HETEROBIFUNCTIONAL MOLECULES FOR BINDING NA v1.8 AND METHODS OF TREATING MEDICAL CONDITIONS USING SAME

Abstract

The invention provides heterobifunctional cotinine-containing compounds, pharmaceutical compositions, and methods of using same to treat medical conditions, such as pain.

Description

HETEROBIFUNCTIONAL MOLECULES FOR BINDING NAvl.8 AND METHODS OF TREATING MEDICAL CONDITIONS USING SAMECROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the benefit of and priority to United States Provisional Patent Application serial number 63 / 711,349, filed October 24, 2024, and United States Provisional Patent Application serial number 63 / 571 ,579, filed March 29, 2024; the contents of each of which are hereby incorporated by reference in their entirety.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

[0002] This application contains a sequence listing which has been submitted electronically in ST.26 format and is hereby incorporated by reference in its entirety (said ST.26 copy, created on March 24, 2025, is named “216917_seqlist.xml” and is 15,201 bytes in size.FIELD OF THE INVENTION

[0003] The invention provides heterobifunctional cotinine-containing compounds, pharmaceutical compositions, and methods of using same to treat medical conditions, such as pain.BACKGROUND

[0004] Pain can function as a protective mechanism that allows healthy human beings and animals to avoid tissue damage and / or prevent further damage to injured tissue. However, there are many instances in which pain persists beyond its usefulness. Such unnecessary suffering from pain can impair a subject’s physical mobility, mental performance, and even contribute to depression. Such unnecessary suffering from pain can be due to acute pain and / or chronic pain. Such pain can also be characterized according to whether the pain is neuropathic pain or nociceptive pain. Substantial resources have been devoted over the years to researching the causes of various types of pain and to the development of medicine to attenuate pain experienced by a patient. Exemplary classes of common pain-relief medications include opioids, non-steroidal anti- inflammatory agents, corticosteroids, and centrally acting agents such as anti -depressants and anti- epileptics. However, existing therapies for treating pain are not effective for all patients and / or can have adverse side effects.

[0005] Voltage-gated sodium channel Nav1.8 is expressed in the dorsal root ganglion, in unmyelinated, small-diameter sensory neurons called C-fibres, and is involved in nociception. Molecules that inhibit Nav1.8 have been reported for treatment of pain. See, for example, P.T. Nguyen et al. in Front. Pharmacol. (2022) vol. 13, article 842032; Ruangsri et al. in J. Biol. Sciences (2011) vol. 286, pages 39,836-39,847; and US Patent Application Publication 2021 / 0387966.

[0006] The use of heterobifuctional compounds that are able to simultaneously bind a target cell-surface protein as well as an exogenous antibody protein are described in, for example, international patent application publication nos. WO 2018 / 134731, WO 2023 / 017484, and WO 2023 / 017483. Such heterobifuctional compounds are used with an anti-cotinine antibody to treat a variety of medical diseases and conditions. Additional heterobifunctional cotinine-containing compounds that bind voltage-gated sodium channel Navi .8 and an exogenous antibody protein are needed and would provide benefits to patients suffering from voltage-gated sodium channel Nav1.8-associated diseases and conditions, such as pain.

[0007] The present invention addresses the foregoing need and provides other related advantages.SUMMARY

[0008] The invention provides heterobifunctional cotinine-containing compounds, pharmaceutical compositions, and methods of using same to treat medical conditions, such as pain. In particular, one aspect of the invention provides a collection of heterobifunctional cotinine- containing compounds represented by Formula I:or a pharmaceutically acceptable salt thereof, where the variables are as defined in the detailed description. Further description of additional collections of heterobifunctional cotinine-containing compounds are described in the detailed description. The compounds may be part of a pharmaceutical composition comprising a pharmaceutically acceptable carrier.

[0009] Another aspect of the invention provides a collection of heterobifunctional cotinine- containing compounds represented by Formula II:or a pharmaceutically acceptable salt thereof, where the variables are as defined in the detailed description. Further description of additional collections of heterobifunctional cotinine- containing compounds are described in the detailed description. The compounds may be part of a pharmaceutical composition comprising a pharmaceutically acceptable carrier.

[0010] Another aspect of the invention provides a collection of heterobifunctional cotinine- containing compounds represented by Formula III:or a pharmaceutically acceptable salt thereof, where the variables are as defined in the detailed description. Further description of additional collections of heterobifunctional cotinine- containing compounds are described in the detailed description. The compounds may be part of a pharmaceutical composition comprising a pharmaceutically acceptable carrier.

[0011] The heterobifunctional compounds bind to voltage-gated sodium channel Nav1.8. The heterobifunctional compounds also bind to an anti-cotinine antibody or fragment thereof that binds cotinine. In this way, the heterobifunctional compounds may be characterized as an antibody recruiting molecule (ARM).

[0012] Another aspect of the invention provides a method of treating or preventing a Navl .8- associated disease or condition in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (such as a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0013] Another aspect of the invention provides a method of treating or preventing a disease or condition in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (such as a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof, wherein the disease or condition is selected from pain, cough, acute itch, or chronic itch.

[0014] Another aspect of the invention provides a method of treating or preventing pain in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (such as a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0015] Another aspect of the invention provides a method of increasing antibody-dependent cell cytotoxicity (ADCC) of voltage-gated sodium channel Navl.8-expressing cells, wherein the method comprises contacting the cells with an effective amount of a heterobifunctional compound described herein (such as a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0016] Another aspect of the invention provides a method of depleting voltage-gated sodium channel Navl 8-expressing cells, wherein the method comprises contacting the cells with an effective amount of a heterobifunctional compound described herein (such as a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0017] Another aspect of the invention provides a combination comprising a heterobifunctional compound described herein (such as a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.DETAILED DESCRIPTION

[0018] The invention provides heterobifunctional cotinine-containing compounds, pharmaceutical compositions, and methods of using same to treat medical conditions, such as pain. The practice of the present invention employs, unless otherwise indicated, conventional techniques of organic chemistry, pharmacology, molecular biology (including recombinant techniques), cell biology, biochemistry, and immunology. Such techniques are explained in the literature, such as in “Comprehensive Organic Synthesis” (B.M. Trost & 1. Fleming, eds., 1991- 1992); “Handbook of experimental immunology” (D M. Weir & C.C. Blackwell, eds.); “Current protocols in molecular biology” (F.M. Ausubel et al., eds., 1987, and periodic updates); and “Current protocols in immunology” (J.E. Coligan et al., eds., 1991), each of which is herein incorporated by reference in its entirety.

[0019] Various aspects of the invention are set forth below in sections; however, aspects of the invention described in one particular section are not to be limited to any particular section. Further, when a variable is not accompanied by a definition, the previous definition of the variable controls.Definitions

[0020] Compounds of the present invention include those described generally herein, and are further illustrated by the classes, subclasses, and species disclosed herein. As used herein, the following definitions shall apply unless otherwise indicated. These definitions apply regardless of whether a term is used by itself or in combination with other terms, unless otherwise indicated. Hence, the definition of “alkyl” applies to “alkyl” as well as the “alkyl” portions of “-O-alkyl” etc. For purposes of this invention, the chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75thEd. Additionally, general principles of organic chemistry are described in “Organic Chemistry”, Thomas Sorrell, University Science Books, Sausalito: 1999, and “March’s Advanced Organic Chemistry”, 5thEd., Ed.: Smith, M.B. and March, J., John Wiley & Sons, New York: 2001, the entire contents of which are hereby incorporated by reference.

[0021] The term “aliphatic” or “aliphatic group”, as used herein, means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a monocyclic hydrocarbon orbicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic (also referred to herein as “cycloaliphatic”), that has a single point of attachment to the rest of the molecule. Unless otherwise specified, aliphatic groups contain 1-6 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-4 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-3 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1-2 aliphatic carbon atoms. In some embodiments, “cycloaliphatic” refers to a monocyclic C3-C6 hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule. Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.

[0022] As used herein, the term “bicyclic ring” or “bicyclic ring system” refers to any bicyclic ring system, i.e., carbocyclic or heterocyclic, saturated or having one or more units of unsaturation, having one or more atoms in common between the two rings of the ring system. Thus, the term includes any permissible ring fusion, such as ort / zo-fused or spirocyclic. As used herein, the term “heterobicyclic” is a subset of “bicyclic” that requires that one or more heteroatoms are present in one or both rings of the bicycle. Such heteroatoms may be present at ring junctions and are optionally substituted, and may be selected from nitrogen (including N-oxides), oxygen, sulfur (including oxidized forms such as sulfones and sulfonates), phosphorus (including oxidized forms such as phosphates), boron, etc. In some embodiments, a bicyclic group has 7-12 ring members and 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. As used herein, the term “bridged bicyclic” refers to any bicyclic ring system, i.e., carbocyclic or heterocyclic, saturated or partially unsaturated, having at least one bridge. As defined by IUPAC, a “bridge” is an unbranched chain of atoms or an atom or a valence bond connecting two bridgeheads, where a “bridgehead” is any skeletal atom of the ring system which is bonded to three or more skeletal atoms (excluding hydrogen). In some embodiments, a bridged bicyclic group has 7-12 ring members and 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. Such bridged bicyclic groups are well known in the art and include those groups set forth below where each group is attached to the rest of the molecule at any substitutable carbon or nitrogen atom. Unless otherwise specified, a bridged bicyclic group is optionally substituted with one or moresubstituents as set forth for aliphatic groups. Additionally or alternatively, any substitutable nitrogen of a bridged bicyclic group is optionally substituted. Exemplary bicyclic rings include:

[0023] Exemplary bridged bicyclics include:

[0024] The term “lower alkyl” refers to a C1-4 straight or branched alkyl group. Exemplary lower alkyl groups are methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and tert-butyl.

[0025] The term “lower haloalkyl” refers to a Ci-4 straight or branched alkyl group that is substituted with one or more halogen atoms.

[0026] The term “heteroatom” means one or more of oxygen, sulfur, nitrogen, phosphorus, or silicon (including, any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quaternizedform of any basic nitrogen or; a substitutable nitrogen of a heterocyclic ring, for example N (as in 3,4-dihydro-2 / 7-pyrrolyl), NH (as in pyrrolidinyl) or NR+(as in N-substituted pyrrolidinyl)).

[0027] The term “unsaturated,” as used herein, means that a moiety has one or more units of unsaturation.

[0028] As used herein, the term “bivalent Ci-s (or Ci-e) saturated or unsaturated, straight or branched, hydrocarbon chain”, refers to bivalent alkylene, alkenylene, and alkynylene chains that are straight or branched as defined herein.

[0029] The term “alkylene” refers to a bivalent alkyl group. An “alkylene chain” is a polymethylene group, i.e., -(CH2)n- wherein n is a positive integer, preferably from 1 to 6, from 1 to 4, from 1 to 3, from 1 to 2, or from 2 to 3. A substituted alkylene chain is a polymethylene group in which one or more methylene hydrogen atoms are replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group.

[0030] The term “-(Co alkylene)-“ refers to a bond. Accordingly, the term “-(Co-3 alkylene)-” encompasses a bond (i.e., Co) and a -(C1.3 alkylene)- group.

[0031] The term “alkenylene” refers to a bivalent alkenyl group. A substituted alkenylene chain is a polymethylene group containing at least one double bond in which one or more hydrogen atoms are replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group.

[0032] The term “halogen” means F, Cl, Br, or I.

[0033] The term “aryl” used alone or as part of a larger moiety as in “aralkyl,” “aralkoxy,” or “aryloxyalkyl,” refers to monocyclic or bicyclic ring systems having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic and wherein each ring in the system contains 3 to 7 ring members. The term “aryl” may be used interchangeably with the term “aryl ring.” In certain embodiments of the present invention, “aryl” refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear one or more substituents. Also included within the scope of the term “aryl,” as it is used herein, is a group in which an aromatic ring is fused to one or more non-aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like. The term “phenylene” refers to a multivalent phenyl group having the appropriate number of open valences to account for groups attached to it. For example, “phenylene” is a bivalent phenyl groupwhen it has two groups attached to it (e.g.,); “phenylene” is a trivalent phenyl group when it has three groups attached to it (e.g., ). The term “arylene” refers to a bivalentaryl group.

[0034] The terms “heteroaryl” and “heteroar-,” used alone or as part of a larger moiety, e.g., “heteroaralkyl,” or “heteroaralkoxy,” refer to groups having 5 to 10 ring atoms, preferably 5, 6, or9 ring atoms; having 6, 10, or 14 it electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms. The term “heteroatom” refers to nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen. Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl. The terms “heteroaryl” and “heteroar-”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where unless otherwise specified, the radical or point of attachment is on the heteroaromatic ring or on one of the rings to which the heteroaromatic ring is fused. Nonlimiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4 / / quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, and tetrahydroisoquinolinyl. A heteroaryl group may be mono- or bicyclic. The term “heteroaryl” may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted. The term “heteroaralkyl” refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted.

[0035] The term “heteroarylene” refers to a multivalent heteroaryl group having the appropriate number of open valences to account for groups attached to it. For example, “heteroarylene” is a bivalent heteroaryl group when it has two groups attached to it; “heteroarylene” is a trivalent heteroaryl group when it has three groups attached to it.

[0036] As used herein, the terms “heterocycle,” “heterocyclyl,” “heterocyclic radical,” and “heterocyclic ring” are used interchangeably and refer to a stable 5- to 7-membered monocyclic or 7-10-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above. When used in reference to a ring atom of a heterocycle, the term "nitrogen" includes a substituted nitrogen. As an example, in a saturated or partially unsaturated ring having 0-3 heteroatoms selected from oxygen, sulfur or nitrogen, the nitrogen may be N (as in 3,4-dihydro- 2 / 7 pyrrol yl), NH (as in pyrrolidinyl), or+NR (as in N-substituted pyrrolidinyl).

[0037] A heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted. Examples of such saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothiophenyl pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, 2-oxa-6- azaspiro[3.3]heptane, and quinuclidinyl. The terms “heterocycle,” “heterocyclyl,” “heterocyclyl ring,” “heterocyclic group,” “heterocyclic moiety,” and “heterocyclic radical,” are used interchangeably herein, and also include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H -indolyl, chromanyl, phenanthridinyl, or tetrahydroquinolinyl. A heterocyclyl group may be mono- or bicyclic. The term “heterocyclylalkyl” refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted. The term “oxo-heterocyclyl” refers to a heterocyclyl substituted by one or more oxo group. The term “heterocyclylene” refers to a multivalent heterocyclyl group having the appropriate number of open valences to account for groups attached to it. For example, “heterocyclylene” is a bivalent heterocyclyl group when it has two groups attached to it; “heterocyclylene” is a trivalent heterocyclyl group when it has three groups attached to it. The term “oxo-heterocyclylene” refers to a multivalent oxo-heterocyclyl group having the appropriate number of open valences to account for groups attached to it.

[0038] As used herein, the term “partially unsaturated” refers to a ring moiety that includes at least one double or triple bond. The term “partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.

[0039] As described herein, compounds of the invention may contain “optionally substituted” moieties. In general, the term “substituted,” whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent. Unless otherwise indicated, an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position. Combinations of substituents envisioned by this invention are preferably those that result in the formation of stable or chemically feasible compounds. The term “stable,” as used herein, refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.

