.

[0162] The term "derivative" refers to a substance that has a chemical structure similar to that of a compound but also contains a chemical group that is not present in at least one of the compounds and / or lacks a chemical group that is present in at least one of the compounds. The compound to which the derivative is compared is referred to as the "parent" compound. 'derivative" can be produced from the parent compound in one or more chemical reaction steps.

[0163] The term "pharmaceutically acceptable salt" refers to a pharmaceutically acceptable organic or inorganic salt of a compound (e.g., a drug, a linker-drug compound or a ligand-drug coupling). The compound or coupling may contain at least one amino or carboxyl group and may therefore form an addition salt with a corresponding acid or base. Exemplary salts include, but are not limited to sulfate, trifluoroacetate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, hydrotartrate, ascorbate, salicylate, formate, benzoate glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, potassium and sodium salts.

[0164] The term "solvent compounds" refers to the linker-drug compounds or ligand-drug couplings of the present invention formed with one or more solvent molecules including, but not limited to, water, ethanol, acetonitrile, isopropanol, DMSO, ethyl acetate, and the like.

[0165] The term "pharmaceutical composition" refers to a mixture containing one or more of the compounds described in the present invention or their physiologically / medicinally useful salts or precursor drugs together with other chemical components, as well as other components such as physiologically / medicinally useful carriers and / or excipients. The pharmaceutical compositions are intended to facilitate the administration of the drug to the organism, to facilitate the absorption of the active ingredient and thus the biological activity.

[0166] The term "carrier" refers to a system that alters the way a drug enters and distributes itself in the body, controls the rate of release and delivers the drug to its target. Drug carrier release and targeting systems can reduce drug degradation and loss, decrease side effects and increase bioavailability.

[0167] The term "excipient" refers to an additive or supplement other than the main drug in a pharmaceutical preparation. For example, binders, fillers, disintegrants, lubricants in tablets; matrix backups in semi-solid ointments and creams; preservatives, antioxidants, flavor enhancers, aromatics, co-solvents, emulsifiers, permeability enhancers, osmolality regulators, coloring agents and so on in liquid preparations can be called excipients.

[0168] The term "diluent" or "filler" is mainly used to increase the weight and / or volume of a preparation. The addition of diluents not only ensures a certain volume size, but also reduces the dosage deviation of the main ingredients, improves the compression molding of the drug, etc.

[0169] The present application provides an Auristatin drug conjugate with a high-stability hydrophilic linking unit. The conjugate is introduced into the linker by forming an ether bond between an aminomethyl group with a high-stability hydrophilic linking unit and a hydroxyl group. The conjugate can carry multiple toxins, has good plasma stability, good water solubility, uniformity and safety, can specifically bind to receptors highly expressed in tumor cells, and release toxins in tumor cells. It has good anti-tumor activity and can be used to prevent or treat diseases such as tumors.

[0170] The disclosure is further elaborated below in connection with specific embodiments which, it should be understood, are intended only to illustrate the invention and are not intended to limit the scope of the invention. Test methods for which specific conditions are not indicated in the following embodiments are generally in accordance with conventional conditions or in th conditions recommended by the manufacturer. All percentages, proportions, ratios, or portions are by weight unless otherwise indicated. Unless otherwise defined, all professional and scientific used in the text are used in the same sense as those familiar to those skilled in the art. In addition, any methods and materials similar or equivalent to those documented may be applied to the methods of the present invention. The preferred embodiments and materials described herein are for exemplary purposes only. The generic steps employed in the following embodiments of the present disclosure are: Generic Step A: ADC Preparation

[0171] After cellular expression and purification by Protein A affinity chromatography with molecular sieve chromatography, the antibody was replaced in 20 mM acetate, pH 6.0 buffer, and the antibody was concentrated or diluted to a protein concentration of 3 mg / mL. The linker-payload was dissolved to 20 mg / mL using DMA and set aside. To open the interchain disulfide bonds of the antibody, 20-fold TECP was added according to the molecular ratio and the reaction was carried out at room temperature for 3 h. Then 20-fold linker-payload was added according to the molecular ratio and the reaction was carried out at room temperature for 1 h. After the reaction was completed, the corresponding ADC was obtained by ultrafiltration using a 30 KDa ultrafiltration tube, and the linker-payload that was not coupled to the antibody was removed. ADC samples were obtained.

[0172] Generic Step B: DARby RP-HPLC (Reversed-phase high-performance liquid chromatography)

[0173] Place the vials filled with samples on the sample plate and set the corresponding position, injection volume, number of injection needles and injection method for each sample according to the Standard Operating Procedures for the Use of UPLC. The column model was Proteomix RP-1000 (4.6*100 mm, 5 μ m, 1000A), Sepax, Item No. 465950-4610.

[0174] The method parameters are as follows: 3: SEC detects the monomer rate of antibodies or ADCs

[0175] Place the sample bottle on the sample plate and set the corresponding position, injection volume, number of injection needles and injection method for each sample according to the Standard Operating Procedures for the Use of UPLC.

[0176] Column: Biocore SEC-300 5pm, 4.6x300 mm

[0177] Manufacturer: NanoChrom, Item No.: B213-050030-04630S

[0178] Mobile phase: 50 mM PB+300 mM NaCl+200 mM Arg+5% IPA, pH=6.5

[0179] The parameters:

[0180] Generic Step D: Studying plasma stability

[0181] The ADC sample was mixed with IgG-free plasma, the final concentration of ADC was set at 0.6 mg / mL, and the reaction was placed in a water bath box in a 37 °C thermostat for incubation with the incubation time set for 0, 3, and 7 days using unincubated plasma as a control. After incubation, the sample ADC was purified and extracted for measuring the drugantibody ratio (DAR), which reflects the stability of the sample ADC in plasma.

[0182] EXAMPLES

[0183] Example 1. Synthesis of Compound 1

[0184] Auristatin E (826 mg, 1.128 mmol, 1.0 eq), ki-1 (831.4 mg, 2.256 mmol, 2.0 eq, the synthesis method refers to the synthesis of compound 1 in CN111686259A), zinc acetate (414.2 mg, 5.64 mmol, 2.0 eq) and toluene (15 mL) were added to a 50 mL single-mouth round-bottom flask in sequence, and nitrogen was replaced 3 times. The reaction was refluxed at 115 °C for 4 h, and the reaction was stopped. The mixture was cooled to room temperature, filtered, and the filtrate was concentrated under reduced pressure. The mixture was purified by reverse phase preparative column and freeze-dried to obtain a white solid (605 mg, 51.55%). LC-MS m / z (ES+): [M+H]+: 1041.3.

[0185] Example 2. Synthesis of compound 3

[0186]

[0187] Z-Gly-Gly-Phe-OH (240 mg, 0.581 mmol, 1.0 eq), HATU (264 mg, 0.697 mmol, 1.2 eq), HOBt (94 mg, 0.697 mmol, 1.2 eq), and DMF (2 mL) were added to a 10 mL EP tube in sequence and stirred at room temperature for later use.

[0188] Compound 1 (605 mg, 0.581 mmol, 1.0 eq) and DMF (8 mL) were added to another 25 mL single-necked round-bottom flask in sequence. After stirring at room temperature and dissolving, DBU (95.6 pL, 0.64 mmol, 1.1 eq) was added. The reaction was carried out at room temperature for 0.5 h. The raw material disappeared under TLC monitoring to produce compound 2. The above mixture was then added to this flask, and DIEA (96 pL, 0.581 mmol, 1.0 eq) was added. The reaction was carried out at room temperature for 1 h and monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (487 mg, 69.08%). LC-MS m / z (ES+): [M+H]+: 1213.6 Example 3. Synthesis of Compound 5

[0189] Compound 3 (487 mg, 0.402 mmol, 1.0 eq), 5% Pd / C (48.7 mg) and DMF (5 mL) were added to a 25 mL single-mouth round-bottom flask in sequence. After hydrogen replacement 3 times, the mixture was reacted at room temperature for 1 h. The reaction was monitored by HPLC. The raw material disappeared and a new peak was generated, which was compound 4, recorded as reaction solution

[0190] In another 25 mL single-mouth bottle, ki-2 (176 mg, 0.442 mmol, 1.1 eq (synthesis method refers to CN108452321A), pentafluorophenol (81 mg, 0.442 mmol, 1.1 eq), DCC (91 mg, 0.442 mmol, 1.1 eq) and DMF (3 mL) were added. The mixture was reacted at room r 30 min. The reaction was monitored by TLC. The reaction was completed to obtain ki-3, recorded as reaction solution @.

[0191] Then the reaction solution (T) was filtered into a new 25 mL single-mouth round-bottom flask, and DIEA (73 pL, 0.442 mmol, 1.1 eq) was added under ice-water bath. The reaction solution was filtrated, and the temperature was raised to room temperature for 1 hour after the addition. The reaction was monitored by HPLC. The reaction solution was filtered, and the filtrate was added to the reaction solution containing compound 4 under ice-bath stirring, and then added, the ice bath was removed, and the reaction was carried out at room temperature for 1 hour, and HPLC was monitored. The reaction solution was directly purified by reverse phase preparation, and the preparation solution was lyophilized to obtain a white solid product (320 mg, 54.53%). LC-MS m / z (ES+): [M / 2+H]+: 730.4.

[0192] Example 4. Synthesis of Compound LP-la Compound 5

[0193] Compound 5 (100 mg, 0.0685 mmol, 1.0 eq) was dissolved in 10 mL dry dichloromethane and 4 mL TFA, and reacted at room temperature for 3 h, monitored by HPLC. After the reaction, the solvent was removed by concentration under reduced pressure, purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid product (21 mg, 29.78%). LC-MS m / z (ES+): [M / 2+H]+: 652.4. The LC-MS spectrum is shown in Figure 1.

[0194] Example 5. Synthesis of Compound 6

[0195] MMAE (2.0 g, 2.79 mmol, l.Oeq), (Boc)2O (L21g, 5.57 mmol, 2.0eq) were added to a 100 mL single-necked bottle, and DCM (20 mL) was used to dissolve the mixture. TEA (563 mg, 5.57 mmol, 2.0eq) was added under an ice-water bath. After the addition, the mixture was heated to room temperature and reacted for 72 h. The reaction of the raw material MMAE was completed by TLC monitoring. Post-treatment: The reaction solution was concentrated under reduced pressure and purified by column chromatography (eluent: DCM / MeOH=20 / l) to obtain a white solid (2.28g, 100%). LC-MSm / z (ES+): [M+H]+: 818.4.

[0196] Example 6. Synthesis of compound 7

[0197] Compound 6 (2.28 g, 2.79 mmol, 1.0 eq), ki-1 (2.05 g, 5.57 mmol, 2.0 eq), zinc acetate (1.02 g, 5.57 mmol, 2.0 eq), and toluene (30 mL) were added to a 100 mL single-mouth bottle in sequence. After N2 replacement 3 times, the temperature was raised to 115°C under N2 4 h, the reaction was stopped, cooled to room temperature, filtered, the filtrate was concentrated under reduced pressure, purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid product (1.071 g, 34%). LC- MSm / z (ES+): [M+H]+: 1126.4.

[0198] Example 7. Synthesis of Compound 9

[0199] Compound 7 (900 mg, O.Smmol, l.Oeq) and DMF (9 mL) were added to a 50 mL singlenecked bottle. After stirring and dissolving, DBU (134 mg, 0.88mmol, l.leq) was added dropwise under an ice-water bath. After addition, the temperature was raised to room temperature for reaction for 30 min. The reaction was completed by TLC monitoring and recorded as reaction solution (T).

[0200] In another 50 mL single-necked bottle, Z-Gly-Gly-Phe-OH (364 mg, 0.88mmol, l.leq), HATU (365 mg, 0.96mmol, 1.2eq), HOBt (129.7 mg, 0.96mmol, 1.2eq) and DMF (7 mL) were added dropwise under an ice-water bath. After dissolving, reaction solution (T) and DIEA (103.4 mg, 0.8mmol, l.Oeq) were added dropwise in turn under an ice-water bath. After addition, the temperature was raised to room temperature for reaction for 1 h. The reaction was monitored by HPLC. The reaction solution was purified by reverse phase preparative method, and the preparative solution was lyophilized to obtain a white solid (960 mg, 92.4%). LC-MS m / z (ES+): [M+H]+: 1299.6.

[0201] Example 8. Synthesis of Compound 11

[0202] Compound 10 (960 mg, 0.74mmol, l.Oeq), 5% Pd / C (960mg) and DMF (lOmL) were added to a 50 mL single-mouth bottle. After H2 replacement 3 times, the mixture was reacted irature for Ih. The reaction was monitored by HPLC and recorded as reaction solution (T).

[0203] In another 25 mL single-mouth bottle, ki-2 (322.7mg, 0.81mmol, l.leq), DCC (167mg, O.Slmmol, l. leq) and DMF (5 mL) were added to dissolve the mixture. Pentafluorophenol (149mg, O.Slmmol, l.leq) was added under ice-water bath. After the addition was completed, the mixture was heated to room temperature and reacted for 30min. The reaction was monitored by TLC. After the reaction was completed, ki-3 was obtained and recorded as reaction solution @.

[0204] The reaction solution was filtered into a 50 mL single-mouth bottle, and DIEA (105 mg, 0.81 mmol, 1.1 eq) was added under an ice-water bath. The reaction solution filtrate of was heated to room temperature for 1 h after addition. The reaction was monitored by HPLC. The reaction solution was purified by reverse phase preparation, and the preparation solution was lyophilized to obtain a white solid (895 mg, 78.5%). LC-MSm / z (ES+): [M / 2+H]+: 773.4.

[0205] Example 9. Synthesis of Compound LP-2a

[0206] Compound 12 (400 mg, 0.259 mmol, 1.0 eq) was dissolved in 20 mL dry dichloromethane and 8 mL TFA, and reacted at room temperature for 3 h, monitored by HPLC. After the reaction was completed, the solvent was removed by concentration under reduced pressure, and the crude product was purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid (248 mg, 74%), LC-MSm / z (ES+): [M / 2+H]+: 645.3. Example 10. Synthesis of VcMMAE

[0207] In a 25 mL round-bottom flask, MMAE (120 mg, 0.167 mmol, 1.0 eq) and MC-VC-PAB- PNP (186 mg, 0.25 mmol, 1.5 eq) were added, dissolved in DMF (5 mL), and HOBt (27.1 mg, 0.20 mmol, 1.2 eq) and pyridine (1 mL) were added in sequence, stirred overnight at room temperature, and monitored by HPLC. After the reaction, the crude product was purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid (158.3 mg, 72%), LC-MSm / z (ES+): [M / 2+H]+: 659.0. The LC-MS spectrum is shown in Figure 2.

[0208] Example 11. Synthesis of Compound 13

[0209] Referring to the synthesis method of Example 5, compound 13 was synthesized using refer to the synthesis of compound 17 in patent CN106279352) as a raw material.

[0210] LC-MSm / z (ES+): [M+H]+: 873.6

[0211] Example 12. Synthesis of Compound 14

[0212] Referring to the synthesis method of Example 6, compound 14 was synthesized using compound 13 and ki-1 as raw materials. LC-MS m / z (ES+): [M+H]+: 1180.7.

[0213] Example 13. Synthesis of Compound 16

[0214] Compound 16 was synthesized from compound 14 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1353.9.

[0215] Example 14. Synthesis of Compound 18

[0216] Compound 18 was synthesized from compound 16 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1600.9.

[0217] Example 15. Synthesis of Compound LP-3a

[0218] Compound LP-3a was synthesized from compound 18 with reference to the synthetic imple 9 LC-MSm / z (ES+):[M+H]+: 1344.7.

[0219] Example 16. Synthesis of Compound 23

[0220] Compound 19 was synthesized from compound 12 and MC-VC-PAB-PNP with reference to the synthesis of Example 10. LC-MS m / z (ES+):[M+H]+: 1371.8.

[0221] Example 17. Synthesis of Compound 21

[0222] Compound 21 was synthesized from compound 20 (synthesized with reference to US2017014524A1) with reference to the synthesis method of Example 5. LC-MSm / z (ES+ ):[M+H]+ :933.6.

[0223] Example 18. Synthesis of Compound 22

[0224] Compound 22 was synthesized from compound 21 and ki-1 with reference to the synthetic method of Example 6. LC-MSm / z (ES+):[M+H]+: 1241.7.

[0225] Example 19. Synthesis of Compound 24

[0226] Compound 24 was synthesized from compound 22 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1414.8.

[0227] Example 20. Synthesis of Compound 26

[0228]

[0229] Compound 26 was synthesized from compound 24 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1660.9.

[0230] Example 21. Synthesis of compound 27 (LP-3sa)

[0231] Compound 27 (LP-3sa, whose structure is shown in the structural formula of LP-3s, where the configuration of the chiral carbon at the position-2 is of the S-type) was synthesized from compound 26 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1304.7.

[0232] Example 22. Synthesis of Compound 29

[0233] Compound 29 was synthesized from compound 28 (synthesized with reference to US2017014524A1) with reference to the synthesis method of Example 5. LC-MSm / z (ES+):[M+H]+: 847.6.

[0234] Example 23. Synthesis of Compound 30

[0235] Compound 30 was synthesized from compound 29 and ki-1 with reference to the synthetic method of Example 6. LC-MSm / z (ES+):[M+H]+: 1155.7.

[0236] Example 24. Synthesis of Compound 32

[0237] Compound 32 was synthesized from compound 30 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1328.8.

[0238] Example 25. Synthesis of Compound 34

[0239] Compound 34 was synthesized from compound 32 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1574.9.

[0240] Example 26. Synthesis of Compound LP-4a

[0241] Compound LP-4a was synthesized from compound 34 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1318.7.

[0242] Example 27. Synthesis of Compound 36

[0243] Compound 36 was synthesized from compound 35 (synthesized with reference to US20210346523A1) by the synthetic method of Example 5. LC-MSm / z (ES+):[M+H]+:863.5. Example 28. Synthesis of Compound 37 nd 37 was synthesized from compound 36 and ki-1 with reference to the synthetic method of Example 6. LC-MSm / z (ES+):[M+H]+: 1171.7.

[0244] Example 29. Synthesis of Compound 39

[0245] Compound 39 was synthesized from compound 37 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1344.7.

[0246] Example 30. Synthesis of Compound 41

[0247] Compound 41 was synthesized from compound 39 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1590.9.

[0248] Example 31. Synthesis of Compound LP-5a

[0249] Compound LP-5a was synthesized from compound 41 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1334.7.

[0250] Example 32. Synthesis of Compound 43

[0251] Compound 43 was synthesized with reference to the synthesis method of Example 6, using compound 42 (with reference to the synthesis of compound 17 in US20210346523A1) and ki-1 as raw material. LC-MSm / z (ES+):[M+H]+: 1085.6.

[0252] Example 33. Synthesis of Compound 45

[0253] Compound 45 was synthesized from compound 43 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1258.7.

[0254] Example 34. Synthesis of Compound 47

[0255] Compound 47 was synthesized from compound 45 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1504.8.

[0256] Example 35. Synthesis of Compound LP-6a

[0257] Compound LP-6a was synthesized from compound 47 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1348.7.

[0258] Example 36. Synthesis of Compound 49 p

[0259] Referring to the synthesis method of Example 6, compound 49 was synthesized from compound 48 (referring to the synthesis of compound 6 in CN106279352) and ki-1. LC-

[0260] MSm / z (ES+):[M+H]+: 1082.6.

[0261] Example 37. Synthesis of Compound 51 p

[0262] Compound 51 was synthesized from compound 49 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1255.7.

[0263] Example 38. Synthesis of Compound 53

[0264] Compound 53 was synthesized from compound 51 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1501.8.

[0265] Example 39. Synthesis of Compound LP-7a

[0266] Compound LP-7a was synthesized from compound 53 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1345.7.

[0267] Example 40. Synthesis of Compound 55

[0268] Referring to the synthesis method of Example 5, Compound 55 was synthesized from Compound 54 (referring to the synthesis of Compound 1 in CN113121639A). LC-MSm / z (ES+ ):[M+H]+ :830.6.

[0269] Example 41. Synthesis of Compound 56

[0270] Compound 56 was synthesized from compound 55 and ki-1 with reference to the synthetic method of Example 6. LC-MSm / z (ES+):[M+H]+: 1138.7.

[0271] Example 42. Synthesis of Compound 58

[0272] Compound 58 was synthesized from compound 56 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1311.8.

[0273] Example 43. Synthesis of Compound 60

[0274] Compound 60 was synthesized from compound 58 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1557.9.

[0275] Example 44. Synthesis of Compound LP-8a

[0276] Compound LP-8a was synthesized from compound 60 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1301.7.

[0277] Example 45. Synthesis of Compound 62

[0278] Referring to the synthesis method of Example 6, compound 62 was synthesized from (referring to the synthesis of Compound 1 in CN113121639A) and ki-1. LC- MSm / z (ES+):[M+H]+: 1052.6.

[0279] Example 46. Synthesis of Compound 63

[0280] Compound 63 was synthesized from compound 61 with reference to the synthetic method of Example 7. LC-MSm / z (ES+):[M+H]+: 1225.7.

[0281] Example 47. Synthesis of Compound 65

[0282] Compound 65 was synthesized from compound 63 with reference to the synthetic method of Example 8. LC-MSm / z (ES+):[M+H]+: 1471.8.

[0283] Example 48 Synthesis of Compound LP-9a

[0284] Compound LP-9a was synthesized from compound 65 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1315.7.

[0285] Example 49. Synthesis of Compound 66

[0286]

[0287] Compound 9 (960 mg, 0.74 mmol, 1.0 eq), 5% Pd / C (960 mg) and DMF (10 mL) were added to a 50 mL single-mouth bottle. After H2 replacement 3 times, the reaction was carried out at room temperature for 1 h. The reaction was monitored by HPLC. The reaction was completed and recorded as reaction solution (T). The reaction solution (T) was filtered into a 50 mL single-mouth bottle. MCOSU (274 mg, 0.89 mmol, 1.2 eq) and DIEA (105 mg, 0.81 mmol, 1.1 eq) were added in turn under ice-water bath. After the addition, the temperature was raised to room temperature for 1 h. The reaction was monitored by HPLC. The reaction solution was purified by reverse phase preparation and the preparation solution was lyophilized to obtain a white solid (847.5 mg, 84.3%). LC-MSm / z (ES+): [M+H]+: 1358.2. Example 50. Synthesis of Compound LP-10

[0288] Compound LP-11 was synthesized from compound 3 with reference to the synthetic method of Example 49. LC-MSm / z (ES+):[M+H]+: 1272.8.

[0289] Example 52. Synthesis of Compound 67

[0290]

[0291] Compound 67 was synthesized from compound 24 with reference to the synthetic method of Example 49 LC-MSm / z (ES+):[M+H]+: 1473.9.

[0292] Example 53. Synthesis of Compound LP-12

[0293] Compound LP-12 was synthesized from compound 67 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1273.8.

[0294] Example 54. Synthesis of Compound 68

[0295] Compound 68 was synthesized from compound 32 with reference to the synthetic method of Example 49 LC-MSm / z (ES+):[M+H]+: 1387.8.

[0296] Example 55. Synthesis of Compound LP-13

[0297] Compound LP-13 was synthesized from compound 68 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1287.8.

[0298] Example 56. Synthesis of Compound 69

[0299]

[0300] Compound 69 was synthesized from compound 39 with reference to the synthetic method of Example 49 LC-MSm / z (ES+):[M+H]+: 1403.8.

[0301] Example 57. Synthesis of Compound LP-14

[0302] Compound LP-14 was synthesized from compound 69 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1303.7.

[0303] Example 58. Synthesis of Compound LP-15

[0304] Compound LP-15 was synthesized from compound 45 with reference to the synthetic method of Example 49. LC-MSm / z (ES+):[M+H]+: 1403.8.

[0305] Example 59. Synthesis of Compound LP-16

[0306]

[0307] Compound LP-16 was synthesized from compound 51 with reference to the synthetic method of Example 49. LC-MSm / z (ES+):[M+H]+: 1314.8.

[0308] Example 60. Synthesis of Compound 70

[0309] Compound 70 was synthesized from compound 58 with reference to the synthetic method of Example 49 LC-MSm / z (ES+):[M+H]+: 1370.8.

[0310] Example 61. Synthesis of Compound LP-17

[0311] Compound LP-17 was synthesized from compound 70 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1270.8.