[0040] Each optional substituent on a substitutable carbon is a monovalent substituent independently selected from halogen; -(CH2)o ^R°; -(CH2)o 4OR0; -0(CH2)o-4R°, -0-(CH2)o- 4C(O)OR°; -(CH2)O-4CH(OR°)2; -(CH2)O 4SR0; -(CH2)O 4Ph, which may be substituted with R°; -(CH2)o-40(CH2)o-iPh which may be substituted with R°; -CH=CHPh, which may be substituted with R°; -(CH2)o-40(CH2)o i-pyridyl which may be substituted with R°; -NO2; -CN; - N3; -(CH2)O4N(RO)2; -(CH2)O-4N(R°)C(0)R°; -N(R°)C(S)R°; -(CH2)O- ^N(RO)C(O)NR°2; -N(RO)C(S)NR°2; -(CH2)O-IN(R0)C(0)OR°; -N(R°)N(R°)C(O)R°; -N(R°)N(RO)C(O)NRO2; -N(R°)N(R°)C(O)OR°; -(CH2)o4C(O)R°; -C(S)R°; -(CH2)(MC(0)0R°; -(CH2)o4C(O)SR°; -(CH2)o^C(0)OSiR°3; -(CH2)o4OC(O)R°; -OC(0)(CH2)O-ISR-, SC(S)SR°; -(CH2)o4SC(O)R°; -(CH2)O4C(O)NRO2; -C(S)NRO2; -C(S)SR°; -SC(S)SR°, 4CH2)O 4OC(O)NR°2;-C(O)N(OR°)R°; C(O)C(O)R°; C(O)CH2C(O)R°; C(NOR°)R°; -(CH2)o4SSR°; -(CH2)o4S(O)2R°; -(CH2)O 4S(O)2ORO; -(CH2)O- ^OS(O)2R°; -S(0)2NRO2; -S(O)(NR°)R°; - S(O)2N-C(NRO2)2; -(CH2)O4S(O)RO; -N(RO)S(O)2NR°2; N(RO)S(O)2R°; N(0R°)R°;C(NH)NRO2; -P(O)2RO; -P(0)RO2; -OP(O)R°2; -OP(O)(OR°)2; SiR°3; -(Ci^ straight or branched alkylene)O-N(R°)2; or -(C1-4 straight or branched alkylene)C(O)O-N(R°)2.

[0041] Each R° is independently hydrogen, Ci-6 aliphatic, -CH2Ph, -0(CH2)o iPh, -CH2-(5-6 membered heteroaryl ring), or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or,notwithstanding the definition above, two independent occurrences of R°, taken together with their intervening atom(s), form a 3-12-membered saturated, partially unsaturated, or aryl mono- or bicyclic ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, which may be substituted by a divalent substituent on a saturated carbon atom of R° selected from =0 and =S; or each R° is optionally substituted with a monovalent substituent independently selected from halogen, -(CH2)o-2R*, -(haloR*), (CH2)o2OH, (CH2)o2OR*, - (CH2)O2CH(OR*)2; -O(haloR’), -CN, -N3, -(CH2)0 2C(O)R*, -(CH2)o2C(O)OH, -(CH2)o-2C(O)OR’, -(CH2)O -2SR*, -(CH2)O2SH, -(CH2)O 2NH2, -(CH2)o2NHR*, -(CH2)o2NR*2, -NO2, -SiR*3, -OSiR*3, -C(O)SR* -(C1-4 straight or branched alkylene)C(O)OR*, or -SSR*.

[0042] Each R* is independently selected from Ci^ aliphatic, -CH2Ph, -0(CH2)o iPh, or a 5- 6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and wherein each R* is unsubstituted or where preceded by halo is substituted only with one or more halogens; or wherein an optional substituent on a saturated carbon is a divalent substituent independently selected from =0, =S, =NNR*2, =NNHC(0)R*, =NNHC(0)0R*, =NNHS(O)2R\ =NR*, =N0R*, O(C(R*2))230 , or S(C(R*2))2-3S-, or a divalent substituent bound to vicinal substitutable carbons of an “optionally substituted” group is -O(CR*2)2-3O-, wherein each independent occurrence of R* is selected from hydrogen, C1-6 aliphatic or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.

[0043] When R* is C1-6 aliphatic, R* is optionally substituted with halogen, - R*, -(haloR*), -OH, -OR*, -O(haloR*), -CN, -C(O)OH, -C(O)OR*, -NH2, -NHR*, -NR*2, or -NO2, wherein each R* is independently selected from C1-4 aliphatic, -CH2Ph, -0(CH2)o iPh, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and wherein each R* is unsubstituted or where preceded by halo is substituted only with one or more halogens.

[0044] An optional substituent on a substitutable nitrogen is independently -R1’, -NR^, - C(O)Rr, -C(O)ORr, -C(O)C(O)Rt, -C(O)CH2C(O)Rt, -S(O)2R+, -S(O)2NRt2, -C(S)NRt2, - C(NI I)NRJ2, or -N(RJ)S(O)2R.:; wherein each RJ is independently hydrogen, C1-6 aliphatic, unsubstituted -OPh, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, twoindependent occurrences of R+, taken together with their intervening atom(s) form an unsubstituted 3-12-membered saturated, partially unsaturated, or aryl mono- or bicyclic ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur; wherein when R' is Ci 6 aliphatic, R' is optionally substituted with halogen, -R*, -(haloR*), -OH, -OR*, - O(haloR*), -CN, -C(O)OH, -C(O)OR*, -NH2, -NHR*, -NR*2, or -NO2, wherein each R* is independently selected from Ci-4 aliphatic, -CH2Ph, -0(CH2)o-iPh, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and wherein each R* is unsubstituted or where preceded by halo is substituted only with one or more halogens.

[0045] As used herein, the term “pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit / risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et al., describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1—19, incorporated herein by reference. Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases. Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphor sulfonate, citrate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like.

[0046] Further, acids which are generally considered suitable for the formation of pharmaceutically useful salts from basic pharmaceutical compounds are discussed, for example, by P. Stahl el al.. Camille G. (eds .) Handbook of Pharmaceutical Salts. Properties, Selection and Use. (2002) Zurich: Wiley-VCH; S. Berge et al., Journal of Pharmaceutical Sciences (1977) 66(1) 1-19; P. Gould, International J. of Pharmaceutics (1986) 33 201-217; Anderson et al., The Practice of Medicinal Chemistry (1996), Academic Press, New York; and in The Orange Book (Food & Drug Administration, Washington, D.C. on their website). These disclosures are incorporated herein by reference.

[0047] Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N+(Ci-4alkyl)4 salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, loweralkyl sulfonate and aryl sulfonate.

[0048] Unless otherwise stated, structures depicted herein are also meant to include all isomeric (e.g., enantiomeric, diastereomeric, and geometric (or conformational)) forms of the structure; for example, the R and S configurations for each asymmetric center, Z and E double bond isomers, and Z and E conformational isomers. Therefore, single stereochemical isomers as well as enantiomeric, diastereomeric, and geometric (or conformational) mixtures of the present compounds are within the scope of the invention. Unless otherwise stated, all tautomeric forms of the compounds of the invention are within the scope of the invention. The invention includes compounds that differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures including the replacement of hydrogen by deuterium or tritium, or the replacement of a carbon by a13C- or14C-enriched carbon are within the scope of this invention. Such compounds are useful, for example, as analytical tools, as probes in biological assays, or as therapeutic agents in accordance with the present invention.

[0049] Diastereomeric mixtures can be separated into their individual diastereomers on the basis of their physical chemical differences by methods known to those skilled in the art, such as, for example, by chromatography and / or fractional crystallization. Enantiomers can be separated by converting the enantiomeric mixture into a diastereomeric mixture by reaction with an appropriate optically active compound (e.g., chiral auxiliary such as a chiral alcohol or Mosher’sacid chloride), separating the diastereomers and converting (e.g, hydrolyzing) the individual diastereomers to the corresponding pure enantiomers. Alternatively, a particular enantiomer of a compound of the present invention may be prepared by asymmetric synthesis. Still further, where the molecule contains a basic functional group (such as amino) or an acidic functional group (such as carboxylic acid) diastereomeric salts are formed with an appropriate optically active acid or base, followed by resolution of the diastereomers thus formed by fractional crystallization or chromatographic means known in the art, and subsequent recovery of the pure enantiomers.

[0050] Individual stereoisomers of the compounds of the invention may, for example, be substantially free of other isomers, or may be admixed, for example, as racemates or with all other, or other selected, stereoisomers. Chiral center(s) in a compound of the present invention can have the S or R configuration as defined by the IUPAC 1974 Recommendations. Further, to the extent a compound described herein may exist as an atropisomer (e.g., substituted biaryls), all forms of such atropisomer are considered part of this invention.

[0051] Chemical names, common names, and chemical structures may be used interchangeably to describe the same structure. If a chemical compound is referred to using both a chemical structure and a chemical name, and an ambiguity exists between the structure and the name, the structure predominates. It should also be noted that any carbon as well as heteroatom with unsatisfied valences in the text, schemes, examples and tables herein is assumed to have the sufficient number of hydrogen atom(s) to satisfy the valences.

[0052] The terms “a” and “an” as used herein mean “one or more” and include the plural unless the context is inappropriate.

[0053] The term “alkyl” refers to a saturated straight or branched hydrocarbon, such as a straight or branched group of 1-12, 1-10, or 1-6 carbon atoms, referred to herein as C1-C12 alkyl, C1-C10 alkyl, and C1-C6 alkyl, respectively. Exemplary alkyl groups include, but are not limited to, methyl, ethyl, propyl, isopropyl, 2 -methyl- 1 -propyl, 2-methyl-2-propyl, 2 -methyl- 1 -butyl, 3- methyl-1 -butyl, 2-methyl-3 -butyl, 2,2-dimethyl-l -propyl, 2-methyl-l -pentyl, 3-methyl-l-pentyl, 4-methyl-l -pentyl, 2-methyl-2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 2,2-dimethyl-l- butyl, 3,3-dimethyl-l-butyl, 2-ethyl-l-butyl, butyl, isobutyl, t-butyl, pentyl, isopentyl, neopentyl, hexyl, heptyl, octyl, etc.

[0054] The term “cycloalkyl” refers to a monovalent saturated cyclic, bicyclic, or bridged cyclic (e.g., adamantyl) hydrocarbon group of 3-12, 3-8, 4-8, or 4-6 carbons, referred to herein, e.g., as “C3-C6 cycloalkyl,” derived from a cycloalkane. Exemplary cycloalkyl groups include cyclohexyl, cyclopentyl, cyclobutyl, and cyclopropyl. The term “cycloalkylene” refers to a bivalent cycloalkyl group.

[0055] The term “haloalkyl” refers to an alkyl group that is substituted with at least one halogen. Exemplary haloalkyl groups include -CH2F, -CHF2, -CF3, -CH2CF3, -CF2CF3, and the like. The term “haloalkylene” refers to a bivalent haloalkyl group.

[0056] The term “hydroxyalkyl” refers to an alkyl group that is substituted with at least one hydroxyl. Exemplary hydroxyalkyl groups include -CH2CH2OH, -C(H)(OH)CH3, -CH2C(H)(OH)CH2CH2OH, and the like.

[0057] The terms “alkenyl” and “alkynyl” are art-recognized and refer to unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double or triple bond respectively.

[0058] The terms “alkoxy!” or “alkoxy” are art-recognized and refer to an alkyl group, as defined above, having an oxygen radical attached thereto. Representative alkoxyl groups include methoxy, ethoxy, propyloxy, tert-butoxy and the like. The term “haloalkoxyl” refers to an alkoxyl group that is substituted with at least one halogen. Exemplary haloalkoxyl groups include -OCH2F, -OCHF2, -OCF3, -OCH2CF3, -OCF2CF3, and the like.

[0059] The term “oxo” is art-recognized and refers to a “=O” substituent. For example, a cyclopentane susbstituted with an oxo group is cyclopentanone.

[0060] The symbol “ — ” indicates a point of attachment.

[0061] When any substituent or variable occurs more than one time in any constituent or the compound of the invention, its definition on each occurrence is independent of its definition at every other occurrence, unless otherwise indicated.

[0062] One or more compounds of the invention may exist in unsolvated as well as solvated forms with pharmaceutically acceptable solvents such as water, ethanol, and the like, and it is intended that the invention embrace both solvated and unsolvated forms. “Solvate” means a physical association of a compound of this invention with one or more solvent molecules. Thisphysical association involves varying degrees of ionic and covalent bonding, including hydrogen bonding. In certain instances the solvate will be capable of isolation, for example when one or more solvent molecules are incorporated in the crystal lattice of the crystalline solid. “Solvate” encompasses both solution-phase and isolatable solvates. Non-limiting examples of suitable solvates include ethanolates, methanolates, and the like. “Hydrate” is a solvate wherein the solvent molecule is H2O.

[0063] As used herein, the terms “subject” and “patient” are used interchangeably and refer to organisms to be treated by the methods of the present invention. Such organisms preferably include, but are not limited to, mammals (e.g, murines, simians, equines, bovines, porcines, canines, felines, and the like), and most preferably includes humans.

[0064] The term “IC50” is art-recognized and refers to the concentration of a compound that is required to achieve 50% inhibition of the target.

[0065] As used herein, the term “effective amount” refers to the amount of a compound sufficient to effect beneficial or desired results (e.g, a therapeutic, ameliorative, inhibitory or preventative result). An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route. As used herein, the term “treating” includes any effect, e.g., lessening, reducing, modulating, ameliorating or eliminating, that results in the improvement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof.

[0066] As used herein, the term “pharmaceutical composition” refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.

[0067] As used herein, the term “pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g, such as an oil / water or water / oil emulsions), and various types of wetting agents. The compositions also can include stabilizers and preservatives. For examples of carriers, stabilizers and adjuvants, see e.g., Martin, Remington’s Pharmaceutical Sciences, 15th Ed., Mack Publ. Co., Easton, PA

[1975] ,

[0068] For therapeutic use, salts of the compounds of the present invention are contemplated as being pharmaceutically acceptable. However, salts of acids and bases that are non- pharmaceutically acceptable may also find use, for example, in the preparation or purification of a pharmaceutically acceptable compound.

[0069] In addition, when a compound of the invention contains both a basic moiety (such as, but not limited to, a pyridine or imidazole) and an acidic moiety (such as, but not limited to, a carboxylic acid) zwitterions (“inner salts”) may be formed. Such acidic and basic salts used within the scope of the invention are pharmaceutically acceptable (i.e., non-toxic, physiologically acceptable) salts. Such salts of the compounds of the invention may be formed, for example, by reacting a compound of the invention with an amount of acid or base, such as an equivalent amount, in a medium such as one in which the salt precipitates or in an aqueous medium followed by lyophilization.

[0070] Throughout the description, where compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.

[0071] As a general matter, compositions specifying a percentage are by weight unless otherwise specified.I. Heterobifunctional Cotinine-Containing Compounds

[0072] One aspect of the invention provides heterobifunctional cotinine-containing compounds. The compounds may be used in the pharmaceutical compositions and therapeutic methods described herein. Exemplary compounds are described in the following sections, along with exemplary procedures for making the compounds.Part A: Compounds of Formula I

[0073] One aspect of the invention provides a compound represented by Formula I:or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C 1-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3-C6 cycloalkylene; or X1is a covalent bond;X2is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein Φ is a bond to L;Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, whereinFormula 1-1 is represented by:whereinR2and R4are independently C1-3 alkyl;R3is C1-3 haloalkyl;R?is C1-4 alkoxyl, -O-(C3-6 cycloalkyl), or C1-4 alkyl;R6represents independently for each occurrence fluoro or chloro;R7, R9, and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1-4 alkyl;R8represents independently for each occurrence fluoro, chloro, or C1.4 alkyl;R11is a bond to X1; x is 0 or 1; y is 0, 1, or 2; z is 0 or 1; andL is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched C1-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(CI-6alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-; or L2biswherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Lleis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-; (L-e) wherein n is an integer of 3 to 50;(L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; andL2giswherein n is 1, 2, 3, 4, or 5, and represents a covalent bondto Llg;(L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or, wherein n is 1, 2, 3, or 4, and represents a covalent bondto Llhandrepresents a covalent bond to L3h; L3his a bond, -C(0)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;(x(L-i) wherein L11is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; L1' is -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2jis Ci-6 linear alkylene orwherein n is 1 or 2, and represents a covalent bond to Llj; and I'represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(0)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(xiii)) wherein Z1is CH or N; m is 1 or 2; p is 1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llmis a bond, -C(O)-, -C(0)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3.6linear alkylene,***C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;or(L-p) wherein Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atoms of are replaced with F; Llpis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein RingA, Ring B, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently -O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; . wherein eachrepresents a covalent bond to X , and each represents acovalent bond to X2.