[0312] Example 62. Synthesis of Compound LP-18

[0313] Compound LP-18 was synthesized from compound 63 with reference to the synthetic method of Example 49. LC-MSm / z (ES+):[M+H]+: 1284.8.

[0314] Example 63. Synthesis of Compound 71

[0315]

[0316] Compound 9 (960 mg, 0.74 mmol, 1.0 eq), 5% Pd / C (960 mg) and DMF (10 mL) were added to a 50 mL single-mouth bottle. After H2 replacement 3 times, the reaction was carried out at room temperature for 1 h. The reaction was monitored by HPLC. The reaction was completed and recorded as reaction solution (T). The reaction solution (T) was filtered into a 50 mL single-mouth bottle. Compound M6 (512.5 mg, 0.74 mmol, 1.0 eq, compound M6 refers to the synthesis of compound M6 in CN113827736) and DIEA (105 mg, 0.81 mmol, 1.1 eq) were added in turn under ice-water bath. After the addition, the temperature was raised to room temperature for 1 h. The reaction was monitored by HPLC. The reaction solution was purified by reverse phase preparation and the preparation solution was lyophilized to obtain a white solid (860 mg, 70%). LC-MSm / z (ES+): [M+H]+: 1660.1.

[0317] Example 64. Synthesis of Compound LP-19a

[0318] Compound 72 was synthesized from compound 3 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 783.5. synthesis of Compound LP-20a

[0319] Compound LP-20a was synthesized from compound 72 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 681.4.

[0320] Example 67. Synthesis of Compound 73

[0321] Compound 73 was synthesized from compound 24 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 888.5.

[0322] Example 68. Synthesis of Compound LP-21a

[0323] Compound LP-21a was synthesized from compound 73 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1362.7.

[0324] Example 69. Synthesis of Compound 74 nd 74 was synthesized from compound 32 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 845.1.

[0325] Example 70. Synthesis of Compound LP-22a

[0326] Compound LP-22a was synthesized from compound 74 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1376.8.

[0327] Example 71. Synthesis of Compound 75

[0328] Compound 75 was synthesized from compound 39 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 853.1.

[0329] Example 72. Synthesis of Compound LP-23a

[0330] Compound LP-23a was synthesized from compound 75 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1392.7.

[0331] Example 73. Synthesis of Compound 76

[0332]

[0333] Compound 76 was synthesized from compound 45 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 810.1.

[0334] Example 74. Synthesis of Compound LP-24a

[0335] Compound LP-24a was synthesized from compound 76 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1406.8.

[0336] Example 75. Synthesis of Compound 77 Compound 77

[0337] Compound 77 was synthesized from compound 51 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 808.5.

[0338] Example 76. Synthesis of Compound LP-25a

[0339] Compound LP-25a was synthesized from compound 77 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1403.8.

[0340] Example 77. Synthesis of Compound 78

[0341]

[0342] Compound 78 was synthesized from compound 58 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 836.5.

[0343] Example 78. Synthesis of Compound LP-26a

[0344] Compound LP-26a was synthesized from compound 78 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1359.7.

[0345] Example 79. Synthesis of Compound 79 Co pou d 9

[0346] Compound 79 was synthesized from compound 63 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 793.5.

[0347] Example 80. Synthesis of Compound LP-27a

[0348] Compound LP-27a was synthesized from compound 79 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1373.8.

[0349] Example 81. Synthesis of Compound 80

[0350]

[0351] Compound 9 (960 mg, 0.74 mmol, 1.0 eq), 5% Pd / C (960 mg) and DMF (10 mL) were added to a 50 mL single-mouth bottle. After H2 replacement 3 times, the reaction was carried out at room temperature for 1 h. The reaction was monitored by HPLC. The reaction was completed and recorded as reaction solution (T). The reaction solution (T) was filtered into a 50 mL single-mouth bottle. Compound M8 (497.7 mg, 0.74 mmol, 1.0 eq, compound M8 refers to the synthesis of compound M8 in CN113827736) and DIEA (105 mg, 0.81 mmol, 1.1 eq) were added in turn under ice-water bath. After the addition, the temperature was raised to room temperature for 1 h. The reaction was monitored by HPLC. The reaction solution was purified by reverse phase preparation and the preparation solution was lyophilized to obtain a white solid (918 mg, 75%). LC-MSm / z (ES+): [M / 2+H]+: 827.5.

[0352] Example 82. Synthesis of Compound LP-28a

[0353] Compound LP-28a was synthesized from compound 80 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 671.4. nd 81 was synthesized from Compound 3 with reference to the synthesis of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 784.5.

[0354] Example 84. Synthesis of Compound LP-29a

[0355] Compound LP-29a was synthesized from compound 81 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 678.4.

[0356] Example 85. Synthesis of Compound 82

[0357] Compound 82 was synthesized from compound 24 with reference to the synthetic method of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 885.0.

[0358] Example 86. Synthesis of Compound LP-30a

[0359] Compound LP-30a was synthesized from compound 82 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 678.9.

[0360] Example 87. Synthesis of Compound 83

[0361]

[0362] Compound 83 was synthesized from compound 32 with reference to the synthetic method of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 842.0.

[0363] Example 88. Synthesis of Compound LP-31a

[0364] Compound LP-31a was synthesized from compound 83 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 685.9.

[0365] Example 89. Synthesis of Compound 84

[0366] Compound 84 was synthesized from compound 39 with reference to the synthetic method of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 850.1.

[0367] Example 90. Synthesis of Compound LP-32a nd LP-32a was synthesized from compound 84 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 693.9.

[0368] Example 91. Synthesis of Compound 85

[0369] Compound 85 was synthesized from compound 45 with reference to the synthetic method of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 806.9.

[0370] Example 92. Synthesis of Compound LP-33a

[0371] Compound LP-33a was synthesized from compound 85 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 700.9.

[0372] Example 93. Synthesis of Compound 86

[0373] Compound 86

[0374] Compound 86 was synthesized from compound 51 with reference to the synthetic method of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 805.5.

[0375] Example 94. Synthesis of Compound LP-34a Compound 86 Compound LP 34a

[0376] Compound LP-34a was synthesized from compound 86 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 699.4.

[0377] Example 95. Synthesis of Compound 87

[0378] Compound 87 was synthesized from compound 58 with reference to the synthetic method of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 833.5.

[0379] Example 96. Synthesis of Compound LP-35a

[0380] Compound LP-35a was synthesized from compound 87 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 677.4.

[0381] Example 97. Synthesis of Compound 88

[0382] Compound 88 was synthesized from compound 63 with reference to the synthetic method of Example 81 LC-MSm / z (ES+): [M / 2+H]+: 790.5.

[0383] Example 98. Synthesis of Compound LP-36a

[0384]

[0385] Compound 89 was synthesized from compound 16 with reference to the synthetic method of Example 49 LC-MSm / z (ES+):[M / 2+H]+: 707.4.

[0386] Example 100. Synthesis of Compound LP-37

[0387] Compound LP-37 was synthesized from compound 89 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M+H]+: 1313.8.

[0388] Example 101. Synthesis of Compound 90

[0389] Compound 90 was synthesized from compound 16 with reference to the synthetic method of Example 63 LC-MSm / z (ES+):[M / 2+H]+: 858.0.

[0390] Example 102. Synthesis of Compound LP-38a

[0391] Compound LP-38a was synthesized from compound 90 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 701.9.

[0392] Example 103. Synthesis of Compound 91

[0393] Compound 91 was synthesized from compound 16 with reference to the synthesis of Example 81 LC-MSm / z (ES+):[M / 2+H]+: 855.0.

[0394] Example 104. Synthesis of Compound LP-39a

[0395] Compound LP-39a was synthesized from compound 91 with reference to the synthetic method of Example 9. LC-MSm / z (ES+):[M / 2+H]+: 698.9.

[0396] Example 105. Expression and purification of TA001 antibody:

[0397] Expi293 suspension cells (Shanghai Aopuma Biotech Co., Ltd.) were cultured. One day before transfection, cells were inoculated at a certain density in OPM-293 CD05 Medium (Shanghai Aopuma Biotech Co., Ltd.) and cultured overnight in a cell culture shaker at 37 °C, 5% CO2, and 120 rpm. The next day, PELMAX was used to transfect the antibody expression plasmid. OPM-293 ProFeed (Shanghai Aopuma Biotech Co., Ltd.) was added as feed on the first and third days after transfection, and the supernatant was collected by centrifugation on the sixth day after transfection.

[0398] The supernatant was initially purified using a Protein A affinity chromatography column, and then finely purified by SEC or CHT to remove impurities such as polymers.

[0399] The amino acid sequneces of Antibody TA001 are listed as SEQ ID NO: 9 for its light chain; SEQ ID NO: 7 for its light chain variable region; SEQ ID NO: 12 for its heavy chain; and SEQ ID NO: 10 for its heavy chain variable region. In addition, the amino acid sequences of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3, as well as the light chain constant region and the heavy chain constant region are listed. Synthesis of Compound 92

[0400] Compound 6 (2.28 g, 2.79 mmol, 1.0 eq), ki-4 (2.13 g, 5.57 mmol, 2.0 eq, the synthesis method refers to the synthesis of compound 4b in WO2020146541), zinc acetate (1.02 g, 5.57 mmol, 2.0 eq), and toluene (30 mL) were added in sequence. After N2 replacement 3 times, the temperature was raised to 115°C under N2 protection for 4 hours, the reaction was stopped, cooled to room temperature, filtered. The filtrate was concentrated under reduced pressure, purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid product (1.2 g, 37.8%). LC-MSm / z (ES+): [M+H]+: 1140.5.

[0401] Example 107. Synthesis of Compound 93

[0402] Compound 92 (1.0 g, 0.877 mmol, 1.0 eq) and DMF (10 mL) were added to a 50 mL single-necked round-bottom flask in sequence. After stirring at room temperature and dissolving, DBU (144.1 pL, 0.985 mmol, 1.1 eq) was added and reacted at room temperature for 0.5 h. The starting material disappeared under TLC monitoring, and compound 93 was produced. The reaction solution was directly purified by reverse phase preparation, and the preparation solution was lyophilized to obtain a white solid product (661.0 mg, 82.1%). LC-MS m / z (ES+): [M+H]+: 918.6.

[0403] Example 108. Synthesis of Compound 94

[0404] Compound 93 (0.53 g, 0.581 mmol, 1.0 eq) and Fmoc-L-valine (197.2 mg, 0.581 mmol, 1.0 eq) were added to a 25 mL single-necked round-bottom flask, and DMF (5 mL) was added to dissolve. Then, HATU (264 mg, 0.697 mmol, 1.2 eq), HOBt (94 mg, 0.697 mmol, 1.2 eq), and DIEA (288 pL, 1.743 mmol, 3.0 eq) were added in an ice bath. After the addition, the mixture was heated to room temperature and stirred for 1 h and then monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (540.2 mg, 75.0%). LC-MS m / z (ES+): [M+H]+: 1239.8. Example 109. Synthesis of Compound 96

[0405]

[0406] In a 10 mL EP tube, ki-2 (115.9 mg, 0.291 mmol, 1.0 eq), HATU (132 mg, 0.349 mmol, 1.2 eq), HOBt (47 mg, 0.349 mmol, 1.2 eq), and DMF (2 mL) were added in sequence and stirred at room temperature for later use.

[0407] In another 10 mL single-necked round-bottom flask, compound 94 (360.1 mg, 0.291 mmol, 1.0 eq) and DMF (2 mL) were added in sequence. After stirring at room temperature and dissolving, DBU (47.8 pL, 0.32 mmol, l. leq) was added and reacted at room temperature for 0.5 h. The reaction was monitored by HPLC. The starting material disappeared and compound 95 was produced. Then the above mixture was added to this bottle, and DIEA (48 pL, 0.291 mmol, 1.0 eq) was added. The reaction was carried out at room temperature for 1 h and monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (308.6 mg, 76%). LC-MS m / z (ES+): [M+2H]2+: 699.4.

[0408] Example 110. Synthesis of Compound LP-51a

[0409] Compound 96 (200 mg, 0.143 mmol, 1.0 eq) was dissolved in 10 mL dry dichloromethane and 4 mL TFA, and reacted at room temperature for 3 h, monitored by HPLC. After the reaction was completed, the solvent was removed by concentration under reduced pressure, and the crude product was purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid (127.4 mg, 78%), LC-MSm / z (ES+): [M+2H]2+: 571.3. Example 111. Synthesis of Compound 97

[0410] Auristatin E (2.04 g, 2.79 mmol, l.Oeq), ki-4 (2.13 g, 5.57 mmol, 2.0eq, the synthesis method refers to the synthesis of compound 4b in WO2020146541), zinc acetate (1.02 g, 5.57 mmol, 2.0eq), and toluene (30 mL) were added in sequence. After N2 replacement 3 times, the temperature was raised to 115 °C under N2 protection for 4h, the reaction was stopped, cooled to room temperature, filtered. The filtrate was concentrated under reduced pressure, purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid product (1.3 g, 44.2%). LC-MSm / z (ES+): [M+H]+: 1053.7.

[0411] Compound 97 (924.7 mg, 0.877 mmol, 1.0 eq) and DMF (9 mL) were added to a 50 mL single-necked round-bottom flask in sequence. After stirring at room temperature and dissolving, DBU (144.1 pL, 0.985 mmol, 1.1 eq) was added and reacted at room temperature for 0.5 h. The starting material disappeared under TLC monitoring, and compound 98 was produced. The reaction solution was directly purified by reverse phase preparation, and the preparation solution was lyophilized to obtain a white solid product (622.5 mg, 85.3%). LC-MS m / z (ES+): [M+H]+: 832.6.

[0412] Example 113. Synthesis of Compound 99

[0413] Compound 93 (483.5 mg, 0.581 mmol, 1.0 eq) and Fmoc-L-valine (197.2 mg, 0.581 mmol, 1.0 eq) were added to a 25 mL single-necked round-bottom flask, and DMF (5 mL) was added to dissolve. Then, HATU (264 mg, 0.697 mmol, 1.2 eq), HOBt (94 mg, 0.697 mmol, 1.2 eq), and DIEA (288 pL, 1.743 mmol, 3.0 eq) were added in an ice bath. After the addition, the mixture was heated to room temperature and stirred for 1 h and then monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (517.4 mg, 77.2%). LC-MS m / z (ES+): [M+H]+: 1153.7. Example 114. Synthesis of Compound 101

[0414] In a 10 mL EP tube, ki-2 (115.9 mg, 0.291 mmol, 1.0 eq), HATU (132 mg, 0.349 mmol, 1.2 eq), HOBt (47 mg, 0.349 mmol, 1.2 eq), and DMF (2 mL) were added in sequence and stirred at room temperature for later use.

[0415] In another 10 mL single-necked round-bottom flask, compound 99 (335.1 mg, 0.291 mmol, 1.0 eq) and DMF (2 mL) were added in sequence. After stirring at room temperature and dissolving, DBU (47.8 pL, 0.32 mmol, l. leq) was added and reacted at room temperature for 0.5 h. The reaction was monitored by HPLC. The starting material disappeared and compound 100 was produced. Then the above mixture was added to this bottle, and DIEA (48 pL, 0.291 mmol, 1.0 eq) was added. The reaction was carried out at room temperature for 1 h and HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (299.1 mg, 78.5%). LC-MS m / z (ES+): [M+2H]2+: 656.4.

[0416] Example 115. Synthesis of Compound LP-52a

[0417] Compound 101 (200 mg, 0.152 mmol, 1.0 eq) was dissolved in 10 mL dry dichloromethane and 4 mL TFA, and reacted at room temperature for 3 h, monitored by HPLC. After the reaction was completed, the solvent was removed by concentration under reduced pressure, and the crude product was purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid (122.3 mg, 69.4%), LC-MSm / z (ES+): [M+2H]2+: 578.3.

[0418] Example 116. Synthesis of Compound 102

[0419] Compound DIEA (4.88 g, 37.74 mmol, 3 eq) and HATU (5.74 g, 15.09 mmol, 1.2 eq) were added to a solution of compound Fmoc-L-citrulline (5 g, 12.58 mmol, 1 eq) and glycine tert-butyl ester (2.48 g, 18.87 mmol, 1.5 eq) in DCM (10 mL), and the reaction solution was stirred at room temperature overnight. LCMS showed that the reaction was complete. Dichloromethane / methanol (10: 1, 150 mL) and water (50 mL) were added to the reaction solution, and the mixture was washed twice with dilute hydrochloric acid (0.5 M), 50 mL each time, and twice with saturated brine, 50 mL each time, dried over anhydrous sodium sulfate, filtered, and dried under reduced pressure. The residue was purified by silica gel column chromatography (eluent: methanol / dichloromethane 0: 1 to 1 :9) to obtain a white solid product (5.7 g, 88.73%). LC-MS m / z (ES+): [M+H]+: 511.3.

[0420] Example 117. Synthesis of Compound 103

[0421] TFA (2 mL) was added to a solution of compound 102 (1.60 g, 3.13 mmol, 1 eq) in DCM

[0422] (10 mL) at 0 °C, and the reaction was stirred overnight at room temperature. LCMS showed that the reaction was complete. The reaction solution was evaporated under reduced pressure, and the residue was purified by silica gel column chromatography to obtain a white solid product (1.82 g, 63.83%). LC-MS m / z (ES+): [M+H]+: 455.2.

[0423] Example 118. Synthesis of Compound 104

[0424] To a solution of compound 103 (1.01 g, 2.22 mmol, 1 eq) in DMF (20 mL) were added acetic acid (400.35 mg, 382.02 pL, 6.66 mmol, 3 eq), copper acetate (121.09 mg, 113.38 pL, 0.67 mmol, 0.3 eq) and lead acetate (1.97 g, 0.89 mL, 4.45 mmol, 2 eq), and the reaction was stirred at 60°C for 1 hour. LCMS showed that the reaction was complete. The reaction solution was dried under reduced pressure, saturated NaHCCL solution was added to the residue to adjust pH = 7, DCM / MeOH (10: 1, IL) was added, the mixed solution was extracted 3 times with DCM / MeOH (10: 1), 500mL each time, the organic phases were combined, washed with saturated brine (lOOmL), the organic phases were dried over anhydrous Na2SO4, filtered and dried under reduced pressure. The residue was purified by silica gel column chromatography (eluent: methanol / dichloromethane 0: 1 to 10: 1) to obtain a white solid product (256.5mg, 24.63%). LC-MS m / z (ES+): [M+Na]+: 491.3.

[0425] Example 119. Synthesis of Compound 105

[0426] Compound 6 (2.12 g, 2.59 mmol, l.Oeq), compound 104 (2.77 g, 5.18 mmol, 2.0eq), zinc acetate (1.08 g, 5.18 mmol, 2.0eq) were added to a 100 mL single-mouth bottle in sequence, dissolved in toluene (30 mL), replaced with N2 three times, heated to 115°C under N2 protection for 4 hours, stopped the reaction, cooled to room temperature, and filtered. The filtrate was concentrated under reduced pressure, purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid product (1.35 g, 42.4%). LC-MS m / z (ES+): [M+H]+: 1226.7.

[0427] Example 120. Synthesis of Compound 106

[0428] Compound 105 (1.02 g, 0.832 mmol, 1.0 eq) and DMF (9 mL) were added to a 50 mL single-necked round-bottom flask in sequence. After stirring at room temperature and dissolving, DBU (136.7 pL, 0.915 mmol, 1.1 eq) was added and reacted at room temperature for 0.5 h. The starting material disappeared under TLC monitoring, and compound 98 was produced. The reaction solution was directly purified by reverse phase preparation, and the preparation solution was lyophilized to obtain a white solid product (726.6 mg, 87%). LC-MS m / z (ES+): [M+H]+: 1004.6.

[0429] Compound 106 (496.5 mg, 0.494 mmol, 1.0 eq) and Fmoc-L-valine (186.3 mg, 0.494 mmol, 1.0 eq) were added to a 25 mL single-necked round-bottom flask, and DMF (5 mL) was added to dissolve. Then, HATU (225.6 mg, 0.593 mmol, 1.2 eq), HOBt (80 mg, 0.593 mmol, 1.2 eq), and DIEA (191.6 pL, 1.483 mmol, 3.0 eq) were added in an ice bath. After the addition, the mixture was heated to room temperature and stirred for 1 h and then monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (496.8 mg, 75.8%). LC-MS m / z (ES+): [M+H]+: 1325.8. Example 122. Synthesis of Compound 109

[0430] In a 10 mL EP tube, ki-2 (115.9 mg, 0.291 mmol, 1.0 eq), HATU (132 mg, 0.349 mmol, 1.2 eq), HOBt (47 mg, 0.349 mmol, 1.2 eq), and DMF (2 mL) were added in sequence and stirred at room temperature for later use.

[0431] In another 10 mL single-necked round-bottom flask, compound 107 (385.8 mg, 0.291 mmol, 1.0 eq) and DMF (2 mL) were added in sequence. After stirring and dissolving at room temperature, DBU (47.8 pL, 0.32 mmol, 1. leq) was added and reacted at room temperature for 0.5 h. The reaction was monitored by HPLC. The starting material disappeared and compound 108 was produced. Then the above mixture was added to this bottle, and DIEA (48 pL, 0.291 mmol, 1.0 eq) was added. The reaction was carried out at room temperature for 1 h and monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (331.6 mg, 76.8%). LC-MS m / z (ES+): [M+2H]2+: 742.4.

[0432] Example 123. Synthesis of Compound LP-53a

[0433] Compound 109 (200 mg, 0.135 mmol, 1.0 eq) was dissolved in 10 mL dry dichloromethane and 4 mL TFA, and reacted at room temperature for 3 h, monitored by HPLC. After the reaction was completed, the solvent was removed by concentration under reduced pressure, and the crude product was purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid (107.9 mg, 65.2%), LC-MSm / z (ES+): [M+2H]2+: 614.3.

[0434] Example 124. Synthesis of Compound 110

[0435] Auristatin E (2.3 g, 3.14 mmol, 1.0 eq), compound 104 (2.94 g, 6.28 mmol, 2.0 eq), zinc acetate (1.15 g, 6.28 mmol, 2.0 eq) and toluene (30 mL) were added to a 100 mL single-necked bottle in sequence. After N2 replacement for 3 times, the temperature was raised to 115°C under N2 protection for 4 h, the reaction was stopped, cooled to room temperature, and filtered. The filtrate was concentrated under reduced pressure, purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid product (1.5 g, 43.2%). LC-MSm / z (ES+): [M+H]+: 1140.7.

[0436] Example 125. Synthesis of Compound 111

[0437] Compound 110 (918.7 mg, 0.805 mmol, 1.0 eq) and DMF (9 mL) were added to a 50 mL single-necked round-bottom flask in sequence. After stirring at room temperature and dissolving, DBU (132.4 pL, 0.886 mmol, 1.1 eq) was added and reacted at room temperature for 0.5 h. The starting material disappeared under TLC monitoring to produce compound 98. The reaction solution was directly purified by reverse phase preparation, and the preparation solution was lyophilized to obtain a white solid product (623.5 mg, 84.3%). LC-MS m / z (ES+): [M+H]+: 918.6.

[0438] Example 126. Synthesis of Compound 112 id 111 (481.3 mg, 0.524 mmol, 1.0 eq) and Fmoc-L-valine (177.9 mg, 0.524 mmol, 1.0 eq) were added to a 25 mL single-necked round-bottom flask, and DMF (5 mL) was added to dissolve. Then, HATU (239 mg, 0.629 mmol, 1.2 eq), HOBt (85 mg, 0.629 mmol, 1.2 eq), and DIEA (203 pL, 1.572 mmol, 3.0 eq) were added in an ice bath. After the addition, the mixture was heated to room temperature and stirred for 1 h and then monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (495.7 mg, 76.3%). LC-MS m / z (ES+): [M+H]+: 1239.7. Example 127. Synthesis of Compound 114

[0439] In a 10 mL EP tube, ki-2 (115.9 mg, 0.291 mmol, 1.0 eq), HATU (132 mg, 0.349 mmol, 1.2 eq), HOBt (47 mg, 0.349 mmol, 1.2 eq), and DMF (2 mL) were added in sequence and stirred at room temperature for later use.