[0074] The definitions of variables in Formula I above encompass multiple chemical groups. The application contemplates embodiments where, for example, i) the definition of a variable is a single chemical group selected from those chemical groups set forth above, ii) the definition of a variable is a collection of two or more of the chemical groups selected from those set forth above, and iii) the compound is defined by a combination of variables in which the variables are defined by (i) or (ii).

[0075] In certain embodiments, the compound is a compound of Formula I.

[0076] As generally defined above, R1is Ci-4 alkyl or C3-6 cycloalkyl. In certain embodiments, R1is C1-4 alkyl. In certain embodiments, R1is -CH3. In certain embodiments, R1is C3-6 cycloalkyl. In certain embodiments, R1is cyclopropyl. In certain embodiments, R1is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R1is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0077] As generally defined above, X1is a CMO bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3- Ce cycloalkylene; or X1is a covalent bond.

[0078] In certain embodiments, X1is a C2-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, or -O-. In certain embodiments, X1is a C2-8 bivalent saturated straight or branched hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)- or -O-. In certain embodiments, X1is a C2-10 bivalent saturated straight hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, or -O-. In certain embodiments, X1is a C2-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)- or -O-. In certain embodiments, X1is aC2-10 bivalent saturated straight hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)- or -O-.

[0079] In certain embodiments, X1is -(C1-3 alkylene)-N(H)-'P, -(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-'P, or -(Ci-3 alkylene)-N(H)-(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-'P, wherein T is a bond to L.

[0080] In certain embodiments, X1is a C2-4 bivalent saturated straight hydrocarbon chain wherein one methylene unit of the chain is replaced by -N(H)-. In certain embodiments, X1is - (C1-3 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -(propylene)- N(H)-'P, (CH2CH2)-N(H)-'I / , or (CH2)-N(H)-'P, wherein T is a bond to L.In certain embodiments, X1is -(propylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -(CH2CH2)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -(CH2)-N(H)- T, wherein 'P is a bond to L.

[0081] In certain embodiments, X1is a C5-10 bivalent saturated straight hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)- or -O-. In certain embodiments, X1is -(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is -(propylene)-O-(propylene)-N(H)-vP, -(CH2CH2)-O- (CH2CH2CH2)-N(H)-T, -(CH2CH2)-O-(CH2CH2)-N(H)-'P, or -(CH2)-N(H)-(CH2CH2)-O- (CH2CH2)-N(H)-'I / , wherein T is a bond to L. In certain embodiments, X1is -(propylene)-O- (propylene)-N(H)-vP, wherein T is a bond to L. In certain embodiments, X1is -(C1-3 alkylene)- N(H)-(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is -(CH2)-N(H)-(CH2CH2)-O-(CH2CH2)-N(H)-'I', wherein 'P is a bond to L.

[0082] In certain embodiments, X1is -O-(C2-4 alkylene)-N(H)-'P or -O-(C2-3 alkylene)-O-(C2-6 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O-(CH2CH2)-N(H)- T, -O-(CH2CH2CH2)-N(H)-'P, -O-(CH2CH2)-O-(CH2CH2)-N(H)-T or -O-(CH2CH2)-O- (CH2CH2CH2)-N(H)-T, wherein T is a bond to L.

[0083] In certain embodiments, X1is -O-(C2-4 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O-(CH2CH2CH2)-N(H)-VP, wherein 'P is a bond to L. In certain embodiments, X1is -O-(C2-3 alkylene)-O-(C2-6 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O-(CH2CH2)-O-(CH2CH2CH2)-N(H)-'I;, wherein T is a bond to L.

[0084] In certain embodiments, X1is -(C2-3 alkylene)-O-(C2-4 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -(C^CFbJ-O-iCFhC^CFhJ-NfH)-1!', wherein T is a bond to L.

[0085] In certain embodiments, X1is a Ci-6 bivalent saturated straight hydrocarbon chain wherein (i) one or two methylene units of the chain are independently replaced by -N(H)-, - N(CHs)-, -O-, or -C(O)-, and (ii) one methylene unit of the chain is replaced by piperidinylene or piperazinylene. In certain embodiments, X1is, wherein the piperazinyl nitrogen is attached to L. In certain embodiments, X1is, wherein the piperidinyl nitrogen is attached to L.

[0086] In certain embodiments, X1is a covalent bond. In certain embodiments, X1is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, X1is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0087] As generally defined above, X2is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein $ is a bond to L. In certain embodiments, X2is $-(Ci-s alkylene)-N(H)-. In certain embodiments, X2is $-CH2CH2-N(H)-. In certain embodiments, X2is $-C(H)(CH3)-N(H)-. In certain embodiments, X2is a covalent bond. In certain embodiments, X2is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, X2is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0088] As generally defined above, Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, wherein Formula 1-1 is represented by:

[0089] In certain embodiments,

[0090] In certain embodiments, Y1is one of the following:

[0091] In certain embodiments,certain embodiments, Y1certain embodiments, Y1isIn certain embodiments, Y1is

[0093] In certain embodiments, Y1is one of the following:

[0094] In certain embodiments, Y1is one of the following:

[0095] In certain embodiments,In certain embodiments, Y1isIn certain embodiments, Y1In certain embodiments, Y1isIn certain embodiments,

[0096] In certain embodiments,

[0097] In certain embodiments, Y1is one of the following:

[0098] In certain embodiments,certain embodiments,In certain embodiments, Y1is

[0100] In certain embodiments, Y1is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, Y1is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0101] In certain embodiments:R2is methyl;R3is trifluorom ethyl; and R4is methyl.

[0102] As generally defined above, R2is C1-3 alkyl. In certain embodiments, R2is methyl. In certain embodiments, R2is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R2is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0103] As generally defined above, R3is C1-3 haloalkyl. In certain embodiments, R3is Ci haloalkyl. In certain embodiments, R3is trifluoromethyl. In certain embodiments, R3is selectedfrom the groups depicted in the compounds in Table 1, below. In certain embodiments, R3is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0104] As generally defined above, R4is C1-3 alkyl. In certain embodiments, R4is methyl. In certain embodiments, R4is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R3is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0105] As generally defined above, R5is C1-4 alkoxyl, -O-(C3-6 cycloalkyl), or C1.4 alkyl. In certain embodiments, R3is C1-4 alkoxyl or -O-(C3-6 cycloalkyl). In certain embodiments, R3is C1-4 alkoxyl or C1-4 alkyl. In certain embodiments, R5is methoxy, -O-(cyclopropyl), or methyl. In certain embodiments, R5is methoxy or -O-(cyclopropyl). In certain embodiments, R5is methoxy or methyl.

[0106] In certain embodiments, R3is C1-4 alkoxyl. In certain embodiments, R3is methoxy. In certain embodiments, R5is -O-(C3-6 cycloalkyl). In certain embodiments, R5is -O-(cyclopropyl). In certain embodiments, R5is C alkyl. In certain embodiments, R5is methyl. In certain embodiments, R5is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R5is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0107] In certain embodiments:R6is fluoro; y is 1 or 2;R7is hydrogen;R9and R10are hydrogen; and z is 0.

[0108] As generally defined above, R6represents independently for each occurrence fluoro or chloro. In certain embodiments, R6is fluoro. In certain embodiments, R6is chloro. In certain embodiments, R6is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R6is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0109] As generally defined above, R7is hydrogen or C1-4 alkyl. Tn certain embodiments, R7is hydrogen. In certain embodiments, R7is C1-4 alkyl. In certain embodiments, R7is methyl. In certain embodiments, R7is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R7is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0110] As generally defined above, R8represents independently for each occurrence fluoro, chloro, or C 1.4 alkyl. In certain embodiments, R8represents independently for each occurrence fluoro or chloro. In certain embodiments, R8is fluoro. In certain embodiments, R8is chloro. In certain embodiments, R8represents independently for each occurrence C1-4 alkyl. In certain embodiments, R8is methyl. In certain embodiments, R8is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R8is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0111] As generally defined above, R9and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1.4 alkyl.

[0112] In certain embodiments, R9and R10are independently hydrogen or C1.4 alkyl. In certain embodiments, R9and R10are hydrogen. In certain embodiments, R9and R10are independently C1-4 alkyl.

[0113] In certain embodiments, R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1-4 alkyl. In certain embodiments, R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms.

[0114] In certain embodiments, R9and R10are independently selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, R9and R10are independently selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0115] As generally defined above, R11is a bond to X1. In certain embodiments, R11replaces R9. In certain embodiments, R11replaces R7. In certain embodiments, R11occurs on the phenyl ring of Y1. In certain embodiments, the position of R11on Y1is selected from the positions depicted in the compounds in Table 1, below. In certain embodiments, the position of R11on Y1is selected from the positions depicted in the compounds in Tables 1 and 1-A, below.

[0116] As generally defined above, x is 0 or 1. In certain embodiments, x is 0. In certain embodiments, x is 1. In certain embodiments, x is selected from the values depicted in the compounds in Table 1, below. In certain embodiments, x is selected from the values depicted in the compounds in Tables 1 and 1-A, below.

[0117] As generally defined above, y is 0, 1, or 2. In certain embodiments, y is 0. In certain embodiments, y is 1. In certain embodiments, y is 2. In certain embodiments, y is 0 or 1. In certain embodiments, y is 1 or 2. In certain embodiments, y is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, y is selected from the values depicted in the compounds in Tables 1 and 1-A, below.

[0118] In certain embodiments, x is 0, and y is 0.

[0119] As generally defined above, z is 0 or 1. In certain embodiments, z is 0. In certain embodiments, z is 1. In certain embodiments, z is selected from the values depicted in the compounds in Table 1, below. In certain embodiments, z is selected from the values depicted in the compounds in Tables 1 and 1-A, below.

[0120] In certain embodiments, Y^X1- is

[0121] In certain embodiments, Y^X1- is

[0122] In certain embodiments, Y^X1- is one of the following:

[0123] In certain embodiments, Y^X1- is one of the following:

[0125] In certain embodiments,certain

[0126] In certain embodiments,

[0127] In certain embodiments,certain embodiments,embodiments,certain embodiments, Y1-1is,

[0129] In certain embodiments,^X1- is

[0130] In certain embodiments, Y^X1- is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, Y^X1- is selected from the groups depicted in the compounds in Tables 1 and 1-A, below.

[0131] As generally defined above, L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0- 20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(CI-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, - S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(CI-6alkyl)-, - OC(O)N(H)-, -OC(O)N(CI-6 alkyl)-, -N(H)C(O)O-, -N(CI-6 alkyl)C(O)O-, optionally substituted3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(0)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-; •** or L2biswherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llb; and each Rlbis independently hydrogen or C1.3 alkyl;(iv) 0 (L-c) wherein Llcis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(L-e) wherein n is an integer of 3 to 50;(vii)(L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)- NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond,wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;wherein each Z1is independently N or CH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L21’ is C2-10 linear alkylene* > wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhandrepresents a covalent bond to L3h; L3his a bond, -C(O)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L411is a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;(L-i) wherein L11is a bond, C1.12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to L31represents a covalent bond to NH; L2' is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-,-C(O)NH-, -NHC(O)-, or -O-; L2jis C1-6 linear alkylene or, wherein n is 1 or 2, andrepresents a covalent bond to Llj; and I' represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or 6- membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(L-m) wherein Z1is CH or N; m is 1 or 2; p is 1 or2; 0, 1, or 2 hydrogen atomsare replaced with F; Llmis a bond, -C(O)-, - C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3-6 linear alkylene, C3-6*** cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to(L-n-iv);(L-p) wherein Z1is CH or N; m is 1 or 2; p is 1 or 2;0, 1, or 2 hydrogen atoms ofare replaced with F; Llpis a bond, -C(O)-, - C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein Ring A, RingB, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare eachindependently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or - NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently - O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

[0132] In certain embodiments,wherein RingA and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L is -O- or -CH2-O-; wherein represents a covalent bond to X , andrepresents a covalent bond to X2.

[0133] In certain embodiments, L is selected from the groups depicted in the compounds in Table 1, below. In certain embodiments, L is selected from the groups depicted in the compounds in Tables 1 and 1-A, below. Further description and embodiments for variable L are provided below in, for example, Part C.

[0134] In certain embodiments, the compound of Formula I is represented by Formula Ta or a pharmaceutically acceptable salt thereof:wherein the variables are as defined in embodiments described herein in connection with Formula I and L. In certain embodiments, the compound is a compound of Formula la.

[0135] In certain embodiments, the compound of Formula I is represented by Formula lb or a pharmaceutically acceptable salt thereof:wherein the variables are as defined in embodiments described herein in connection with Formula I and L. In certain embodiments, the compound is a compound of Formula lb.

[0136] In certain embodiments, the compound of Formula I is represented by Formula Ic or a pharmaceutically acceptable salt thereof:wherein the variables are as defined in embodiments described herein in connection withFormula I and L. In certain embodiments, the compound is a compound of Formula Ic.

[0137] The description above describes multiple embodiments relating to compounds of Formula I. The patent application specifically contemplates all combinations of the embodiments.

[0138] Another aspect of the invention provides a compound represented by Formula (I*):or a pharmaceutically acceptable salt thereof, wherein:R1is C1-4 alkyl or C3-6 cycloalkyl;X is a C2 -10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)-, -N(CHs)-, or - O-; is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein is a bond to L;Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, wherein Formula 1-1 is represented by:whereinR2and R4are independently C1-3 alkyl;R3is C1-3 haloalkyl;R5is C1-4 alkoxyl, -O-(C3-6 cycloalkyl), or C1-4 alkyl;R6represents independently for each occurrence fluoro or chloro;R7, R9, and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1-4 alkyl;R8represents independently for each occurrence fluoro, chloro, or C1.4 alkyl;R11is a bond to X1; x is 0 or 1; y is 0, 1, or 2; z is 0 or 1;L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched C1-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(C 1-6 alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionallysubstituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -0- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -wherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2 -io linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;(v)0(L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(L-e) wherein n is an integer of 3 to 50;(vii)(L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-;2tis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; andL2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;(ix)(L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or*, wherein n is 1, 2, 3, or 4, and represents a covalent bond to L111andrepresents a covalent bond to L3h; L3his a bond, -C(O)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;(x)(L-i) wherein L11is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; L1' is -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2' is Ci-6 linear alkylene or, wherein n is 1 or 2, andrepresents a covalent bond to Llj; and II represents a single bond or a double bond;wherein Ring A is phenylene or a 5 or 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH- or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(xiii)) wherein Z1is CH or N; m is 1 or 2; pis 1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llmis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2mis C3-6linear alkylene,C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;(L-p) wherein Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atoms ofare replaced with F; L,pis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2pis -(4-6 memberedsaturated heterocyclylene containing 1 or 2 heteratoms independently selected from nitrogen oxygen, and sulfur)-C(O))-; andcovalent bond to X2.