[0440] In another 10 mL single-necked round-bottom flask, compound 112 (360.7 mg, 0.291 mmol, 1.0 eq) and DMF (2 mL) were added in sequence. After stirring at room temperature and dissolving, DBU (47.8 pL, 0.32 mmol, l.leq) was added and reacted at room temperature for 0.5 h. The reaction was monitored by HPLC. The starting material disappeared and compound 113 was produced. Then the above mixture was added to this bottle, and DIEA (48 μL, 0.291 mmol, 1.0 eq) was added. The reaction was carried out at room temperature for 1 h and monitored by HPLC. After the reaction was completed, the product was purified by reverse phase preparative column to obtain a white solid product (314 mg, 77.2%). LC-MS m / z (ES+): [M+2H]2+: 699.4.

[0441] Example 128. Synthesis of Compound LP-54a

[0442] Compound 114 (200 mg, 0.143 mmol, 1.0 eq) was dissolved in 10 mL dry dichloromethane and 4 mL TFA, and reacted at room temperature for 3 h, monitored by HPLC. After the reaction was completed, the solvent was removed by concentration under reduced pressure, and the crude product was purified by reverse phase preparative column, and the preparative solution was lyophilized to obtain a white solid (120.6 mg, 67.9%), LC-MSm / z (ES+): [M+2H]2+: 621.3. ADC-l-la

[0443] ADC-l-la was prepared by combining the corresponding linker-payload (LP-la, whose structure is shown in the structural formula of LP-1, wherein the configuration of the chiral carbon at position-2 is S-type) with antibody TA001 according to the method of generic Step A. The sequence information of TA001 is shown in Example 105. The RP-HPLC detection results of ADC-l-la are shown in Figure 3A, and the SEC-HPLC detection results are shown in Figure

[0444] Example 130. ADC-2-la

[0445] ADC-2- la was prepared as the corresponding linker-payload (LP-2a, the structure of which is shown in the structural formula of LP-2, where the configuration of the chiral carbon at position 2 is of the S-type) was prepared in accordance with the method of generic Step A. was prepared with the antibody TA001 to obtain, and the sequence information of TA001 is shown in Example 105.

[0446] ADC-2-la was prepared by combining the corresponding linker-payload (LP-2a, whose structure is shown in the structural formula of LP-2, wherein the configuration of the chiral carbon at position-2 is S-type) with antibody TA001 according to the method of generic Step A. The sequence information of TA001 is shown in Example 105.

[0447]

[0448] Control Example 1. ADC- C-la

[0449] ADC-C-la was prepared by combining compound VcMMAE with antibody TA001 according to the method of generic Step A. The RP-HPLC detection results of ADC-C-la are shown in Figure 3B, and the SEC-HPLC detection results are shown in Figure 4B.

[0450] Example 131. ADC-3-la

[0451] ADC-3-la was prepared as the corresponding linker-payload (LP-10) was prepared with antibody TA001 according to the method of generic Step A.

[0452] Example 132. ADC-4-la

[0453] ADC-4-la was prepared by combining the corresponding linker-payload (LP-37) with antibody TA001 according to the method of generic Step A.

[0454]

[0455] Example 133. ADC-5-la

[0456] ADC-5-la was prepared by combining the corresponding linker-payload (LP-16) with antibody TA001 according to the method of generic Step A.

[0457] Example 134. ADC-6-la

[0458] ADC-6-la was prepared by combining the corresponding linker-payload (LP-11) with antibody TA001 according to the method of generic Step A. ADC-7-la

[0459] ADC-7-la was prepared by combining the corresponding linker-payload (LP-12) with antibody TA001 according to the method of generic Step A.

[0460] Example 136. ADC-8-la

[0461] ADC-8-la was prepared by combining the corresponding linker-payload (LP-13) with antibody TA001 according to the method of generic step A

[0462] Example 137. ADC-9-la

[0463] ADC-9-la was prepared by combining the corresponding linker-payload (LP-14) with antibody TA001 according to the method of generic Step A.

[0464]

[0465] Example 138. ADC-10-la

[0466] ADC-10-la was prepared by combining the corresponding linker-payload (LP-15) with antibody TA001 according to the method of generic Step A.

[0467] Example 139. ADC-ll-la

[0468] ADC-ll-la was prepared by combining the corresponding linker-payload (LP-17) with antibody TA001 according to the method of generic Step A.

[0469]

[0470] Example 140. ADC-12-la

[0471] ADC-12-la was prepared by combining the corresponding linker-payload (LP-18) with antibody TA001 according to the method of generic Step A.

[0472] Example 141. ADC-13-la

[0473] ADC-13-la was prepared by combining the corresponding linker-payload (LP-3a, whose structure is shown in the structural formula of LP-3, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0474]

[0475] Example 142. ADC-14-la

[0476] ADC-14-la was prepared by reacting the corresponding linker-payload (LP-7a, whose structure is shown in the structural formula of LP-7, wherein the configuration of the chiral carbon at position-2 is S-type) with antibody TA001 according to the method of generic Step A.

[0477] Example 143. ADC-15-la

[0478] ADC-15-la was prepared by combining the corresponding linker-payload (LP-3sa, whose structure is shown in the structural formula of LP-3s, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0479]

[0480] Example 144. ADC-16-la

[0481] ADC-16-la was prepared by combining the corresponding linker-payload (LP-4a, whose structure is shown in the structural formula of LP-4, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0482] Example 145. ADC-17-la

[0483] ADC-16-la was prepared by combining the corresponding linker-payload (LP-4a, whose structure is shown in the structural formula of LP-4, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0484] Example 146. ADC-18-la

[0485] ADC-18-la was prepared by combining the corresponding linker-payload (LP-6a, whose structure is shown in the structural formula of LP-6, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0486] Example 147. ADC-19-la

[0487] ADC-19-la was prepared by reacting the corresponding linker-payload (LP-8a, whose structure is shown in the structural formula of LP-8, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0488]

[0489] Example 148. ADC-20-la

[0490] ADC-20-la was prepared by combining the corresponding linker-payload (LP-9a, whose structure is shown in the structural formula of LP-9, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0491] Example 149. ADC-21-la

[0492] ADC-21-la was prepared by combining the corresponding linker-payload (LP-28a, whose structure is shown in the structural formula of LP-28, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0493]

[0494] Example 150. ADC-22-la

[0495] ADC-22-la was prepared by combining the corresponding linker-payload (LP-29a, whose structure is shown in the structural formula of LP-29, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0496] Example 151. ADC-23-la

[0497] ADC-23-la was prepared by combining the corresponding linker-payload (LP-30a, whose structure is shown in the structural formula of LP-30, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0498]

[0499] Example 152. ADC-24-la

[0500] ADC-24-la was prepared by combining the corresponding linker-payload (LP-31a, whose structure is shown in the structural formula of LP-31, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0501] Example 153. ADC-25-la

[0502] ADC-25-la was prepared by combining the corresponding linker-payload (LP-32a, whose structure is shown in the structural formula of LP-32, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0503]

[0504] Example 154. ADC-26-la

[0505] ADC-26-la was prepared by combining the corresponding linker-payload (LP-33a, whose structure is shown in the structural formula of LP-33, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0506] Example 155. ADC-27-la

[0507] ADC-27-la was prepared by reacting the corresponding linker-payload (LP-35a, whose structure is shown in the structural formula of LP-35, wherein the configuration of the chiral carbon at position-2 is S-type) with antibody TA001 according to the method of generic Step A.

[0508]

[0509] Example 156. ADC-28-la

[0510] ADC-28-la was prepared by combining the corresponding linker-payload (LP-36a, whose structure is shown in the structural formula of LP-36, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0511] Example 157. ADC-29-la

[0512] ADC-29-la was prepared by combining the corresponding linker-payload (LP-39a, whose structure is shown in the structural formula of LP-39, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0513]

[0514] Example 158. ADC-30-la

[0515] ADC-30-la was prepared by combining the corresponding linker-payload (LP-34a, whose structure is shown in the structural formula of LP-34, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A p

[0516] ADC-31-la was prepared by combining the corresponding linker-payload (LP-19a, whose structure is shown in the structural formula of LP-19, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0517]

[0518] Example 160. ADC-35-la

[0519] ADC-35-la was prepared by combining the corresponding linker-payload (LP-22a, whose structure is shown in the structural formula of LP-22, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of genericStep A.

[0520] Example 161. ADC-39-la

[0521] ADC-39-la was prepared by combining the corresponding linker-payload (LP-26a, whose structure is shown in the structural formula of LP-26, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0522]

[0523] Example 162. ADC-45-la

[0524] ADC-45-la was prepared by combining the corresponding linker-payload (LP-20a, whose structure is shown in the structural formula of LP-20, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0525] Example 163. ADC-48-la

[0526] ADC-48-la was prepared by combining the corresponding linker-payload (LP-27a, whose structure is shown in the structural formula of LP-27, wherein the configuration of the chiral carbon at position-2 is S-type) with the antibody TA001 according to the method of generic Step A.

[0527]

[0528] Example 164. Preparation of ADC-51-la

[0529] ADC-5 1-la was prepared by combining the corresponding linker-payload (LP-51a) with antibody TA001 according to the method of generic Step A.

[0530] Example 165. Preparation of ADC-52-la

[0531] ADC-52-la was prepared by combining the corresponding linker-payload (LP-52a) with antibody TA001 according to the method of generic Step A.

[0532]

[0533] Example 166. Preparation of ADC-53-la

[0534] ADC-53-la was prepared by combining the corresponding linker-payload (LP-53a) with antibody TA001 according to the method of generic Step A.

[0535] Example 167. Preparation of ADC-54-la

[0536] ADC-54-la was prepared by combining the corresponding linker-payload (LP-54a) with antibody TA001 according to the method of generic Step A. iple 2. FITC-IgGl-LP-la

[0537] FITC-IgGl-LP-la was prepared by combining the corresponding linker-payload (LP- la, whose structure is shown in the structural formula of LP-1, wherein the configuration of the chiral carbon at position-2 is S-type) with an irrelevant antibody FITC-IgGl (an IgG antibody of the same type that does not target any antigen) according to the method of generic Step A. The RP-HPLC detection results of FITC-IgGl-LP-la are shown in Figure 3C.

[0538] The amino acid sequences of the unrelated antibody FITC-IgGl are listed as SEQ ID NO: 25 for the light chain; SEQ ID NO: 26 for the light chain variable region; SEQ ID NO: 27 for the heavy chain; and SEQ ID NO: 28 for the heavy chain variable region.

[0539] Control Example 3. Preparation of ADC-Dxd

[0540] ADC-Dxd was prepared by combining the corresponding linker-payload (LP-55, synthesized according to the method described in Example 58 of CN104755494 A) with antibody TA001 according to the method of generic Step A. The RP-HPLC test results of ADC- Dxd are shown in Figure 3D.

[0541]

[0542] Control Example 4. Preparation of ADC-l-lb

[0543] ADC-l-lb was prepared by combining the corresponding linker-payload (LP-la, whose structure is shown in the structural formula of LP-1, wherein the configuration of the chiral carbon at position-2 is S-type) with the anti-HER2 antibody Disitamab according to the method of generic Step A. The RP-HPLC test results of ADC-l-lb are shown in Figure 3E, and the SEC-HPLC test results are shown in Figure 4D.

[0544] The amino acid sequences of Disitamabare listed as SEQ ID NO: 29 for the light chain; SEQ ID NO: 30 for the light chain variable region; SEQ ID NO: 31 for the heavy chain; and SEQ ID NO: 32 for the heavy chain variable region.

[0545] Control Example 5. Preparation of ADC-l-lc

[0546] ADC-l-lc was prepared by combining the corresponding linker-payload (LP-la, whose structure is shown in the structural formula of LP-1, wherein the configuration of the chiral carbon at position-2 is S-type) with the anti-HER2 antibody HT-19 according to the method of generic Step A. The RP-HPLC test results of ADC-l-lc are shown in Figure 3F, and the SEC- HPLC test results are shown in Figure 4E.

[0547]

[0548] The amino acid sequences of Disitamabare listed as SEQ ID NO: 33 for the light chain; SEQ ID NO: 34 for the light chain variable region; SEQ ID NO: 35 for the heavy chain; and SEQ ID NO: 36 for the heavy chain variable region.

[0549] Control Example 6. Preparation of ADC-l-ld

[0550] ADC-l-ld was prepared by combining the corresponding linker-payload (LP-la, whose structure is shown in the structural formula of LP-1, wherein the configuration of the chiral carbon at position-2 is S-type) with the anti-HER2 antibody XMT-1517 according to the method of generic Step A. The RP-HPLC test results of ADC-l-ld are shown in Figure 3G, and the SEC-HPLC test results are shown in Figure 4F.

[0551] The amino acid sequences of XMT-1517 are listed as SEQ ID NO: 37 for the light chain; SEQ ID NO: 38 for the light chain variable region; SEQ ID NO: 39 for the heavy chain; and SEQ ID NO: 40 for the heavy chain variable region.

[0552] Control Example 7. Preparation of ADC-l-le

[0553] ADC-l-le was prepared by combining the corresponding linker-payload (LP-la, whose structure is shown in the structural formula of LP-1, wherein the configuration of the chiral carbon at position-2 is S-type) with the anti-HER2 antibody MHES0488A according to the eric Step A. The RP-HPLC test results of ADC-l-le are shown in Figure 3H, and the SEC-HPLC test results are shown in Figure 4G.

[0554] ADC-1 -1e

[0555] The amino acid sequences of MHES0488Aare listed as SEQ ID NO: 41 for the light chain; SEQ ID NO: 42 for the light chain variable region; SEQ ID NO: 43 for the heavy chain; and SEQ ID NO: 44 for the heavy chain variable region.

[0556] Example 168. Detection of DAR of ADC by RP-HPLC

[0557] As determined by RP-HLLC in generic Step B, the average drug / antibody ratio, DAR, of the corresponding ADCs is shown in Table 1. RC-48 was purchased from Remegen Biosciences (batch no.: RC48-X1-202302003, the results of the RP-HPLC assay are shown in Figure 31, SEC-HPLC assay are shown in Figure 4C). For ADC-C-la and ADC-Dxd, its DAR = n, and for the other ADCs, DAR=nl+n2+ n3. As can be seen from Table 1, the ADCs disclosed in the present application have the excellent property of high DAR value and can significantly increase the drug concentration at the target site at the same dose of ADC drug. Example 169. SEC Detection of ADC Monomer Rates

[0558] The percentage of aggregation of each ADC was assessed by generic Step C, and the results are shown in Figure 4and Table 2. Using the classic MC linker VcMMAE RC-48 has a DAR of 4.19, a monomer rate of more than 99%, and a relatively low percentage of aggregation and degradation. In contrast, ADC-C-la that uses VcMMAE as its linker-payload had a DAR of 7.63, a monomer rate of 17.59%, but showed a high percentage of aggregation, indicating that ADCs using the classic MC linker VcMMAE may be prone to aggregation when made into high DAR.

[0559] The percentage of aggregation of ADCs of coupling different HER2 antibodies with LP-la may be different (Table 2). When coupling TA001 with LP-la, the monomer rate of ADC-1- la was high, indicating that antibody TA001 contributed to the stability of ADC as compared to other antibodies. The ADCs with antibody TA001 also displayed reduced levels of aggregation and degradation.

[0560] ADC-l-lb, which was made of an acidic stable linker on the hydroxyl group of the toxin, had a DAR of 7.48, which was nearly twice of the DAR of RC-48. However, its monomer rate was above 99% which was like that of RC-48, and the percentages of aggregation and degradation degree were low. When compared with ADC-C-la, ADC-l-la had a similar DAR )y a much higher monomer rate than ADC-C-la. This indicates that the high- DAR ADC obtained by coupling an acidic stable linker on the hydroxyl group of the toxin possesses the characteristics of low levels of degradation and laggregation while having the excellent property of high monomer rate.

[0561] Example 170. In vitro plasma stability of ADC

[0562] The plasma stability study of ADC was carried out according to generic Step D. As shown in Table 3, ADCs of coupling acidic stable linkers on the hydroxyl groups of toxins have less loss of drug during plasma incubation. Specifically, when antibody TA001 was used as the antibody, ADC-l-la was the most stable, while ADC-C-la with the classic MC-linked showed a significant DAR reduction after 7 days of incubation. Thus, the ADC drug having an acidic stable linker into the hydroxyl group of the toxin shows good plasma stability and no major changes in the DAR value.

[0563] Example 171. Anti-tumor cell activity of ADC

[0564] To evaluate the in vitro tumor cell killing activity of ADC, human tumor cell lines of different cancer types (Table 4) and mixed tumor cells (JIMT-1 + MDA-MB-468) were used as experimental models. A certain number of tumor cells were seeded in a 96-well plate through a gradient of dilutions of the test antibody or ADC drug. After ADC treatment for 5 days, the cell viability was assessed by using CellTiter-Glo ® Luminescent Cell Viability Assay, and the killing effect of the test antibody and ADC drug on the tumor cell line was evaluated by calculating the half-maximal inhibitory concentration (IC50).

[0565] The starting dose of antibody drug or ADC drug was 100 nM, the dilution multiple was 10 times, a total of 8 detection concentration points, and the treatment lasted for 5 days. Cell survival rate = (experimental group-blank) / (control group-blank group)* 100%.

[0566] JIMT-1 is a breast cancer cell line expressing moderate level of HER2, whereas MDA- MB-468 is a HER2-negative triple-negative breast cancer cell line (Table 4). The in vitro mixed tumor model of JIMT-1 + MDA-MB-468 (1 :2.5) cells was set up as follows: take the test cells in the logarithmic growth phase, discard the culture medium and rinse the cells with sterilized 1 *PBS, and add an appropriate amount of 0.25% Trpsin-EDTA to digest the cells according to the size of the culture flask; seed JIMT-1 cells into a 96-well plate at a density of 2000 cells / well, and MDA-MB-468 cellsinto a 96-well plate at a density of 5000 cells / well with the seeding ratio of the two lines of cells per well at 1 :2.5, add 300pL of sterilized 1 *PBS or sterilized ddH2O to the edge of the 96-well plate without adding cell suspension to seal the edge, and place it in a CO2 incubator for overnight culture.

[0567] With the counts of viable cells after ADC treatment for 5 days, the percentages of cell viability were plotted as the survival curves shown in Figures 5A, 5B, 5C, 5D, 5E, 5F, and 5G, and the IC50 values were calculated and listed in Table 5. The in vitro data showed that in the cancer cell models of high-, medium-, and low-HER2 expression (Table 4), ADC-l-la with antibody TA001 consistantly exerted higher tumor cell killing activity than that ADCs coupling other anti-HER2 antibodies with LP-la. In the mixed tumor cell model (JIMT-1 + MDA-MB- 468), ADC-l-la led to higher tumor cell killing activity than the anti-HER2 antibodies (i.e., Disitamab, HT-19, XMT1517, and MHES0488A) of other ADCs (i.e., ADC-l-lb, ADC-l-lc, ADC- 1 -Id, and ADC-l-le, respectively) when coupled with LP-la. It remains possible that the treatment by ADC-l-la induced more bystander effects.

[0568] In addition, the tumor cell killing activity of ADC-l-la is better than that of ADC-Dxd, :s that, compared with the ADC with Dxd as a toxin, the ADC with Auristatins as a toxin has an advantage in in vitro anti-tumor activity.

[0569] Example 172. In vivo efficacy of anti-HER2-ADCs in JIMT-1 -derived tumor in mice

[0570] To evaluate the in vivo efficacy of anti-HER2-ADC, a xenograft tumor model was established by transplanting JIMT-1 breast cancer cells into BALB / c-nu mice. JIMT-1 (5>< 106 / mouse) cell suspension (0.1 mL / mouse) was subcutaneously injected into the right scapula of 6~7-week-old BALB / c-nu mice. The mice were randomly divided into 13 groups, including vehicle control group (Vehicle), six treatment groups for ADC-l-la, ADC-l-lb, ADC-l-lc, ADC- 1 -Id, ADC-l-le, and ADC-Dxd with each treatment group divided by two dose groups (0.25 mg / kg, 0.5 mg / kg) and with 6 mice per dose group. When the average tumor volume of each mice grew to about 166 mm3, drug administration began (DO). Mice of each dose group were administered with the same type of ADC through a tail vein injection of 10 mL / kg body weight, with a dosing cycle of 7 days (QW), and 4 consecutive cycles of administration. All dose groups were observed 28 days (D28) for evaluating tumor groth inhibtion by ADC.

[0571] The average of tumor volumes was recorded through the cycle and calculated on D28 (Table 6 and 7). In JIMT-1 -derived single tumor model, ADC-l-la treatment from both 0.25mg / kg and 5mg / kg groups led to smaller average tumor volume than the treatment by ADCs of anti-HER.2 antibodies other than antibody TA001 coupled with LP-la in a paiwise comparison of tumor growth and inhibtion curves (Figure 6).

[0572] In addition, ADC-l-la exerted stronger tumor inhibition effect than ADC-Dxd, indicating that Auristatins are more effecious toxins than Dxd.

[0573] Example 173. In vivo efficacy of anti -HER2 -ADC in mixed tumors (JIMT-1 + MDA-MB-468)

[0574] JIMT-1 is a breast cancer cell line expressing moderate level of HER2, whereas MDA- MB-468 is a HER2-negative triple-negative breast cancer cell line (Table 4). The in vivo mixed tumor model of JIMT-1 + MDA-MB-468 was established in a subcutaneous mixed transplant tumor model in BALB / c-nu mice. A mixture of JIMT-1 (1 x 106) and MDA-MB-468 (2.5x 106) cells (0.1 mL / mouse) was subcutaneously injected into the right scapula of 6~7-week-old BALB / c-nu mice. The mice were randomly divided into 13 groups, including vehicle control group (Vehicle), six treatment groups for ADC-l-la, ADC-l-lb, ADC-l-lc, ADC-l-ld, ADC- l-le, and ADC-Dxd with each treatment group divided by two dose groups (0.25 mg / kg, 0.5 mg / kg) and with 6 mice per dose group. When the average tumor volume of each mice grew to about 172 mm3, drug administration began (DO). Mice of each dose group were administered with the same type of ADC through a tail vein injection of 10 mL / kg body weight, with a dosing cycle of 7 days (QW), and 4 consecutive cycles of administration. All dose groups were observed 28 days (D28) for evaluating tumor groth inhibtion by ADC.

[0575] The average of tumor volumes was recorded through the cycle and calculated on D28 (Table 7). In the (JIMT-1 + MDA-MB-468)-derived mixed tumor model, ADC-l-la treated mice in both 0.25mg / kg and 5mg / kg groups showed smaller average tumor volume than the mice treated by ADCs of LP-la coupled with anti-HER2 antibodies other than antibody TA001 in a paiwise comparison of tumor growth and inhibtion curves (Figure 7). This shows that antibody TA001 disclosed in the present application made the differences when compared with ADCs with other anti-HER2 antibodies for treating mixed tumors.

[0576] In addition, the tumor inhibition effect of ADC-l-la is also stronger than that of ADC- dicates that the ADC with Auristatins as toxins has advantages in the treatment of mixed tumors compared with the ADC with Dxd as toxins.

[0577] Example 174. Anti-Tumor Cell Activity of ADC

[0578] To evaluate ADC drug candidates for their activity of killing tumor cells in vitro, JIMT- l+MDA-MB-468 ad other human tumor cell lines of different cancer types (1 : 1) were used to assemble the experimental cell models of heterogeneous tumor cells (cell lines are shown in Table 8). A certain number of tumor cells were seeded in a 96-well plate, and gradient dilutions of ADC and controls were added to the cells for 5-day treatment. Cell viability was monitored using CellTiter-Glo® Luminescent Cell Viability Assay, and the killing effect of ADC on the tumor cell line was evaluated by calculating the half inhibitory concentration (IC50).

[0579] The starting dose of ADC was 100 nM, the dilution multiple was 10-fold with a total of 8 detection concentration points. Cell survival rate = (experimental group-blank) / (control group-blank group) x 100%.

[0580] The JIMT-l+MDA-MB-468 (1 : 1) in vitro heterogeneous tumor cell model was constructed as follows: take the test cells in the logarithmic growth phase, discard the culture medium and rinse the cells with sterilized I PBS, and add an appropriate amount of 0.25% Trpsin-EDTA to digest the cells according to the size of the culture flask. After the cells are digested, resuspended and counted, the HER2-moderately expressed breast cancer cell line JIMT-1 is first seeded into a 96-well plate at a density of 3500 cells / well, and then the HER2- negative triple-negative breast cancer cell line MDA-MB-468 is seeded into a 96-well plate at a density of 3500 cells / well. The seeding ratio of the two cells per well is 1 : 1. Finally, add 300pL of sterilized I PBS or sterilized FEO to the edge of the 96-well plate without adding cell suspension to seal the edge, and place it in a CO2 incubator for overnight culture.