[0139] The definitions of variables in Formula I* above encompass multiple chemical groups. The application contemplates embodiments where, for example, i) the definition of a variable is a single chemical group selected from those chemical groups set forth above, ii) the definition of a variable is a collection of two or more of the chemical groups selected from those set forth above, and iii) the compound is defined by a combination of variables in which the variables are defined by (i) or (ii).

[0140] In certain embodiments, the compound is a compound of Formula I*.

[0141] In certain embodiments, the definition of each of variables R1, X1, X2, Y1, R2, R3, R4,R5, R6, R7, R8, R9, R10, R11, x, y, z, and L is one of the embodiments described above in connection with Formula I. Additionally, further description and embodiments for variable L are provided below in, for example, Part C.

[0142] The description above describes multiple embodiments relating to compounds of Formula I*. The patent application specifically contemplates all combinations of the embodiments.Part B: Compounds of Formula II

[0143] One aspect of the invention provides a compound represented by Formula (II):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a Ci-io bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH )-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3-C6 cycloalkylene; or X1is a covalent bond;X2is cf>-(C 1-5 alkylene)-N(H)- or a covalent bond, wherein is a bond to L;Y1is defined by Formula II-l, III- 1 , or IV-1, each of which is substituted by one occurrence of R11, wherein R11is a bond to X1;Formula II- 1 is represented by:whereinR2is C1-3 haloalkyl;R3represents independently for each occurrence hydrogen, chloro, or fluoro;R4represents independently for each occurrence fluoro, chloro, C1-3 haloalkoxyl, C1.3 haloalkyl, -OH, Ci-4 alkoxyl, or C1-4 alkyl;R5is hydrogen or C1-4 alkyl;each of which is substituted with 0 or 1 occurrence of C1-4 alkyl;Y11is N or C(R3);Znis -O- or -CH2-; and x is 1 or 2;Formula III- 1 is represented by:wherein:R111’1represents independently for each occurrence halo;R111’2represents independently for each occurrence C1-4 alkoxyl or C1-4 alkyl;R111’3is hydrogen or C1-4 alkyl; and x-III and y-III are independently 0, 1, or 2;Formula IV-1 is represented by:wherein:RIV-1represents independently for each occurrence halo;RIV'2, RIV'3, RIV'4, and RIV'5are independently hydrogen or Ci-4 alkyl; or RIV'2and RIV'3or RIV’4and RIV'5are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring; and x-IV is 0, 1, 2, 3, or 4; andL is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(C i-6 alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(0)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-; or L2biswherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;(v)0(L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vi) (L-e) wherein n is an integer of 3 to 50;(vii) ° (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; andL2§iswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;(ix)(L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or _, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L311is a bond, -C(O)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;(x)(L-i) wherein L11is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linearalkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; L1Jis -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2jis Ci-6linear alkylene or*** I I I, wherein n is 1 or 2, and * represents a covalent bond to Llj; and I' represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(0)NH-, or -NHC(O)-; and L2kis a C3.8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(L-m) wherein Z1is CH or N; m is 1 or 2; pV is 1 or 2; 0, 1, or 2 hydrogen atoms of are replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3.6linear alkylene,***C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;(L-p) wherein Z1is CH or N; m is 1 or 2; p is v1 or 2; 0, 1, or 2 hydrogen atoms of are replaced with F; L,pis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein RingA, Ring B, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently -O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with - O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-; . — “ wherein eachrepresents a covalent bond to X , and eachrepresents a covalent bond to X2.

[0144] The definitions of variables in Formula II above encompass multiple chemical groups. The application contemplates embodiments where, for example, i) the definition of a variable is a single chemical group selected from those chemical groups set forth above, ii) the definition of a variable is a collection of two or more of the chemical groups selected from those set forth above, and iii) the compound is defined by a combination of variables in which the variables are defined by (i) or (ii).

[0145] In certain embodiments, the compound is a compound of Formula II.

[0146] As generally defined above, R1is C1-4 alkyl or C3-6 cycloalkyl. In certain embodiments, R1is C1-4 alkyl. In certain embodiments, R1is C3-6 cycloalkyl. In certain embodiments, R1is -CH3. In certain embodiments, R1is cyclopropyl. In certain embodiments, R1is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, R1is selected from the groups depicted in the compounds in Tables 2 and 2-A,below. In certain embodiments, R1is selected from the groups depicted in the compounds in Table 3, below. In certain embodiments, R1is selected from the groups depicted in the compounds in Table 4, below. In certain embodiments, R1is selected from the groups depicted in the compounds in Tables 2, 2-A, 3, and 4, below.

[0147] As generally defined above, Y1is defined by Formula II- 1 , III- 1 , or IV-1, each of which is substituted by one occurrence of R11, wherein R11is a bond to X1;Formula II- 1 is represented by:wherein:R2is C1-3 haloalkyl, chloro, or fluoro;R3represents independently for each occurrence hydrogen, chloro, or fluoro;R4represents independently for each occurrence fluoro, chloro, C1-3 haloalkoxyl, C1.3 haloalkyl, -OH, Ci-4 alkoxyl, or C1-4 alkyl;R5is hydrogen or C1-4 alkyl;which is substituted with 0 or 1 occurrence of C1-4 alkyl;Y11is N or C(R3);Znis -O- or -CH2-; and x is 1 or 2;Formula III- 1 is represented by:wherein:R111’1represents independently for each occurrence halo;R111’2represents independently for each occurrence C1-4 alkoxyl or C1-4 alkyl;R111’3is hydrogen or C1-4 alkyl; and x-III and y-III are independently 0, 1, or 2; andFormula IV-1 is represented by:wherein:RIV-1represents independently for each occurrence halo;RIV'2, RIV'3, RIV'4, and RIV'5are independently hydrogen or Ci-4 alkyl; or RIV'2and RIV'3or RIV’4and RIV'5are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring; and x-IV is O, 1, 2, 3, or 4.

[0148] In certain embodiments,substituted by one occurrence ofR11. In certain embodiments,

[0149] In certain embodiments, Y1is one of the following:certain embodiments,

[0151] In certain embodiments,that is substituted by one occurrence of R11. In certain embodiments,

[0152] In certain embodiments,In certain embodiments, Y1

[0153] In certain embodiments:R2is trifluoromethyl or chloro;R4represents independently for each occurrence fluoro, -OCF3, or methyl; and R3is hydrogen.

[0154] As generally defined above, R2is C1-3 haloalkyl, chloro, or fluoro. In certain embodiments, R2is C1-3 haloalkyl or chloro. In certain embodiments, R2is trifluoromethyl, chloro, or fluoro. In certain embodiments, R2is trifluoromethyl or chloro. In certain embodiments, R2is C 1-3 haloalkyl. In certain embodiments, R2is trifluoromethyl. In certain embodiments, R2is chloro or fluoro. In certain embodiments, R2is chloro. In certain embodiments, R2is fluoro. In certain embodiments, R2is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, R2is selected from the groups depicted in the compounds in Tables 2 and 2-A, below.

[0155] As generally defined above, R3represents independently for each occurrence hydrogen, chloro, or fluoro. In certain embodiments, R3is hydrogen, chloro, or fluoro. In certain embodiments, R3is hydrogen. In certain embodiments, R3is chloro. In certain embodiments, R3is fluoro. In certain embodiments, R3is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, R3is selected from the groups depicted in the compounds in Tables 2 and 2-A, below.

[0156] As generally defined above, R4represents independently for each occurrence fluoro, chloro, C1-3 haloalkoxyl, C1.3 haloalkyl, -OH, Ci-4alkoxyl, or C1-4 alkyl. In certain embodiments, R4represents independently for each occurrence fluoro, C1-3 haloalkoxyl, or C1-4 alkyl. In certain embodiments, R4represents independently for each occurrence fluoro, chloro, or C1-4 alkyl. In certain embodiments, R4represents independently for each occurrence fluoro or C1-4 alkyl. In certain embodiments, R4represents independently for each occurrence fluoro, chloro, C1-3haloalkoxyl, or C1-3 haloalkyl. In certain embodiments, R4represents independently for each occurrence -OH, C1-4 alkoxyl, or C1-4 alkyl.

[0157] In certain embodiments, R4represents independently for each occurrence fluoro, chloro, -OCF3, -CF3, -OH, -OCH3, or methyl. In certain embodiments, R4represents independently for each occurrence fluoro, -OCF3, or methyl. In certain embodiments, R4represents independently for each occurrence fluoro or methyl. In certain embodiments, R4represents independently for each occurrence fluoro, chloro, -OCF3, or -CF3. In certain embodiments, R4represents independently for each occurrence fluoro or chloro. In certain embodiments, R4represents independently for each occurrence -OH, -OCH3, or methyl

[0158] In certain embodiments, R4is fluoro. In certain embodiments, R4is chloro. In certain embodiments, R4represents independently for each occurrence C1-3 haloalkoxyl. In certain embodiments, R4is -OCF3. In certain embodiments, R4represents independently for each occurrence C1-3 haloalkyl. In certain embodiments, R4is -CF3. In certain embodiments, R4is - OH. In certain embodiments, R4represents independently for each occurrence C1-4 alkoxyl. In certain embodiments, R4is -OCH3. In certain embodiments, R4represents independently for each occurrence C1-4 alkyl. In certain embodiments, R4is methyl. In certain embodiments, R4is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, R4is selected from the groups depicted in the compounds in Tables 2 and 2 -A, below.

[0159] As generally defined above, R5is hydrogen or C1-4 alkyl. In certain embodiments, R3is hydrogen. In certain embodiments, R3is C1-4 alkyl. In certain embodiments, R5is methyl. In certain embodiments, R5is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, R5is selected from the groups depicted in the compounds in Tables 2 and 2- A, below.

[0160] As generally defined above,each of which is substituted with 0 or 1 occurrence of C1-4 alkyl. In certainembodiments, R6iseach of which is substituted with 0 or 1 occurrence of Ci-4 alkyl. In certain embodiments, R6iseach of which is substituted with 0 or 1 occurrence of Ci-4 alkyl. In certain embodiments, R6isIn certain embodiments, R6is?bNH

[0161] In certain embodiments, R6is O substituted with 0 or 1 occurrence of Ci-4 alkyl. In certain embodiments, R6is. In certain embodiments, R6issubstituted with 0 or 1 occurrence of Ci-4 alkyl. In certain embodiments, R6is. In certain embodiments, R6is. In certain embodiments, R6isIn certain embodiments, R6issubstituted with 0 or 1 occurrence of Ci-4 alkyl. In certain embodiments, R6is. In certain embodiments, R6isAs generally defined above, In certain embodiments, R6is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, R6is selected from the groups depicted in the compounds in Tables 2 and 2-A, below.

[0162] As generally defined above, R11is a bond to X1. In certain embodiments, R11occurs on the phenyl ring of Y1that bears R4. In certain embodiments, R11occurs on R6. In certain embodiments, R11occurs on the nitrogen atom of R6. In certain embodiments, the position ofR11on Y1is selected from the positions depicted in the compounds in Table 2, below. In certain embodiments, the position of R11on Y1is selected from the positions depicted in the compounds in Tables 2 and 2-A, below.

[0163] As generally defined above, Ynis N or C(R3). In certain embodiments, Ynis N. In certain embodiments, Ynis C(R3). In certain embodiments, Y11is C(H). In certain embodiments, Ynis selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, Ynis selected from the groups depicted in the compounds in Tables 2 and 2-A, below.

[0164] As generally defined above, Z11is -O- or -CH2-. In certain embodiments, Znis -O-. In certain embodiments, Znis -CH2-. In certain embodiments, Znis selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, Znis selected from the groups depicted in the compounds in Tables 2 and 2-A, below.

[0165] As generally defined above, x is 1 or 2. In certain embodiments, x is 1. In certain embodiments, x is 2. In certain embodiments, x is selected from the values depicted in the compounds in Table 2, below. In certain embodiments, x is selected from the values depicted in the compounds in Tables 2 and 2-A, below.

[0166] In certain embodiments, Y1is one of the following:

[0167] In certain embodiments, Y1is one of the following:

[0168] In certain embodiments, Y1is one of the following:

[0169]

[0170] In certain embodiments,

[0171] In certain embodiments, Y1is one of the following:

[0172] In certain embodiments, Y1is one of the following:

[0173] In certain embodiments, Y1is one of the following:

[0174] In certain embodiments, Y1is one of the following:

[0175] In certain embodiments, Y1is one of the following:

[0176] In certain embodiments, Y1is one of the following:

[0177] In certain embodiments,certain embodiments,In certain embodiments, Y1is

[0178] In certain embodiments, Y1is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, Y1is selected from the groups depicted in the compounds in Tables 2 and 2 -A, below.

[0179] In certain embodiments, the compound of Formula II is represented by Formula IIa-1 or a pharmaceutically acceptable salt thereof:wherein the variables are as defined in embodiments described herein in connection withFormula II and L.

[0180] In certain embodiments, the compound of Formula II is represented by Formula Ila or a pharmaceutically acceptable salt thereof:wherein the variables are as defined in embodiments described herein in connection withFormula II and L.

[0181] In certain embodiments, the compound of Formula II is represented by Formula lib or a pharmaceutically acceptable salt thereof:lib wherein the variables are as defined in embodiments described herein in connection withFormula II and L.

[0182] In certain embodiments, the compound of Formula II is represented by Formula He or a pharmaceutically acceptable salt thereof:wherein the variables are as defined in embodiments described herein in connection with Formula II and L.

[0183] In certain embodiments, the compound of Formula II is represented by Formula lid or a pharmaceutically acceptable salt thereof:lid wherein the variables are as defined in embodiments described herein in connection with Formula II and L.

[0184] In certain embodiments, Y1is defined by Formula III- 1 that is substituted by one occurrence of R11, wherein R11is a bond to X1, and wherein Formula III- 1 is represented by:wherein:R111’1represents independently for each occurrence halo;R111’2represents independently for each occurrence Ci-4 alkoxyl or Ci-4 alkyl;R111’3is hydrogen or Ci-4 alkyl; and x-III and y-III are independently 0, 1, or 2.

[0185] In certain embodiments,In certain embodiments, Y1isIn certain embodiments, Y1is

[0186] In certain embodiments, Y1isIn certain1"2In certain embodiments, Y1is

[0187] In certain embodiments,

[0188] In certain embodiments: R111’1is chloro;R111'2is -OCH3;Rm-3 •shydrogen; x-III is 1 or 0; and y-III is 1 or 2.

[0189] As defined generally above, R111’1represents independently for each occurrence halo. In certain embodiments, R111’1represents independently for each occurrence chloro or fluoro. In certain embodiments, R111 1is chloro or fluoro. In certain embodiments, R111 1is chloro. In certain embodiments, R111’1is fluoro. In certain embodiments, R111'1is selected from the groups depicted in the compounds in Table 3, below.

[0190] As defined generally above, R111'2represents independently for each occurrence Ci-4 alkoxyl or Ci-4 alkyl. In certain embodiments, R111'2represents independently for each occurrence Ci-4alkoxyl. In certain embodiments, R111'2represents independently for each occurrence Ci-4 alkyl. In certain embodiments, R111'2represents independently for each occurrence -OCH3 or - CH3. In certain embodiments, R111'2is -OCH3 or -CH3. In certain embodiments, R111'2is -OCH3. In certain embodiments, R111'2is -CH3. In certain embodiments, R111'2is selected from the groups depicted in the compounds in Table 3, below.

[0191] As defined generally above, R111’3is hydrogen or C1.4 alkyl. In certain embodiments, R111'3is hydrogen. In certain embodiments, R111'3is C1-4 alkyl. In certain embodiments, R111'3is - CH3. In certain embodiments, R111’3is selected from the groups depicted in the compounds in Table 3, below.