[0581] The corresponding in vitro data are shown in Table 9, as well as Figures 8 A, 8B, 8C, 8D, 8E, 8F, 8G, and 8H. The results showed that in HER2 high-expression, medium-expression, and low-expression cell models, ADC-l-la showed stronger tumor cell killing activity than the commercial drug, RC-48. In addition, in the heterogeneous tumor cell model of JIMT- l+MDA-MB-468, ADC-l-la showed a stronger bystander effect and stronger killing activity than RC-48.

[0582] Example 175. In Vivo Efficacy of ADC-l-la to Single Tumor (JIMT-1)

[0583] BALB / c-Nude subcutaneous xenogarft of a human-derived tumor cell line (JIMT-1) was utilized as an experimental model to evaluate the in vivo efficacy of ADC-l-la. A certain number of tumor cell suspensions were subcutaneously injected into BALB / c-Nude. When the tumor volume grew to about 170 mm3, the tail vein was injected with a lysate (Vehicle), a naked antibody control (TA001), an unrelated antibody ADC control (FITC-IgGl-LP-la), a payload control (Auristatin E), a positive control (RC-48), and a positive control (RC-48). RC-48 and the corresponding ADC-l-la were administered once a week for four times for continuous observation, and the tumor volume and body weight of the mice were measured twice a week to evaluate the inhibitory effect of injected ADC on tumor growth. The results, as shown in Table 10, 11, and Figure 9, showed that, in HER2-expressing JIMT-1 tumors, 1 mg / kg of ADC- l-la exhibited stronger tumor suppression than 1 mg / kg of naked antibody control (TA001), 1 mg / kg of unrelated antibody ADC control (FITC-IgGl-LP-la), 0.039 mg / kg of payload control (Auristatin E) at equimolar doses of payload, 0.25 mg / kg, 0.5 mg / kg; 1 mg / kg of ADC-l-la exhibited stronger tumor suppression than 0.5 mg / kg, 1 mg / kg, and 2 mg / kg of the positive 8); and mice were well tolerated by ADC-l-la. This suggests that ADC-l-la possesses significant in vivo antitumor activity and safety.

[0584] Example 176. In vivo Efficacy of ADC-l-la to mixed tumors (JIMT-1 + MDA-MB-468)

[0585] BALB / c-Nude subcutaneous xenogarft of mixed human tumor cell lines, such as JIMT-1 + MDA-MB-468, was utilized as an experimental model to evaluate the in vivo efficacy of ADC-l-la. A certain number of mixed suspensions of tumor cells were seeded subcutaneously in BALB / c-Nude mice. When the tumor volume grew to about 160 mm3, the tail vein was injected with lysate (Vehicle), naked anti-control (TA001), unrelated antibody ADC control (FITC-IgGl-LP-la), payload control (Auristatin E), and positive control (RC-48) and the corresponding ADC drug (ADC-l-la) were administered four times once a week for continuous observation. Tumor volume and body weight of the mice were measured twice every week to evaluate the inhibitory effect of thecADC drug candidate on tumor growth. The results are shown in Table 12, 13 and Figure 10. In the mixed tumors derived from the mixture of HER2-positive JIMT-1 cells and HER2-negative MDA-MB-468 cells, 1 mg / kg of ADC-l- la showed stronger tumor inhibition than 1 mg / kg of naked anti-control (TA001), 1 mg / kg of irrelevant antibody ADC control (FITC-IgGl-LP-la), and 0.039 mg / kg of payload control (Auristatin E); at the equivalent molar dose of payload, 0.25 mg / kg, 0.5 mg / kg and 1 mg / kg of ADC-l-la showed stronger tumor inhibition than 0.5 mg / kg, 1 mg / kg and 2 mg / kg of positive control (RC-48); and mice tolerated ADC-l-la well. This shows that ADC-l-la has significant in vivo anti-tumor activity and safety.

[0586] Example 177. In vivo Efficacy of ADC-l-la in single form of tumor derived from NCI-N87

[0587] BALB / c-Nude subcutaneous xenograft model of a human tumor cell line (NCI-N87) was established as an experimental model to evaluate the in vivo efficacy of ADC-l-la. A certain number of tumor cell suspensions were subcutaneously injected in BALB / c-Nude. When the tumor volume grew to about 180 mm3, the tail vein was inj ected with a lysate (Vehicle), a naked antibody control (TA001), an unrelated antibody ADC control (FITC- IgGl-LP-la), a payload control (Auristatin E), a positive control (RC-48), and a positive control (RC-48). (RC-48) and the ADC drug candidate (e.g., ADC-l-la) were administered once a week for four times for continuous observation, and the tumor volume and body weight of the mice were measured twice a week to evaluate the inhibitory effect of the ADC drug tested for tumor growth. The results are shown in Table 14, 15 and Figure 11. In HER2-expressing NCI-N87 cell-derived tumors, 1 mg / kg ADC-l-la showed a stronger tumor inhibition effect than 1 mg / kg naked anticontrol (TA001), 1 mg / kg irrelevant antibody ADC control (FITC-IgGl-LP-la), and 0.039 mg / kg payload control (Auristatin E); at equimolar doses of payload, 0.25 mg / kg, 0.5 mg / kg and 1 mg / kg ADC-l-la showed a stronger tumor inhibition effect than 0.5 mg / kg, 1 mg / kg and 2 mg / kg positive control (RC-48); and mice tolerated ADC-l-la well. These data established that ADC-l-la has significant in vivo anti -turn or activity and safety.

[0588] Example 178. In Vivo Efficacy of ADC-l-la in NCI-H1975 cell-derived tumors

[0589] BALB / c-Nude subcutaneous xenograft of a human tumor cell line (NCI-H1975) was utilized as an experimental model in this invention to evaluate the in vivo efficacy of ADC-l- la. A certain number of tumor cell suspensions were inoculated subcutaneously in BALB / c- Nude. When the tumor volume grew to about 180 mm3, the tail vein was injected with a lysate (Vehicle), a naked antibody control (TA001), an unrelated antibody ADC control (FITC- IgGl- LP-la), a payload control (Auristatin E), a positive control (RC-48), and a positive control :h were used to evaluate the efficacy of ADC-l-la in vivo. RC-48 and the corresponding ADC drug (ADC-l-la) were administered once a week for four times for continuous observation, and the tumor volume and body weight of the mice were measured twice a week to evaluate the inhibitory effect of the tested ADC drugs on tumor growth.

[0590] The results are shown in Table 16, 17 and Figure 12. In HER2-expressing NCI-H1975- derived tumors, 1 mg / kg ADC-l-la showed stronger anti -turn or effects when compared to 1 mg / kg naked antibody control substance (TA001), 1 mg / kg irrelevant antibody ADC reference substance (FITC-IgGl-LP-la) and 0.039 mg / kg payload reference substance (Auristatin E); at equimolar doses of payload, 0.25 mg / kg, ADC-l-la at 0.5 mg / kg and 1 mg / kg showed stronger anti-tumor effects than the positive control (RC-48) at 0.5 mg / kg, 1 mg / kg and 2 mg / kg; and mice have a stronger anti-tumor effect on ADC -1-la is well tolerated. This indicates that ADC-l-la has significant anti -turn or activity and safety in vivo.

[0591] It can be understood that the above specific description of the present disclosre is only used to illustrate the present application and is not limited to the technical solutions described in the embodiments of the present application. Those skilled in the art should understand that the present application can still be modified or replaced by equivalents to achieve the same technical effects; the above modifications or equivalent replacements are all within the protection scope of the present application.

[0592]

[0593] Remarks: Incubated for 0 days means the DAR value measured after adding the ADC to the plasma and starting the purification and extraction step; Incubated for 3 days means the DAR value measured after the ADC is added to the plasma and left at 37°C for 3 DAR values were measured after the purification and extraction steps were started after 3 days of incubation; 7 days of incubation were measured after the purification and extraction steps were started after ADC was added to plasma and left at 37°C for 7 days.

[0594] 126

[0595]

[0596] Table 8. Human cancer cell lines

[0597] Cell line Cancer of origin Level of HERZ expression Source Gastric carcinoma of Shanghai Cell

[0598] NCI-N87 High human stomach Bank Adenocarcinoma of Shanghai Cell

[0599] SK-OV-3 High human ovary Bank Human non-small-cell

[0600] Calu-3 Intermediate to High Shanghai Tongpai lung cancer

[0601] JIMT-1 Human breast cancer Positive Shanghai Tongpai

[0602] Human non-small-cell

[0603] NCI-H1975 Low ATCC lung cancer

[0604] Epidermoid carcinoma Pricella

[0605] A431 Low of human skin

[0606] Triple-negative human Shanghai Tongpai

[0607] MDA-MB-468 Negative breast cancer

[0608] Table 9. IC50 (nM) of ADCs

[0609] FITC-IgGl -

[0610] Cancer cell line Cell Model TA001 ADC-l-la RC-48 FITC-IgGl LP-la

[0611] NCLN87 > 100 0.02 0.08 > 100 86.83

[0612] SK-OV-3 > 100 0.10 3.18 > 100 > 100

[0613] Calu-3 > 100 0.07 0.24 > 100 > 100

[0614] JIMT-1 Single tumor > 100 0.22 > 100 > 100 > 100

[0615] NCLH1975 > 100 27.68 52.31 > 100 29.76

[0616] A431 > 100 19.79 49.18 > 100 72.03

[0617] MDA-MB-468 > 100 27.96 81.77 > 100 31.58

[0618] JIMT-1 +

[0619] Mixed breast MDA-MB-468 > 100 1.42 20.92 > 100 > 100 cancer (1 :1)

[0620]

[0621]

[0622]

[0623] 135 >SEQ ID NO . 11 : TA001 HC constant region amino acid sequence

[0624] ASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPG

[0625] >SEQ ID NO . 12 : TA001 HC amino acid sequence

[0626] EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARI YPTNGYTRYADSV KGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVP SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKT I SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP G