[0192] As defined generally above, R11is a bond to X1. In certain embodiments, R11occurs on the phenyl ring of Y1that is attached to the amide nitrogen atom of Y1. In certain embodiments, R11occurs on the phenyl ring of Y1that is attached to the furan ring of Y1. In certain embodiments, R11occurs on the furan ring of Y1. In certain embodiments, R11replaces R111'3. In certain embodiments, the position of R11on Y1is selected from the positions depicted in the compounds in Table 3, below.

[0193] As defined generally above, x-III and y-III are independently 0, 1, or 2. In certain embodiments, x-III is 0, 1, or 2. In certain embodiments, x-III is 0. In certain embodiments, x- III is 1. In certain embodiments, x-III is 2. In certain embodiments, x-III is 1 or 0. In certain embodiments, x-III is 1 or 2. In certain embodiments, x-III is selected from the values represented in the compounds in Table 3, below.

[0194] In certain embodiments, y-III is 0, 1, or 2. In certain embodiments, y-III is 0. In certain embodiments, y-III is 1. In certain embodiments, y-III is 2. In certain embodiments, y-Ill is 1 or 0. In certain embodiments, y-III is 1 or 2. In certain embodiments, y-III is selected from the values represented in the compounds in Table 3, below.

[0196] In certain embodiments, Y1is selected from the groups depicted in the compounds inTable 3, below.

[0197] In certain embodiments, Y1is defined by Formula TV-1 that is substituted by one occurrence of R11, wherein R11is a bond to X1, and wherein Formula TV-1 is represented by:wherein:RIV-1represents independently for each occurrence halo;R1V-2, RIV-3,ancj RIV‘5areindependently hydrogen or C1-4 alkyl; or R1V'2and RIV'3or RIV’4and RIV'5are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring; and x-IV is O, 1, 2, 3, or 4.,

[0199] In certain embodiments,

[0200] In certain embodiments:RIV-1is chloro;RIV'2and RIV'4are hydrogen;RIV’3, if present, is hydrogen;RIV'5, if present, is -CH3; and x-IV is 2, 3, or 4.

[0201] In certain embodiments, RIVIis chloro, and RIV'2and RIV4are hydrogen. In certain embodiments, RIV'2and RIV‘4are hydrogen. In certain embodiments, each of RIV3and RIV'5, if present, is hydrogen.

[0202] As defined generally above, RIX -lrepresents independently for each occurrence halo. In certain embodiments, RR _1represents independently for each occurrence fluoro or chloro. In certain embodiments, RIV-1is chloro. In certain embodiments, RIV1is selected from the groups depicted in the compounds in Table 4, below.

[0203] As defined generally above, RIV2, RIV-3, RIV-4, and RIV :5are independently hydrogen or C1-4 alkyl; or R1V'2and R1V’3or R1V4and R1V'5are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring.

[0204] In certain embodiments, RIV'2, RIV'3, RIV’4, and RIV'5are independently hydrogen or C1-4 alkyl. In certain embodiments, RIV'2and RIV’3are independently hydrogen or C1-4 alkyl. In certain embodiments, RIV'4and RIV'5are independently hydrogen or C1-4 alkyl.

[0205] In certain embodiments, RIV‘2and RI 3are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring. In certain embodiments, RIV-4and Riy 5are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring.

[0206] In certain embodiments, RIV'2is hydrogen or Ci-4 alkyl. In certain embodiments, RIV'2is hydrogen or -CH3. In certain embodiments, RIV'2is hydrogen. In certain embodiments, RIV'2is C1-4 alkyl. In certain embodiments, RIV’2is -CH3. In certain embodiments, RIV'2is selected from the groups depicted in the compounds in Table 4, below.

[0207] In certain embodiments, RIV'3is hydrogen or C1-4 alkyl. In certain embodiments, RIV'3is hydrogen or -CH3. In certain embodiments, RIV-3is hydrogen. In certain embodiments, RIV-3is C1-4 alkyl. In certain embodiments, RIV’3is -CH3. In certain embodiments, RIV’3is selected from the groups depicted in the compounds in Table 4, below.

[0208] In certain embodiments, RIV'4is hydrogen or C1.4 alkyl. In certain embodiments, RIV'4is hydrogen or -CH3. In certain embodiments, RIV'4is hydrogen. In certain embodiments, RIV’4is C1-4 alkyl. In certain embodiments, RIV'4is -CH3. In certain embodiments, RIV'4is selected from the groups depicted in the compounds in Table 4, below.

[0209] In certain embodiments, RIV'5is hydrogen or C1.4 alkyl. In certain embodiments, RIV'5is hydrogen or -CH3. In certain embodiments, RIV’5is hydrogen. In certain embodiments, RIV'3is C1-4 alkyl. In certain embodiments, RIV'3is -CH3. In certain embodiments, RIV'5is selected from the groups depicted in the compounds in Table 4, below.

[0210] As defined generally above, R11is a bond to X1. In certain embodiments, R11replaces RIV'3. In certain embodiments, R11replaces RIV'5. In certain embodiments, R11occurs on the pyridine ring of Y1. In certain embodiments, R11occurs on the phenyl ring of Y1. In certain embodiments, the position of R11on Y1is selected from the positions depicted in the compounds in Table 4, below.

[0211] As defined generally above, x-IV is 0, 1, 2, 3, or 4. In certain embodiments, x-IV is 0. In certain embodiments, x-IV is 1. In certain embodiments, x-IV is 2. In certain embodiments, x-IV is 3. In certain embodiments, x-IV is 4. In certain embodiments, x-IV is 0 or 1. In certain embodiments, x-IV is 1 or 2. In certain embodiments, x-IV is 2 or 3. In certain embodiments, x-IV is 3 or 4. In certain embodiments, x-IV is 0, 1 , or 2. In certain embodiments, x-IV is 1, 2, or 3. In certain embodiments, x-IV is 2, 3, or 4. In certain embodiments, x-IV is 0, 1, 2, or 3. In certain embodiments, x-IV is 1, 2, 3, or 4. In certain embodiments, x-IV is selected from the values represented in the compounds in Table 4, below.

[0212] In certain embodiments,In certain embodiments,In certain embodiments,In certain embodiments,In certain embodiments, Y1is

[0213] In certain embodiments, Y1is selected from the groups depicted in the compounds in Table 4, below. In certain embodiments, Y1is selected from the groups depicted in the compounds in Tables 2, 2-A, 3, and 4, below.

[0214] As generally defined above, X1is a Ci-io bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3- Cg cycloalkylene; or X1is a covalent bond. In certain embodiments, X1is a C2-10 bivalent saturated straight or branched hydrocarbon chain wherein one or two methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, or -O-. In certain embodiments, X1is a C2-8 bivalent saturated straight or branched hydrocarbon chain wherein one or two methylene units of the chain are independently replaced by -N(H)- or -O-.

[0215] In certain embodiments, X1is -O-(C2-4 alkylene)-N(H)-'P or -O-(C2-3 alkylene)-O-(C2-6 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O-(CH2CH2)-N(H)- T, -O-(CH2CH2CH2)-N(H)-T, -O-(CH2)4-N(H)-T, or -O-(CH2CH2)-O-(CH2CH2CH2)-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is -O-(C2-4 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O-(CH2CH2)-N(H)-T, -O-(CH2CH2CH2)-N(H)-T, or -O-(CH2)4-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O- (CH2CH2CH2)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -O-(C2-3 alkylene)-O-(C2-6 alkyl ene)-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is - O-(CH2CH2)-O-(CH2CH2CH2)-N(H)-T, wherein T is a bond to L.

[0216] In certain embodiments, X1is -(C0-3 alkylene)-N(H)-'P or -(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is -CH2-N(H)-'P, - (CH2)2-N(H)-T, -(CH2)3-N(H)-T, -(CH2)2-O-(CH2)2-N(H)-T, -(CH2)2-O-(CH2)3-N(H)-T, or - (CH2)3-O-(CH2)3-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is -(C0-3 alkylene)-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is -CH2-N(H)-T, - (CH2)2-N(H)-T, or -(CH2)3-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is - (C2-4 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is - (CH2CH2CH2)-N(H)-T, wherein T is a bond to L. In certain embodiments, X1is -(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-'P, wherein T is a bond to L. In certain embodiments, X1is - (CH2)2-O-(CH2)2-N(H)-T, -(CH2)2-O-(CH2)3-N(H)-T, or -(CH2)3-O-(CH2)3-N(H)-T, wherein T is a bond to L.

[0217] In certain embodiments, X1is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, X1is selected from the groups depicted in thecompounds in Tables 2 and 2-A, below. Tn certain embodiments, X1is selected from the groups depicted in the compounds in Table 3, below. In certain embodiments, X1is selected from the groups depicted in the compounds in Table 4, below. In certain embodiments, X1is selected from the groups depicted in the compounds in Tables 2, 2-A, 3, and 4, below.

[0218] As generally defined above, X2is 4>-(C 1-5 alkylene)-N(H)- or a covalent bond, wherein (f> is a bond to L. In certain embodiments, X2is $-(Ci-5 alkylene)-N(H)-. In certain embodiments, X2is ^-CH2CH2-N(H)-. In certain embodiments, X2is <|)-C(H)(CH3)-N(H)-. In certain embodiments, X2is a covalent bond. In certain embodiments, X2is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, X2is selected from the groups depicted in the compounds in Tables 2 and 2-A, below. In certain embodiments, X2is selected from the groups depicted in the compounds in Table 3, below. In certain embodiments, X2is selected from the groups depicted in the compounds in Table 4, below. In certain embodiments, X2is selected from the groups depicted in the compounds in Tables 2, 2-A, 3, and 4, below.

[0219] In certain embodiments, Y’-X1- is one of the following:

[0220] In certain embodiments, Y^X1- is one of the following:

[0221]

[0222] In certain embodiments, Y^X1- is one of the following:

[0223] In certain embodiments, Y^X1- is one of the following:

[0224] In certain embodiments, Y^X1- is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, Y^X1- is selected from the groups depicted in the compounds in Tables 2 and 2 -A, below. In certain embodiments, Y^X1- is selected from the groups depicted in the compounds in Table 3, below. In certain embodiments, Y’-X1- is selectedfrom the groups depicted in the compounds in Table 4, below. In certain embodiments, Y^X1- is selected from the groups depicted in the compounds in Tables 2, 2-A, 3, and 4, below.

[0225] As generally defined above, L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0- 20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(CI-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, - S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(CI-6alkyl)-, - OC(O)N(H)-, -OC(O)N(CI-6 alkyl)-, -N(H)C(O)O-, -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, - NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-;*** 1 _ or L2biswherein n is 1, 2, 3, or 4, and I represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vii) ° (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)- NHC(O)-; L2tis a bond, -NHC(O)-, -C(O)NH-, or a Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and L2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;wherein each Z1is independently N or CH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene> **** wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhand ’ represents a covalent bond to L31’; L311is a bond, -C(O)CH2-, -O-(Cs-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;v, w ere n n s , , , , or , an « represents a cova ent ond to L and represents a covalent bond to NH; L21is a bond, C1-12 linear alkylene, or, , , , , , represents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-,-C(O)NH-, -NHC(O)-, or -O-; L2jis C1-6 linear alkylene or, wherein n is 1 or 2, and represents a covalent bond to Llj; and I' represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or 6- membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; L1kis a bond, -C(O)-, -C(O)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene *** _ or, wherein n is 1, 2, or 3, and ’ represents a covalent bond to Llk;, , , ,C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3.6linear alkylene, C3.6cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond toLlm;(L-n-iv);0, 1, or 2 hydrogen atomsare replaced with F; Llpis a bond, -C(O)-, - C(O)NH-, -NHC(O)-, -S(O)2-, -S(0)2NH-, or -NHS(0)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein Ring A, RingB, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or - NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently - O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

[0226] In certain embodiments,wherein RingA and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O- or -CH2-O-; wherein I represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0227] In certain embodiments, L is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, L is selected from the groups depicted in the compounds in Tables 2 and 2-A, below. In certain embodiments, L is selected from the groups depicted in the compounds in Table 3, below. In certain embodiments, L is selected from the groups depicted in the compounds in Table 4, below. In certain embodiments, L is selected from the groups depicted in the compounds in Tables 2, 2-A, 3, and 4, below. Further description and embodiments for variable L are provided below in, for example, Part C.

[0228] The description above describes multiple embodiments relating to compounds of Formula II. The patent application specifically contemplates all combinations of the embodiments.

[0229] Another aspect of the invention provides a compound represented by Formula (II*):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C2 -10 bivalent saturated straight or branched hydrocarbon chain wherein one or two methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, or -O-;X2is >-(C 1-5 alkylene)-N(H)- or a covalent bond, wherein ([) is a bond to L;Y1is defined by Formula II- 1 that is substituted by one occurrence of R11, whereinFormula II- 1 is represented by:whereinR2is Ci-3 haloalkyl;R3is hydrogen, chloro, or fluoro;R4represents independently for each occurrence fluoro, chloro, or Ci-4 alkyl;R5is hydrogen or C1-4 alkyl;occurrence of Ci-4 alkyl;R11is a bond to X1; x is 1 or 2;L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(CI-6alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(0)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -wherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) 0 (L-c) wherein Llcis C2.10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vii) ° (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2tis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and, , , , ,represents a covalent bond to L3h; L311is a bond, -C(0)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(0)CH2-; and m is 1, 2, or 3;, , , , , , bond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;and Z~ is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2' is Ci-6 linear alkylene or*** | 11, wherein n is 1 or 2, and » represents a covalent bond to Llj; and " represents a single bond or a double bond;wherein Ring A is phenylene or a 5 or 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH- or -NHC(O)-; and L2kis a C3-8*** / r i\ ** / '(^^''op*** I _ straight chain alkylene orn, wherein n is 1, 2, or 3, and » represents a covalent bond to Llk;3-6 cyc oa y ene, or , w ere n n s or , an represents a covalent bond to Llm;n Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llpis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteratoms independently selected from nitrogen oxygen, and sulfur)-C(O))-; and. I — . — | ** wherein each « represents a covalent bond to X , and each « represents a covalent bond to X2.

[0230] The definitions of variables in Formula II* above encompass multiple chemical groups. The application contemplates embodiments where, for example, i) the definition of a variable is a single chemical group selected from those chemical groups set forth above, ii) the definition of a variable is a collection of two or more of the chemical groups selected from those set forth above, and iii) the compound is defined by a combination of variables in which the variables are defined by (i) or (ii).

[0231] In certain embodiments, the compound is a compound of Formula II*.

[0232] In certain embodiments, the definition of each of variables R1, X1, X2, Y1, R2, R3, R4,R5, R6, R11, x, and L is one of the embodiments described above in connection with Formula II. Additionally, further description and embodiments for variable L are provided below in, for example, Part C.

[0233] The description above describes multiple embodiments relating to compounds of Formula II*. The patent application specifically contemplates all combinations of the embodiments.Part B-1 : Compounds of Formula III

[0234] Another aspect of the invention provides a compound represented by Formula III:or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C 1-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3-C6 cycloalkylene; or X1is a covalent bond;X2is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein <]) is a bond to L;Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, whereinFormula 1-1 is represented by:whereinR2and R4are independently C1.3 alkyl;R3is C1-3 haloalkyl;R5is Ci-4haloalkoxyl;R6represents independently for each occurrence fluoro or chloro;R7, R9, and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1-4 alkyl;R8represents independently for each occurrence fluoro, chloro, or C1.4 alkyl;R11is a bond to X1; x is 0 or 1; y is 0, 1, or 2; z is 0 or 1; andL is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched C1-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(C 1-6 alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -0- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(0)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -wherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;(v)0(L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vii) ° (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and _L2§iswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg; *( ) (L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or _wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L311is a bond, -C(O)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;(x)(L-i) wherein L11is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linearalkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; L1Jis -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2jis Ci-6linear alkylene or*** I I I, wherein n is 1 or 2, and * represents a covalent bond to Llj; and I' represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(0)NH-, or -NHC(O)-; and L2kis a C3.8 _ straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(L-m) wherein Z1is CH or N; m is 1 or 2; pis 1 or 2; 0, 1, or 2 hydrogen atoms of are replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3.6linear alkylene,***C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;(L-p) wherein Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atoms ofare replaced with F; L,pis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein RingA, Ring B, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently -O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-;* | — . — | “ wherein each « represents a covalent bond to X , and each » represents a covalent bond to X2.

[0235] The definitions of variables in Formula III above encompass multiple chemical groups. The application contemplates embodiments where, for example, i) the definition of a variable is a single chemical group selected from those chemical groups set forth above, ii) the definition of a variable is a collection of two or more of the chemical groups selected from those set forth above, and iii) the compound is defined by a combination of variables in which the variables are defined by (i) or (ii).

[0236] In certain embodiments, the compound is a compound of Formula III.

[0237] As generally defined above, R5is Ci-4haloalkoxyl. In certain embodiments, R3is C1-2 haloalkoxyl. In certain embodiments, R5is Ci haloalkoxyl. In certain embodiments, R5is fluromethoxyl. In certain embodiments, R?is difluromethoxyl.

[0238] In certain embodiments, one or more variables of Formula III are as defined in Part A above, except for the definition of variable R5.Part C: Additional Description of the Linker

[0239] As generally defined above for Formula I and II, and for Formula II, II, and III, L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0- 20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(CI-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, - S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(CI-6alkyl)-, - OC(O)N(H)-, -OC(O)N(CI-6 alkyl)-, -N(H)C(O)O-, -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, - NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-;*** 1 _ or L2biswherein n is 1, 2, 3, or 4, and I represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vii) ° (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)- NHC(O)-; L2tis a bond, -NHC(O)-, -C(O)NH-, or a Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and L2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;wherein each Z1is independently N or CH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene> **** wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhand ’ represents a covalent bond to L31’; L311is a bond, -C(O)CH2-, -O-(Cs-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;v, w ere n n s , , , , or , an « represents a cova ent ond to L and represents a covalent bond to NH; L21is a bond, C1-12 linear alkylene, or, , , , , , represents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z~ is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-,-C(O)NH-, -NHC(O)-, or -O-; L2jis Ci-6linear alkylene or, wherein n is 1 or 2, I I and represents a covalent bond to L1'; and I' represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or 6- membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene *** | _ or, wherein n is 1, 2, or 3, and ’ represents a covalent bond to Llk;(xiii)) wherein Z1is CH or N; m is 1 or 2; p is 1 or2; 0, 1, or 2 hydrogen atomsare replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3-6 linear alkylene, C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to(L-n-iv);0, 1, or 2 hydrogen atomsare replaced with F; Llpis a bond, -C(O)-, -C(O)NH- , -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein Ring A, RingB, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or - NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently - O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

[0240] As generally defined above for Formula I* and IF, and in certain embodiments for Formula I and II, L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0- 20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(CI-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, - S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(CI-6alkyl)-, - OC(O)N(H)-, -OC(O)N(C i-6 alkyl)-, -N(H)C(O)O-, -N(CI-6 alkyl)C(O)O-, optionally substituted3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, - NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-; •** or L2biswherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llb; and each Rlbis independently hydrogen or C1.3 alkyl;(iv) 0 (L-c) wherein Llcis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vii) ° (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)- NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH; o(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and L2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;wherein each Z1is independently N or CH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L21’ is C2-10 linear alkylene*** i > J **** wherein n is 1, 2, 3, or 4, and • represents a covalent bond to Llhand ’ represents a covalent bond to L3h; L3his a bond, -C(O)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L411is a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3;, , , , , , nd to L31and represents a covalent bond to NH; L2' is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-,-C(O)NH-, -NHC(O)-, or -O-; L2jis Ci-6 linear alkylene or, wherein n is 1 or 2, andrepresents a covalent bond to Llj; and I' represents a single bond or a double bond;wherein Ring A is phenylene or a 5 or 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH- or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or , wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(L-m) wherein Z1is CH or N; m is 1 or 2; p is 1 or2; 0, 1, or 2 hydrogen atoms of are replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2mis C3-6 linear alkylene, C3-6cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to(L-n-iv); or, , , , C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteratoms independently selected from nitrogen oxygen, and sulfur)-C(O))-;| _ _ I ** wherein each » represents a covalent bond to X1, and each « represents a covalent bond

[0241] In certain embodiments, L is bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(Ci-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(0)-, -N(CI-6alkyl)C(O)-, - C(0)N(H)-, -C(O)N(C 1-6 alkyl)-, -0C(0)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(0)0-, -N(CI-6alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0242] In certain embodiments, L is a divalent linker of Formula (L-a), (L-b), (L-c), (L-d), (L-e), (L-f), (L-g), (L-h), (L-i), (L-j), (L-k), (L-m), (L-n-i), (L-n-ii), (L-n-iii), or (L-n-iv).

[0243] In certain embodiments, L is a divalent linker of Formula (L-a):wherein:Ring A and Ring B are each independently C4-6 cycloalkylene;Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-; wherein represents a covalent bond to X andrepresents a covalent bond to X2.

[0244] In certain embodiments, Ring A and Ring B of Formula (L-a) are each independently

[0245] In certain embodiments, L is a divalent linker of Formula (L-a-i):wherein:Ring A is C4-6 cycloalkylene;Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; andL2ais -O-, -NHC(O)-, or -CH2-O-;* I _ _ I ** wherein I represents a covalent bond to X1, and ‘ represents a covalent bond to X2.

[0247] In certain embodiments, L is a divalent linker of Formula (L-a-ii):-ii); wherein:Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1.3 alkyl;L2ais -O-, -NHC(O)-, or -CH2-O-; p is 1 or 2; and m is 1 or 2; h represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0248] In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected fromwherein: j is 1, 2, 3, or 4; k is 0, 1, 2, or 3; the sum of j and k is 2, 3, or 4; q is 1 or 2; r is 1 or 2; s is 0 or 1;the sum of q, r, and s is 2 or 3;X1Aand X2Aare independently -O- or NRa; and each Rais independently hydrogen or C1-3 alkyl; wherein represents a covalent bond to the C(O) group of Formula (L-a), (L-a-i), or (L-a-ii), and represents a covalent bond to Ring B of Formula (L-a) or to the cyclohexylene group of Formula (L-a-i) or (L-a-ii).

[0249] In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from - (CH2)2O-, -(CH2)3O-, -(CH2)4O-, -(CH2)2OCH2-, -(CH2)3OCH2-, -(CH2)2O(CH2)2-, -CH2OCH2-, -CH2O(CH2)2-, -CH2O(CH2)3-, -CH2OCH2O-, or -CH2OCH2OCH2-. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -(CH2)2O-, -(CH2)3O-, -(CH2)2OCH2-, or - (CH2)3OCH2-. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -(CH2)2NRa-, -(CH2)3NRa-, -(CH2)4NRa-, -(CH2)2NRaCH2-, -(CH2)3NRaCH2-, - (CH2)2NRa(CH2)2-, -CH2NRaCH2-, -CH2NRa(CH2)2-, -CH2NRa(CH2)3-, -CH2NRaCH2NRa-, or - CH2NRaCH2NRaCH2-, wherein each Rais independently hydrogen or C1-3 alkyl. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -(CH2)2NRa-, - (CH2)3NRa-, -(CH2)2NRaCH2-, or -(CH2)3NRaCH2-, wherein Rais hydrogen or C1-3 alkyl. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -(CH2)2NH-, - (CH2)3NH-, -(CH2)4NH-, -(CH2)2NHCH2-, -(CH2)3NHCH2-, -(CH2)2NH(CH2)2-, -CH2NHCH2-, - CH2NH(CH2)2-, -CH2NH(CH2)3-, -CH2NHCH2NH-, or -CH2NHCH2NHCH2-. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -(CH2)2NH-, -(CH2)3NH- , -(CH2)2NHCH2-, or -(CH2)3NHCH2-. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -CH2OCH2NRa-, -CH2NRaCH2O-, -CH2OCH2NRaCH2-, - CH2NRaCH2OCH2-, wherein Rais independently hydrogen or C1-3 alkyl. In certain embodiments, Llaof Formula (L-a), (L-a-i), or (L-a-ii) is selected from -CH2OCH2NH-, - CH2NHCH2O-, -CH2OCH2NHCH2-, -CH2NHCH2OCH2-.

[0250] In certain embodiments, L is a divalent linker of Formula (L-a-iii):p is 1 or 2; m is 1 or 2; and n is 1, 2, or 3; wherein represents a covalent bond to X1,represents a covalent bond to X2.

[0251] In certain embodiments, L is a divalent linker of Formula (L-a) selected from the group consisting of:

[0252] In certain embodiments, L is selected from the group consisting ofattachment indicated on the cycloalkyl-bound carbonyl group is the attachment point to X1.

[0253] In certain embodiments, L is a divalent linker of Formula (L-b):wherein:Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene;Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-;L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, - C(O)NRlb-, or -NRlbC(O)-; orL2bis, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl; h wherein represents a covalent bond to X1, and represents a covalent bond to X2.

[0255] In certain embodiments, L is a divalent linker of Formula (L-b-i):)NH-;L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, - C(O)NRlb-, or -NRlbC(O)-; orL2bis , wherein n is 1, 2,3, or 4, and represents a covalent bond to Llb; each Rlbis independently hydrogen or C1-3 alkyl; p is 1 or 2; and m is 1 or 2;* _ wherein represents a covalent bond to X1, and represents a covalent bond to X2.

[0256] In certain embodiments, L2bof Formula (L-b) or (L-b-i) is selected from; wherein: j is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; k is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; the sum of j and k is 5, 6, 7, 8, 9, 10, or 11; q is 1, 2, 3, 4, 5, 6, 7, 8, or 9; r is 1, 2, 3, 4, 5, 6, 7, 8, or 9; s is O, 1, 2, 3, 4, 5, 6, 7, or 8; the sum of q, r, and s is 4, 5, 6, 7, 8, 9, or 10;t is 1, 2, 3, 4, 5, 6, or 7; u is 1, 2, 3, 4, 5, 6, or 7; v is 1, 2, 3, 4, 5, 6, or 7; w is 0, 1, 2, 3, 4, 5, or 6; the sum of t, u, v, and w is 3, 4, 5, 6, 7, 8, or 9; a is 1, 2, 3, 4, or 5; b is 1, 2, 3, 4, or 5; c is 1, 2, 3, 4, or 5; d is 1, 2, 3, 4, or 5; e is 0, 1, 2, 3, or 4; the sum of a, b, c, d, and e is 4, 5, 6, 7, or 8;X1AX2A, X3A, and X4Aare independently -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-; and each Rlbis independently hydrogen or C1-3 alkyl;*** I > I ** wherein I represents a covalent bond to Llbof Formula (L-b) or (L-b-i), and « represents a covalent bond to X2.

[0257] In certain embodiments, L is a divalent linker of Formula (L-b) selected from the group consisting of:. In certain embodiments, the point of attachment indicated on the cycloalkyl-bound carbonyl group is the attachment point to X1.

[0258] In certain embodiments, L is divalent linker of Formula (L-c):wherein:Llcis C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; andL2Cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; _ whereinrepresents a covalent bond to X1, andrepresents a covalent bond to X2.

[0259] In certain embodiments, Ring A of Formula (L-c) is

[0260] In certain embodiments, L is a divalent linker of Formula (L-c-i):wherein:Llcis C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;L2eis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; p is 1 or 2; and m is 1 or 2; wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0261] In certain embodiments, Llcof Formula (L-c) or (L-c-i) is selected fromj is 1, 2, 3, 4, 5, 6, 7, 8, or 9; k is 0, 1, 2, 3, 4, 5, 6, 7, or 8; the sum of j and k is 1, 2, 3, 4, 5, 6, 7, 8, or 9; q is 1, 2, 3, 4, 5, 6, or 7; r is 1, 2, 3, 4, 5, 6, or 7; s is 0, 1, 2, 3, 4, 5, or 6; the sum of q, r, and s is 2, 3, 4, 5, 6, 7, or 8; t is 1, 2, 3, 4, or 5; u is 1, 2, 3, 4, or 5; v is 1, 2, 3, 4, or 5; w is 0, 1, 2, 3, or 4; the sum of t, u, v, and w is 3, 4, 5, 6, or 7; andX1A, X2Aand X3Aare independently -O-, -NH-, -NHC(O)-, or -C(O)NH-; _ whereinrepresents a covalent bond to the C(O) group of Formula (L-c) or (L-c-i), andrepresents a covalent bond to the ring of Formula (L-c) or (L-c-i).[02621 In certain embodiments, L2eof Formula (L-c) or (L-c-i) is selected fromwherein: j is O, 1, 2, 3, 4, 5, 6, 7, 8, or 9; k is 0, 1, 2, 3, 4, 5, 6, 7, 8, or 9; the sum of j and k is 1, 2, 3, 4, 5, 6, 7, 8, or 9; q is 0, 2, 3, 4, 5, 6, or 7; r is 1, 2, 3, 4, 5, 6, 7, or 8; s is 0, 1, 2, 3, 4, 5, 6, or 7; the sum of q, r, and s is 1, 2, 3, 4, 5, 6, 7, or 8; t is 0, 1 , 2, 3, 4, or 5; u is 1, 2, 3, 4, 5, or 6; v is 1, 2, 3, 4, 5, or 6; w is 0, 1, 2, 3, 4, or 5;the sum of t, u, v, and w is 2, 3, 4, 5, 6, or 7; andX1A, X2Aand X3Aare independently -O-, -NH-, -NHC(O)-, or -C(O)NH-;### | _ _ | « wherein I represents a covalent bond to the ring of Formula (L-c) or (L-c-i), and * represents a covalent bond to X2.

[0263] In certain embodiments, L is a divalent linker of Formula (L-c) selected from the group consisting of:

[0264] In certain embodiments, L is selected from the group consisting ofIn certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0265] In certain embodiments, L is a divalent linker of Formula (L-d):wherein:Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;* | _ _ I ** wherein ’ represents a covalent bond to X1, and ‘ represents a covalent bond to X2.

[0266] In certain embodiments, Lldof Formula (L-d) is selected fromwherein: j is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20; k is 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, or 20; the sum ofj and k is 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21; q is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19; r is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19; s is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18; the sum of q, r, and s is 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20; t is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17; u is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17; v is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17; w is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16;the sum of t, u, v, and w is 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19; a is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15; b is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15; c is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15; d is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15; e is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14; the sum of a, b, c, d, and e is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18; f is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13; g is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13; h is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13; i is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13; y is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13; z is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12; the sum of f, g, h, i, y, and z is 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17; andX1A, X2A, X3A, X4A, and X5Aare independently -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)- NH-; wherein represents a covalent bond to the C(O) group of Formula (L-d), andrepresents a covalent bond to X2.

[0267] In certain embodiments, L is a divalent linker of Formula (L-d) selected from the group consisting of:In certain embodiments, the point of attachment indicated on the carbon-bound carbonyl group is the attachment point to X1.