[0627] >SEQ ID NO . 13 : TA001 CDR-L1 nucleic acid sequence

[0628] CGTGCCAGTCAGGATGTGAATACTGCTGTAGCC

[0629] >SEQ ID NO . 14 : TA001 CDR-L2 nucleic acid sequence

[0630] TCGGCATCCTTCCTCTACTCT

[0631] >SEQ ID NO . 15 : TA001 CDR-L3 nucleic acid sequence

[0632] GAG CAAC AT T AT AC T AC T C C T C C C AC G

[0633] >SEQ ID NO . 1 6 : TA001 CDR-H1 nucleic acid sequence

[0634] GAC AC C TAT AT AC AC

[0635] >SEQ ID NO . 17 : TA001 CDR-H2 nucleic acid sequence

[0636] AGGATTTATCCTACGAATGGTTATACTAGATATGCCGATAGCGTCAAGGGC

[0637] >SEQ ID NO . 18 : TA001 CDR-H3 nucleic acid sequence

[0638] TGGGGAGGGGACGGCTTCTATGCTATGGACTAC

[0639] >SEQ ID NO . 19 : TA001 VL nucleic acid sequence

[0640] GATATCCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACCATCA

[0641] CCTGCCGTGCCAGTCAGGATGTGAATACTGCTGTAGCCTGGTATCAACAGAAACCAGGAAAAGC

[0642] TCCGAAACTACTGATTTACTCGGCATCCTTCCTCTACTCTGGAGTCCCTTCTCGCTTCTCTGGC

[0643] TCCAGATCTGGGACGGATTTCACTCTGACCATCAGCAGTCTGCAGCCGGAAGACTTCGCAACTT

[0644] ATTACTGTCAGCAACATTATACTACTCCTCCCACGTTCGGACAGGGTACCAAGGTGGAGATCAA

Claims

ANTIBODY-AURISTATIN DRUG CONJUGATESAND METHODS OF MAKING AND USING THEREOFCLAIMS1. An antibody-drug conjugate as shown in general Formula I or a pharmaceutically acceptable salt or solvate thereof.wherein,Ab is an antibody or its antigen-binding fragment having a binding affinity to HER2; wherein said antibody comprises a light chain and a heavy chain, said light chain comprising CDR-L1, CDR-L2 and CDR-L3 each having an amino acid sequence as shown in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, respectively; said heavy chain comprising CDR-H1, CDR-H2, CDR-H3, each having an amino acid sequence as shown in SEQ ID NO: 4, SEQ ID NO: 5 , SEQ ID NO: 6, respectively;M is a linker connected to Ab;A is a peptide residue comprising 2-7 amino acids, wherein, optionally, said amino acids are each independently substituted with one or more substituents, said substituents being selected from: deuterium, halogen, hydroxyl, a cyano group, an amino group, a nitro group, alkyl, substituting alkyl, alkoxyl, cycloalkyl, and substituted cycloalkyl;W denotes an amino methylene oxide structural unit as shown in Formula (i):wherein, the left wavy line indicates the site of attachment of the nitrogen atom to A in Formula (i), and the right wavy line indicates the site of attachment of the oxygen atom to the D in Formula (i), where the oxygen atom is the common group of D and W;Ri, R2 and R3 are each hydrogen, deuterium, alkyl, or substituted alkyl; p is an integer or decimal from 1-20; andD is an auristatin having the structure shown in Formula D, its isomeric, endo-, racemic, enantiomeric, or mixtures thereof s, or pharmaceutically acceptable salts thereof.wherein,R4, RS are each independently hydrogen, deuterium, alkyl, and deuterated alkyl, or R4, Rs are linked together to form the following structure: -(CRnRi2)n-B-(CRi3Ri4)m-, wherein Rn, R12, R13, and R14 are independently hydrogen, deuterium, alkyl, and deuterated alkyl; B is O, NRis, or CRieRi? , wherein Ris, Rie, and Ri? are independently hydrogen, deuterium, or alkyl; n and m are independently an integer from 0-8; and -(CRnRnjn -B-(CRi3Ri4)m- forms a ring together with the nitrogen atom bonded with R4 and Rs,Re, R?, Rs, R9 are each independently hydrogen, deuterium, a halogen, an azido group, alkyl, or NRisRi9 , or any two of Re, R?, Rs, R9 form a cycloalkyl group together with the atom to which they are bonded, and the remaining two are each independently selected from hydrogen, a halogen, an azido group, alkyl, and NRisRi9 , wherein Ris, R19 are independently hydrogen or alkyl;Rio is aryl, heteroaryl, said aryl or heteroaryl being optionally substituted with one or more substituents, said substituents comprising hydrogen, halogen, alkyl, alkoxy, an amino group, or a nitro group; and the wavy line in Formula D indicates the site of attachment of the oxygen atom at position 1 in the structure of D to W, wherein said oxygen atom is shared by D and W.

2. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to Claim 1, wherein said light chain comprises: a light chain variable region having the amino acid sequence SEQ ID NO: 7, a light chain constant region having an amino acid sequence SEQ ID NO: 8, an amino acid sequence of SEQ ID NO: 9, wherein said heavy chain comprises: a heavy chain variable region having an amino acid sequence SEQ ID NO: 10, a heavy chain constant region having an amino acid sequence SEQ ID NO: 11, or an amino acid sequence of SEQ ID NO: 12.

3. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to Claim 1 or 2, said antibody or antigen-binding fragment thereof comprising a murine antibody, a rabbit antibody, a phage display source antibody, a yeast display source antibody, a chimeric antibody, a humanized antibody, or a fully human antibody.

4. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-3, wherein R4, Rs are each independently hydrogen, C1-C4 alkyl, or R4, Rs are linked to form the following structure: -(CH2) 2-B-(CH2)2-, B is O, NH, and nitrogen atoms bonded to R4 and Rs form a ring with -(CH2)2-B-(CH2)2-.

5. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-4, wherein Re, R?, Rs, R9 in Formula D are each hydrogen; alternatively, one of Re, R?, Rs, R9 in Formula D is halogen, an azido group, amino, and the remaining three are each hydrogen; alternatively, any two of Re, R?, Rs, R9 in Formula D form a cyclopropyl group together with the atoms to which they are bonded, and each of the remaining two groups is independently hydrogen.

6. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereofaccording to any one of Claims 1-5, wherein Rio in Formula D is phenyl, and wherein optionally said phenyl is substituted with one or more of substituents comprising amino, or nitro, or wherein D is selected from the following compounds, its isomers, endo-, racemates, enantiomers, or mixtures thereof, or a pharmaceutically acceptable salt thereof:

7. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-6, said antibody-drug conjugate having the structure shown inFormula la: wherein,Z is -C1-C10 alkylene-, -C3-C8carbocyclic-, -arylidene-, -C1-C10 alkylene-arylidene-, - arylidene-Ci-Cio -alkylene-, -C1-C10 alkylene-(C3-C8carbocyclic)-, -(C3-C8carbocyclic)-Ci-Cio alkylene-, -3-8 membered heterocyclic-, -C1-C10 alkylene-(3-8 membered heterocyclic)-, -(3-8 membered heterocyclic)-Ci-Cio alkylene-, - or , wherein X is -C1-C10 alkylene-, -C3-C8carbocyclic-, -aryl-, -C1-C10 alkyl-arylene-, -aryl-Ci- Cio alkyl-, -C1-C10 alkylene-(C3-C8 carbocyclic)-, -(C3-C8carbocyclic)-Ci-Cio alkylene-, -3-8 membered heterocyclic-, -C1-C10 alkyl-(3-8 membered heterocyclic)-, -(3-8 membered heterocyclic)-Ci-Cio alkylene-,Y is a hydrophilic structure derived from carboxylic acid, phosphoric acid, polyphosphoric acid, phosphite, sulphonic acid, sulfenic acid, or polyethylene glycol) (PEG); said 3-8 membered heterocyclic each independently comprise 1-3 atoms selected from N, O, and S; said -C1-C10 alkylene-, -C3-C8carbocyclic -, and 3-8 membered heterocyclic are each independently substituted with one or more deuterium, halogen, hydroxyl, cyano, nitro, amino, alkyl, heteroalkyl, substituted alkyl, substituted alkoxyls, carboxyl, or cycloalkyl;the left wavy line indenotes the attachment site to N on the maleimide, and the right wavy line denotes the attachment site to the carbonyl group; r is an integer from 1-10; q is an integer from 1-8; n1, n2, n3are independently chosen from an integer or a decimal between 0 and 20, wherein n1, n2, n3are not simultaneously 0 and n1+ n2+ n3< 20.

8. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-7, wherein A comprises:2-7 amino acid selected from phenylalanine (F), glycine (G), valine (V), lysine (K), alanine (A), citrulline, serine (S), glutamic acid (E), or aspartic acid (D),2-4 amino acids selected from phenylalanine and glycine, or a tetrapeptide consisting of glycine-glycine-phenylalanine-glycine.

9. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to Claim 7 or 8, wherein Z is -Ci-Cio alkylene-, -C4 -Ce alkylene-, -C5 alkylene-, or, wherein q is an integer between 1 and 8.

10. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 7-9, wherein Ri, R2 and R3 are each independently hydrogen, deuterium, alkyl, an alkyl halide group, an alkyl deuteride group, or a hydroxyalkyl group,Ri, R2 and R3 are all hydrogen or deuterium, orRi, R2 and R3 are all hydrogen atom.

11. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-10, said antibody-drug conjugate having a structure as shown in Formula lb.wherein are as defined in any one of Claims 1-7.

12. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-10, said antibody-drug conjugate having a structure as shown in Formula Ic, Formula Id or Formula le.148Ac is linked to methylene carbon at the position-2 as labeled via an amino functional group, X, ¥ are as defined in claim 7; R4, R5, Rs, R?, Rs, R9, Rio, n1, n2, n3are as defined in any one of Claims 1-7, preferably, said Ac is selected from glycine, (D / L) alanine, (D / L) leucine, (D / L) isoleucine, (D / L) valine, (D / L) phenylalanine, (D / L) proline, (D / L) tryptophan, (D / L) serine, (D / L) tyrosine, (D / L) cysteine, (D / L) cystine, (D / L) arginine, (D / L) histidine, (D / L) methionine, (D / L) asparagine, (D / L) glutamine, (D / L) threonine, (D / L) aspartic acid, (D / L) glutamic acid, natural or non-natural amino acid derivatives, or the following structures:

13. The antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-12, said antibody-drug coupling compound being selected from the following structures:155157165166170173wherein the configuration of the chiral carbon at the position-2 is R or S.

14. A linker-drug compound as shown in Formula II, its isomeric, endo-, racemic, enantiomeric, or mixture thereof, or pharmaceutically acceptable salts or solvates thereof,wherein,, are as defined in any one of Claims 1-10.

15. The linker- drug compound of Claim 14, its isomeric, endo-, racemic, enantiomeric, or mixture thereof, or pharmaceutically acceptable salts or solvates thereof, wherein said linker- drug compound has the structure shown in Formula Ila:

16. The linker- drug compound of Claim 15-, its isomeric, endo-, racemic, enantiomeric, or mixture thereof, or pharmaceutically acceptable salts or solvates thereof, wherein said linker- drug compound has the structure shown in Formula lib, Formula lie or Formula lid:wherein Ac is a hydrophilic structural unit having the structure shown in Formula c;wherein X, ¥ are as defined in Claim 7, and Ac is linked to methylene carbon at the position- 2 as labeled via -NH-.

17. The linker-drug compound according to any one of Claims 14-16, its isomeric, endo-,racemic, enantiomeric, or mixture thereof, or pharmaceutically acceptable salts or solvates thereof, said linker-drug compound being selected from the following structures:181181851wherein the configuration of the chiral carbon at the position-2 is R or S.

18. The use of the antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-13, or the linker- drug compound of any one of Claims 14-17, its isomeric, endo-, racemic, enantiomeric, or mixture thereof, or a pharmaceutically acceptable salt or solvate thereof, for the preparation of a drug, said drug is used for thetreatment or prevention of tumors, wherein: said tumor expresses HER2, said tumor is cancer, or said tumor is breast cancer, ovarian cancer, cervical cancer, uterine cancer, prostate cancer, renal cancer, urethral cancer, bladder cancer, liver cancer, gastric cancer, endometrial cancer, salivary gland cancer, esophageal cancer, lung cancer, colon cancer, rectal cancer, colorectal cancer, bone cancer, skin cancer, thyroid cancer, pancreatic cancer, melanoma, glioma, neuroblastoma, polymorphous glioblastoma, sarcoma, lymphoma, or Leukemia.

19. A pharmaceutical composition comprising an effective amount of the antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-13, or the linker-drug compound of any one of Claims 14-17, its isomeric, endo-, racemic, enantiomeric, or mixture thereof, or a pharmaceutically acceptable salt or solvates, wherein, optionally, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent or excipient.

20. A pharmaceutical formulation comprising an effective amount of the antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-13, or the linker-drug compound of any one of Claims 14-17-, its isomeric, endo-, racemic, enantiomeric, or mixture thereof, a pharmaceutically acceptable salt or solvent compounds.

21. The use of the linker-drug compound of any one of Claims 14-17, its isomer, endo-, racemate, enantiomer, or mixtures thereof, or pharmaceutically acceptable salts or solvates thereof, for the preparation of antibody-drug couplings or pharmaceutically acceptable salts or solvates thereof, wherein, optionally, said antibody-drug coupling substance is the antibody-drug conjugate according to any one of Claims 1-13.

22. A method for preparing the antibody-drug conjugate or a pharmaceutically acceptable salt or solvate thereof according to any one of Claims 1-13, said method comprising; reacting a reduced antibody or antigen-binding fragment thereof with the linker-drug compound according to any one of Claims 14-17, its isomers, endo-, racemates, enantiomers, or mixtures thereof, or a pharmaceutically acceptable salt or solvent compound thereof, to obtain said antibody-drug conjugate.

Citation Information

Patent Citations

  • Fusion protein 4D5Fv-PE25, preparation method and uses thereof

    CN106589131A

  • Antibody-drug conjugate having improved stability and use thereof

    US20160136300A1

  • Drug-conjugated bi-specific antigen-binding constructs

    US20180193477A1

  • Antibody-drug conjugate comprising modified antibody

    US20220105197A1