[0268] In certain embodiments, L is a divalent linker of Formula (L-e):wherein: n is an integer of 3 to 50; wherein » represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0269] In certain embodiments, n of Formula (L-e) is 3 to 25, 3 to 10, 3 to 8, 3 to 7, 3 to 5, or 3 to 4. In certain embodiments, n of Formula (L-e) is 3, 4, 5, 7, 8, 22, or 50.

[0270] In certain embodiments, L is a divalent linker of Formula (L-f):wherein:Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH- , or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-;L2fis a bond, -NHC(O)-, -C(O)NH-, or a Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH; whereinrepresents a covalent bond to X1, andrepresents a covalent bond to X2.

[0271] In certain embodiments, Llfof Formula (L-f) is selected from; wherein: j is 1, 2, 3, 4, or 5; k is 0, 1, 2, 3, or 4; the sum of j and k is 1, 2, 3, 4, or 5; q is 1, 2, or 3; r is 1, 2, or 3; s is 0, 1, 2; the sum of q, r, and s is 2, 3, or 4; andX1Aand X2Aare independently -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; _ whereinrepresents a covalent bond to the C(O) group of Formula (L-f), andrepresents a covalent bond to the ring of Formula (L-f).

[0272] In certain embodiments, L2fof Formula (L-f) is selected fromwherein: j is 1, 2, 3, 4, or 5; k is 0, 1, 2, 3, or 4; the sum of j and k is 1, 2, 3, 4, or 5; q is 1, 2, or 3; r is 1, 2, or 3; s is 0, 1, 2; and the sum of q, r, and s is 2, 3, or 4; whereinrepresents a covalent bond to the ring of Formula (L-f), andrepresents a covalent bond to the X2.

[0273] In certain embodiments, L is a divalent linker of Formula (L-f) selected from the group consisting of:. In certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0274] In certain embodiments, L is selected from the group consisting of:attachment indicated on the carbonyl group is the attachment point to X1.

[0275] In certain embodiments, L is a divalent linker of Formula (L-g):wherein:Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms;Llgis a bond, -CH2-, -NH-, or -O-; andL2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg; _ wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0276] In certain embodiments, L is a divalent linker of Formula (L-g-i):wherein:Llgis a bond, -CH2-, -NH-, or -O-;L2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;Z1, Z2, and Z3are each independently selected from N or CH, provided that one or two of Z1, Z2, and Z3is N; wherein represents a covalent bond to Xrepresents a covalent bond to X2.

[0277] In certain embodiments, L is a divalent linker of Formula (L-g) selected from the group consisting of:. In certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0278] In certain embodiments, L is a divalent linker of Formula (L-h):wherein: each Z1is independently N or CH;Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-;L211is C2-10 linear alkylene or, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhandrepresents a covalent bond to L311;L3his a bond, -C(O)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-;L4his a bond, -C(O)-, -CH2C(O)-, or -C(O)CH2-; and m is 1, 2, or 3; _ _ whereinrepresents a covalent bond to X1, andrepresents a covalent bond to X2.

[0279] In certain embodiments, L is a divalent linker of Formula (L-h) selected from the group consisting of:In certain embodiments, the point of attachment indicated on the carbonyl group or cyclic group is the attachment point to X1.

[0280] In certain embodiments, L is a divalent linker of Formula (L-i):wherein:L11is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, and represents a covalent bond to L31andrepresents a covalent bond to NH;L21is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; andL31is a bond or -C(O)-; _ wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0281] In certain embodiments, L is a divalent linker of Formula (L-i) selected from the group consisting of:In certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0282] In certain embodiments, L is divalent linker of Formula (L-j):each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N;Lljis -NH-, -C(O)NH-, -NHC(O)-, or -O-;L2' is Ci-6 linear alkylene or, wherein n is 1 or 2, and represents acovalent bond to Llj; andI represents a single bond or a double bond; whereinrepresents a covalent bond to X1, andrepresents a covalent bond to X2.

[0283] In certain embodiments, L is a divalent linker of Formula (L-j) selected from the group consisting of:. In certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0284] In certain embodiments, L is a divalent linker of Formula (L-k):wherein:Ring A is phenylene or a 5- or 6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N;Llkis a bond, -C(O)-, -C(O)NH-, or -NHC(O)-; andL2kis a C3-8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk; wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0285] In certain embodiments, L is a divalent linker of Formula (L-k) selected from the group consisting of:attachment indicated on the carbonyl group is the attachment point to X1.

[0286] In certain embodiments, L is a divalent linker of Formula (L-m):O (L-m); wherein:Z1is CH or N; m is 1 or 2; p is 1 or 2;0, 1, or 2 hydrogen atomsare replaced with F;Llinis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; andL2mis C3-6 linear alkylene, C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm; wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0287] In certain embodiments, L is a divalent linker of Formula (L-m) selected from the group consisting of:indicated on the carbonyl group is the attachment point to X1.

[0288] In certain embodiments, L is a divalent linker of Formula (L-n-i):wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0289] In certain embodiments, L is a divalent linker of Formula (L-n-ii):_ whereinrepresents a covalent bond to X1, andrepresents a covalent bond to X2.

[0290] In certain embodiments, L is a divalent linker of Formula (L-n-iii):wherein represents a covalent bond to X1, andrepresents a covalent bond to X2.

[0291] In certain embodiments, L is divalent linker of Formula (L-n-iv):iv)* I _ _ I “ wherein I represents a covalent bond to X1, and ’ represents a covalent bond to X2.

[0292] In certain embodiments,wherein Z1isCH or N; m is 1 or 2; p is 1 or 2; 0, 1, or 2 hydrogen atomsare replaced withF; Llpis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis - (4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-.

[0293] In certain embodiments,wherein Z1is CH or N; m is 1 or 2; p is 1 or 2; 0, 1, or 2 hydrogen atomsare replaced withF; Llpis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-.

[0294] In certain embodiments, L isIn certain embodiments, the point of attachment indicated on the cycloalkyl-bound carbonyl group is the attachment point to X1.

[0295] In certain embodiments,. In certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0296] In certain embodiments, L is a divalent linker of Formula (L-q):wherein Ring A, Ring B,Ring C, and Ring D are each independently C4-6 cycloalkylene; Llq, L2q, and L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or - NRa-; each Rais independently hydrogen or C1-3 alkyl; and L4qis -O-, -NHC(O)-, or -CH2-O-; — and wherein represents a covalent bond to X1andrepresents a covalent bond to X2.

[0297] In certain embodiments, L is a divalent linker of Formula (L-q-i):L3q,L4q, — , and — are as defined for Formula (L-q); and each p and m is independentlyfor each occurrence 1 or 2.

[0298] In certain embodiments, L is a divalent linker of Formula (L-q-ii):* andare as defined for Formula (L-q); each p and m is independently for each occurrence 1 or 2; and n is independently for each occurrence 1, 2, or 3.

[0299] In certain embodiments, L iswhereinare as defined for Formula (L-q).

[0300] In certain embodiments, L is a divalent linker of Formula (L-r):O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or - C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; and whereinrepresents a covalent bond to X1andrepresents a covalent bond to X2.

[0301] In certain embodiments, L is divalent linker of Formula (L-r-i):are as defined for Formula (L-r); and each p and m is independently for each occurrence 1 or 2.

[0302] In certain embodiments, L is a divalent linker of Formula (L-r-ii):defined for Formula (L-r).

[0303] In certain embodiments, L is one of the following:

[0304] In certain embodiments, L is one of the following:certain embodiments, the point of attachment indicated on the carbon-bound carbonyl group is the attachment point to X1.

[0305] In certain embodiments, L is one of the following:In certain embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0306] In certain embodiments,embodiments, the point of attachment indicated on the carbonyl group is the attachment point to X1.

[0307] In certain embodiments, Lis selected from the groups depicted in the compounds in Table 1. In certain embodiments, L is selected from the groups depicted in the compounds in Table 2, below. In certain embodiments, L is selected from the groups depicted in the compounds in Tables 1, 1-A, 2, 2-A, 3, and 4, below.Part D: Additional Embodiments

[0308] Compounds of Formula I and II may be further defined according to the following additional embodiments. For example, in certain embodiments,taken together are one of the following:

[0310] In certain embodiments,selected from the groups depicted in the compounds in Table 1 or 2, below.Exemplary Specific Compounds

[0311] In certain embodiments, the compound is a compound in Table 1 or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 1. In certain embodiments, the compound is a compound in Table 1-A or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 1-A. In certain embodiments, the compound is a compound in Table 1 or 1-A, or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 1 or 1-A.

[0312] In certain embodiments, the compound is a compound in Table 2 or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 2. In certain embodiments, the compound is a compound in Table 2-A or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 2-A. In certain embodiments, the compound is a compound in Table 2 or 2-A, or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 2 or 2-A.

[0313] In certain embodiments, the compound is a compound in Table 3 or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 3. In certain embodiments, the compound is a compound in Table 4 or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 4.

[0314] In certain embodiments, the compound is a compound in Table 1, 1-A, 2, 2-A, 3, or 4, or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 1, 1-A, 2, 2-A, 3, or 4. In certain embodiments, the compound is a compound in Table 1-B or a pharmaceutically acceptable salt thereof. In certain embodiments,the compound is a compound in Table 1 -B. In certain embodiments, the compound is a compound in Table 1 or 2, or a pharmaceutically acceptable salt thereof. In certain embodiments, the compound is a compound in Table 1 or 2.TABLE 1. Exemplary CompoundsTABLE 1-A. Exemplary CompoundsTABLE 1-B. Exemplary CompoundsTABLE 2. Exemplary CompoundsTABLE 2-A. Exemplary CompoundsTable 3. Exemplary CompoundsTable 4. Exemplary CompoundsSynthetic Methods

[0315] Methods for preparing compounds described herein are illustrated in the following synthetic schemes. The schemes are provided for the purpose of illustrating the invention and are not intended to limit the scope or spirit of the invention. Starting materials shown in theschemes can be obtained from commercial sources or can be prepared based on procedures described in the literature.

[0316] In the schemes, it is understood by one skilled in the art of organic synthesis that the functionality present on various portions of the molecule should be compatible with the reagents and reactions proposed. Substituents not compatible with the reaction conditions will be apparent to one skilled in the art, and alternate methods are therefore indicated (for example, use of protecting groups or alternative reactions). Protecting group chemistry and strategy is well known in the art, for example, as described in detail in Protecting Groups in Organic Synthesis, 3rdEdition, T. W. Greene and P. G. M. Wuts, John Wiley & Sons, 1999 and Greene’s Protective Groups in Organic Synthesis, 5th Ed., (Peter G. M. Wuts, John Wiley & Sons: 2014).

[0317] The synthetic route illustrated in Scheme 1-1 is a general method for preparing a tetrahydrofuranyl compound 18, which may be applied with appropriate adjustments to make additional compounds shown in Table 1.Scheme 1-1.frac)

[0318] In step 1 of Scheme 1-1, P-keto ester 1 is converted to a-diazo keto compound 2 via diazo transfer from a diazo transfer agent. In some embodiments, the diazo transfer agent is / -ABSA (4-acetamidobenzenesulfonyl azide). The diazo transfer may be achieved under basic conditions (e.g., 1.2 eq. / ?-ABSA, 1.5 eq. EtsN, CH3CN, 0 °C to RT, 8 h). In step 2, a-diazo keto compound 2 is converted into silyl enol ether intermediate A by treatment with TMSOTf (e.g., 1.2 eq. TMSOTf, 1.4 eq. EtaN, DCM, 0 °C, 30 min). In step 3, silyl enol ether intermediate A is reacted with trifluoromethyl acetone 3 under Lewis Acid conditions (e.g, 1.5 eq. 3, 1.5 eq. TiCL, DCM, -78 °C, 2 h) to provide diazo alcohol 4. In step 4, diazo alcohol 4 is cyclized with Rh(OAc)2 (e.g., toluene, 100 °C, 30 min) to provide a racemic mixture of P-keto ester tetrahydrofuranyl compound 5. In step 5, the P-keto ester tetrahydrofuranyl compound 5 is reacted with triflic anhydride (e.g., Tf O, DIPEA, DCM, -78 °C, 1.5 h) to form silyl enol ether intermediate B. In step 6, silyl enol ether intermediate B is reacted with aryl boronic ester 6 under Suzuki coupling conditions (e.g, Pd(PPha)4, K3PO4, toluene, 100 °C, 2 h) to provide aryl substituted dihydrofuran compound 7. In step 7, removal of the methyl ether from compound 7 (e.g., BBr?, DCM, 0 °C to RT, 2h) and cyclization (TFA, DCM, 45 °C, 12 h) provides a racemic mixture of tricyclic compound 8. In step 8, reductive hydrogenation of compound 8 (e.g., Pd(OH)2 / C, 40 psi H2, MeOH, RT, 24 h) provides phenoxy-substituted tetrahydrofuran compound 9. In step 9, equilibration of phenoxy-substituted tetrahydrofuran compound 9 under basic conditions (e.g, KO- / Bu, THF, RT, 2 h) results in formation of the more favorable epimer and hydrolysis of the methyl ester to provide phenoxy carboxylic acid 10. In step 10, phenoxy carboxylic acid 10 is dimethylated (e.g, CH3I, K2CO3, CH3CN, RT, 12 h) to form anisole methyl ester 11. In step 11, saponification of anisole methyl ester 11 (e.g., LiOH, H2O, MeOH, 12 h) provides carboxylic acid intermediate C. In step 12, carboxylic acid intermediate C is converted to amide intermediate 13 by reaction with amino pyridinyl methyl ester 12 (e.g, oxalyl chloride, DCM, DMF, EtsN). At this stage, amide intermediate 13 may be purified (e.g., via supercritical fluid chromatography or SFC) if desired. In step 13, amide intermediate 13 is saponified (e.g, LiOH, H2O, MeOH, RT, 8 h) to provide pyridinyl carboxylic acid compound 14. In step 14, pyridinyl carboxylic acid compound 14 is converted to amide 15 by reaction with mono-protected a,co- diamino compound 16 (e.g, HATU, DIPEA) followed by BOC deprotection (e.g, HC1, dioxane). Finally, in step 15, amide 15 is reacted with (17?,4r)-4-(4-(((15',4A)-4-(2-((25',35)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyl)oxy)butanamido) cyclohexane-l-carboxylic acid 17 (e.g., HATU, DIPEA) to form compound 18.

[0319] The synthetic route illustrated in Scheme 1-2 is a general method for preparing a tetrahydrofuranyl compound 26, which may be applied with appropriate adjustments to make additional compounds shown in Table 1.Scheme 1-2.

[0320] In step 1 of Scheme 1-2, silyl enol ether intermediate B, which may be synthesized as described above in reference to Scheme 1-1, is reacted with aryl boronic ester 19 under Suzuki coupling conditions (e.g., Pd(PPh3)4, K3PO4, toluene, 100 °C, 6 h) to provide aryl substituted dihydrofuran compound 20. In step 2, hydrogenation of aryl substituted dihydrofuran compound 20 (e.g., Pd(OH)2 / C, 60 psi H2, EtOH, RT, 24 h) provides aryl-substituted tetrahydrofuran compound 21. In step 3, equilibration of aryl-substituted tetrahydrofuran compound 21 under basic conditions (e.g., KO- / Bu, THF, RT, 2 h) results in formation of the more favorable epimer and hydrolysis of the ethyl ester to provide aryl-substituted tetrahydrofuranyl carboxylic acid 22. In step 4, aryl-substituted tetrahydrofuranyl carboxylic acid 22 is converted to pyridinyl methyl ester-amide intermediate 23 by reaction with amino pyridinyl methyl ester 12 (e.g., propanephosphonic acid anhydride aka T3P, EtOAc, 70 °C, 12 h). In step 5, ammonolyis of pyridinyl methyl ester-amide intermediate 23 (e.g., 7N NH3, MeOH) provides BOC-protected pyridinyl amide 24. At this stage, BOC-protected pyridinyl amide 24 may be purified (e.g., via SFC) if desired. In step 6, BOC-protected pyridinyl amide 24 is deprotected (e.g., TFA, DCM, RT) to form amino compound 25. Finally, in step 7, amino compound 25 is reacted with (lA,4r)-4-(4-(((lS,4A)-4-(2-((25,35Y)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy) cyclohexyl)oxy) butanamido) cyclohexane-1 -carboxylic acid 17 (e.g, HATU, DMF, RT) to form the compound 26.

[0321] The synthetic route illustrated in Scheme 1-3 is a general method for preparing a tetrahydrofuranyl compound 29, which may be applied with appropriate adjustments to make additional compounds shown in Table 1.Scheme 1-3.COOM

[0322] In step 1 of Scheme 1-3, ammonolyis (e.g., 7N NH3, MeOH, RT, 12 h) of amide intermediate 13, which may be synthesized as described above in reference to Scheme 1-1, provides pyridinyl amide compound 27. In step 2, pyridinyl amide compound 27 is converted toamino compound 28 by (a) converting the methyl ether to a phenol (e.g, BBn), (b) performing a Mitsunobu reaction with a BOC-protected alcohol (e.g., PPh3, DEAD), and (c) removing the BOC protecting group (e.g., HC1, dioxane). Finally, in step 3, amino compound 28 is reacted with (17?,4r)-4-(4-(((l<S',4J?)-4-(2-((25,35)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3- carboxamido)ethoxy)cyclohexyl)oxy)butanamido) cyclohexane- 1 -carboxylic acid 17 (e.g., HATU, DIPEA, DMF, RT) to form compound 29.

[0323] The synthetic route illustrated in Scheme 1-4 is a general method for preparing a tetrahydrofuranyl compound 34, which may be applied with appropriate adjustments to make additional compounds shown in Table 1.Scheme 1-4.

[0324] In step 1 of Scheme 1-4, pyridinyl methyl ester 12 is alkylated with BOC-protected amino bromo compound 30 to provide BOC-protected pyridinyl methyl ester 31. In step 2, BOC-protected pyridinyl methyl ester 31 is reacted with carboxylic acid intermediate C (e.g., oxalyl chloride, DCM, DMF, EtsN) to form BOC-protected anisole pyridinyl methyl ester 32. Carboxylic acid intermediate C may be synthesized as described above in reference to Scheme 1- 1. At this stage, BOC-protected anisole pyridinyl methyl ester 32 may be purified (e.g., via SFC) if desired. In steps 3 and 4, ammonolyis of BOC-protected anisole pyridinyl methyl ester 32 e.g., 7N NH3, MeOH) followed by removal of the BOC-protecting group (e.g, TFA, DCM, RT) provides the amino compound 33. Finally, in step 5, amino compound 33 is reacted with (17?,4r)-4-(4-(((lS,47?)-4-(2-((25,3))-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3- carboxamido)ethoxy)cyclohexyl)oxy) butanamido) cyclohexane- 1 -carboxylic acid 17 (e.g, HATU, DMF, RT) to form the compound 34.

[0325] The synthetic route illustrated in Scheme 2-1 is a general method for preparing a trifluoromethyl-substituted pyridinyl compound 40, which may be applied with appropriate adjustments to make additional compounds shown in Table 2.Scheme 2-1.40

[0326] In step 1 of Scheme 2-1, trifluoromethyl-substituted pyridinyl carboxylic acid 35 is reacted with imino-sulfanone 36 (e.g., HATU, DIPEA) to form amide intermediate 37. In step 2, amide intermediate 37 is converted to alkyl amino compound 39 by (a) converting the methyl ether to a phenol (e.g., BBn, DCM), (b) performing a Mitsunobu reaction with a pthalamide- protected amine compound 38 (e.g., PPhs, DEAD), and (c) removing the pthalamide protecting group (e.g., hydrazine). Finally, in step 3, alkyl amino compound 39 is reacted with (U?,4r)-4- (4-(((lS,47?)-4-(2-((2lS’,3S)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyljoxy) butanamido) cyclohexane-1 -carboxylic acid 17 (e.g., HATU, DIPEA) to form the compound 40.

[0327] The synthetic route illustrated in Scheme 2-2 is a general method for preparing a trifluoromethyl-substituted pyridinyl compound 46, which may be applied with appropriate adjustments to make additional compounds shown in Table 2.Scheme 2-2.Step 3

[0328] In step 1 of Scheme 2-2, trifluoromethyl-substituted chloro-pyridinyl carboxylic acid 41 is reacted with BOC-protected imino-sulfanone 42 (e.g., HATU, DIPEA) to form aryl amide intermediate 43. In step 2, aryl amide intermediate 43 is reacted with fluoro-substituted phenol 44 under Stille-type coupling conditions (e.g., SnAr) followed by removal of the BOC protecting group (e.g., HC1, dioxane) to form phenoxy-substituted pyridinyl amino compound 45. Finally, in step 3, phenoxy-substituted pyridinyl amino compound 45 is reacted with (17?,4r)-4-(4- (((15,4J?)-4-(2-((25,35)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy) cyclohexyl)oxy)butanamido)cyclohexane-l-carboxylic acid 17 (e.g., HATU, DIPEA) to form the compound 46.

[0329] The synthetic route illustrated in Scheme 3-1 is a general method for preparing compound 51, which may be applied with appropriate adjustments to make additional compounds shown in Table 4.Scheme 3-1.

[0330] In step 1 of Scheme 3-1, compound 47 is reacted with compound 48 under standard conditions (e.g., amine 48, MeOH, THF) to give amide 49. In step 2, the Boc group is removed under acidic conditions (e.g., HC1, dioxane) to give compound 50, which is then coupled with compound 17 under standard peptide coupling conditions (e.g., HATU, DIPEA, DMF) to give compound 51.

[0331] The synthetic route illustrated in Scheme 3-2 is a general method for preparing compound 58, which may be applied with appropriate adjustments to make additional compounds shown in Table 4.Scheme 3-2.

[0332] In step 1 of Scheme 3-2, compound 52 is reacted with compound 53 under S\Ar conditions (e.g., potassium carbonate, DMF) to give compound 54. In step 2, a cross-coupling between compound 54 and compound 55 (e.g., bis(tri-tert-butylphosphine)palladium, tris(dibenzylideneacetone)dipalladium, KF, THF) gives compound 56. The Boc group is then removed under acidic conditions (e.g., HC1, dioxane) to give compound 57, which is then coupled with compound 17 under standard peptide coupling conditions (e.g., HATU, DIPEA, DMF) to give compound 58.

[0333] The synthetic route illustrated in Scheme 3-3 is a general method for preparing compound 69, which may be applied with appropriate adjustments to make additional compounds shown in Table 2.Scheme 3-3,Step 7

[0334] In step 1 of Scheme 3-3, compound 59 is coupled with compound 60 under standard peptide coupling conditions (e.g., HATU, DIPEA, DMF) to give compound 61. In step 2, compound 61 is coupled to compound 62 using SxAr conditions (e.g., potassium carbonate, DMF) to give compound 63. Compound 63 is subjected to demethylation conditions (e.g., BBrs) followed by an O-alkylation using compound 65 (e.g., CH3CN, heat) to give compound 66. In step 5, compound 66 is oxidized (e.g., m-CPBA) to give V-oxide 67. The Boc group is then removed under acidic conditions (e.g., HC1, dioxane) to give compound 68, which is then coupled with compound 17 under standard peptide coupling conditions (e.g., HATU, DIPEA, DMF) to give compound 69.

[0335] The modular synthetic route illustrated in the Schemes can be adjusted to provide additional compounds by conducting functional group transformations on the intermediate and final compounds. Such functional group transformations are well known in the art, as described in, for example, Comprehensive Organic Synthesis (B.M. Trost & I. Fleming, eds., 1991-1992); Organic Synthesis, 3rdEd. (Michael B. Smith, Wavefunction, Inc., Irvine: 2010); Modern Methods of Organic Synthesis, 4thEd. (William Carruthers and Iain Coldham, Cambridge University Press, Cambridge: 2004); March 's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, 8thEd., (Michael B. Smith, John Wiley & Sons, New York: 2020); and Comprehensive Organic Transformations: A Guide to Functional Group Preparations, 3rd Ed. (Richard C. Larock, ed., John Wiley & Sons, New York: 2018).II. Anti-cotinine Antibody

[0336] Also provided is an antibody, or antigen-binding fragment thereof, that binds to a cotinine moiety. As used herein, the term “anti-cotinine antibody or antigen-binding fragmentthereof’ refers to an antibody, or antigen binding fragment thereof that binds to a cotinine moiety. Cotinine has the following structure:

[0337] As used herein, the term “cotinine moiety” refers to cotinine or an analog of cotinine. Compounds of Formula (I) and (II) described herein comprise a cotinine moiety linked via a linker to a Navl .8-binding moiety. In certain embodiments, the cotinine moiety has the following structure:wherein R1is Ci-4 alkyl or C3.6 cycloalkyl. In certain embodiments, R1is methyl, ethyl, 1-propyl, 2-propyl, 1-butyl, 2-butyl, or t-butyl. In certain embodiments, R1is methyl. In certain embodiments, R1is cyclopropyl, cyclobutyl, cyclopentyl, or cyclohexyl.

[0338] The term “antibody” is used herein in the broadest sense to refer to molecules with an immunoglobulin-like domain (for example IgG, IgM, IgA, IgD or IgE) and includes monoclonal, recombinant, polyclonal, chimeric, human, humanised, multispecific antibodies, including bispecific antibodies, and heteroconjugate antibodies; a single variable domain (e.g., a domain antibody (DAB)), antigen binding antibody fragments, Fab, F(ab’)2, Fv, disulphide linked Fv, single chain Fv, disulphide-linked scFv, diabodies, TANDABS, etc. and modified versions of any of the foregoing (for a summary of alternative “antibody” formats see Holliger and Hudson, Nature Biotechnology, 2005, 23(9): 1126-1136).

[0339] The term, full, whole or intact antibody, used interchangeably herein, refers to a heterotetrameric glycoprotein with an approximate molecular weight of 150,000 daltons. An intact antibody is composed of two identical heavy chains (HCs) and two identical light chains (LCs) linked by covalent disulphide bonds. This H2L2 structure folds to form three functionaldomains comprising two antigen-binding fragments, known as ‘Fab’ fragments, and a ‘Fc’ crystallisable fragment. The Fab fragment is composed of the variable domain at the amino- terminus, variable heavy (VH) or variable light (VL), and the constant domain at the carboxyl terminus, CHI (heavy) and CL (light). The Fc fragment is composed of two domains formed by dimerization of paired CH2 and CH3 regions. The Fc may elicit effector functions by binding to receptors on immune cells or by binding Clq, the first component of the classical complement pathway. The five classes of antibodies IgM, IgA, IgG, IgE and IgD are defined by distinct heavy chain amino acid sequences, which are called p, a, y, e and 5 respectively, each heavy chain can pair with either a K or X light chain. The majority of antibodies in the serum belong to the IgG class, there are four isotypes of human IgG (IgGl, IgG2, IgG3 and IgG4), the sequences of which differ mainly in their hinge region.

[0340] “CDRs” are defined as the complementarity determining region amino acid sequences of an antibody or antigen binding fragment thereof. These are the hypervariable regions of immunoglobulin heavy and light chains. There are three heavy chain and three light chain CDRs (or CDR regions) in the variable portion of an immunoglobulin. Thus, “CDRs” as used herein refers to all three heavy chain CDRs, all three light chain CDRs, all heavy and light chain CDRs, or at least two CDRs.

[0341] Throughout this specification, amino acid residues in variable domain sequences and variable domain regions within full-length antigen binding sequences, e.g. within an antibody heavy chain sequence or antibody light chain sequence, are numbered according to the Kabat numbering convention. Similarly, the terms “CDR”, “CDRL1”, “CDRL2”, “CDRL3”, “CDRH1”, “CDRH2”, “CDRH3” used in the Examples follow the Kabat numbering convention. For further information, see Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987).

[0342] It will be apparent to those skilled in the art that there are alternative numbering conventions for amino acid residues in variable domain sequences and full-length antibody sequences. There are also alternative numbering conventions for CDR sequences, for example those set out in Chothia et al., Nature, 1989, 342: 877-883. The structure and protein folding of the antigen binding protein may mean that other residues are considered part of the CDR sequence and would be understood to be so by a skilled person.

[0343] Other numbering conventions for CDR sequences available to a skilled person include “AbM” (University of Bath) and “contact” (University College London) methods.

[0344] Table 3 below represents one definition using each numbering convention for each CDR or binding unit. It should be noted that some of the CDR definitions may vary depending on the individual publication used.Table 3.

[0345] In a further embodiment, the anti-cotinine antibody is humanized. In a further embodiment, the Fc region of the anti-cotinine antibody is modified to increase ADCC activity, ADCP activity, and / or CDC activity, suitable modifications of which are provided below. In a further embodiment, the Fc region of the anti-cotinine antibody is modified to increase ADCC activity.

[0346] Fc engineering methods can be applied to modify the functional or pharmacokinetics properties of an antibody. Effector function may be altered by making mutations in the Fc region that increase or decrease binding to Clq or Fey receptors and modify CDC or ADCC activity respectively. Modifications to the glycosylation pattern of an antibody can also be made to change the effector function. The in vivo half-life of an antibody can be altered by making mutations that affect binding of the Fc to the FcRn (neonatal Fc receptor).

[0347] The term “effector function” as used herein refers to one or more of antibody- mediated effects including antibody-dependent cell-mediated cytotoxicity (ADCC), antibody- mediated complement activation including complement-dependent cytotoxicity (CDC), complement-dependent cell-mediated phagocytosis (CDCP), antibody dependent complement- mediated cell lysis (ADCML), and Fc-mediated phagocytosis or antibody-dependent cellular phagocytosis (ADCP).

[0348] The interaction between the Fc region of an antigen binding protein or antibody and various Fc receptors (FcR), including FcyRI (CD64), FcyRII (CD32), FcyRIII (CD 16), FcRn, Clq, and type II Fc receptors is believed to mediate the effector functions of the antigen binding protein or antibody. Significant biological effects can be a consequence of effector functionality. Usually, the ability to mediate effector function requires binding of the antigen binding protein or antibody to an antigen and not all antigen binding proteins or antibodies will mediate every effector function.

[0349] Effector function can be assessed in a number of ways including, for example, evaluating ADCC effector function of antibody coated to target cells mediated by Natural Killer (NK) cells via FcyRIII, or monocytes / macrophages via FcyRI, or evaluating CDC effector function of antibody coated to target cells mediated by complement cascade via Clq. For example, an antibody, or antigen binding fragment thereof, of the present invention can be assessed for ADCC effector function in a Natural Killer cell assay. Examples of such assays can be found in Shields et al., The Journal of Biological Chemistry, 2001, 276: 6591-6604; Chappel et al., The Journal of Biological Chemistry, 1993, 268: 25124-25131; Lazar et al., PNAS, 2006, 103: 4005-4010.

[0350] Examples of assays to determine CDC function include those described in J Imm Meth, 1995, 184: 29-38.

[0351] The effects of mutations on effector functions (e.g., FcRn binding, FcyRs and Clq binding, CDC, ADCML, ADCC, ADCP) can be assessed, e.g., as described in Grevys et al., J Immunol., 2015,194(11): 5497-5508; Tam et al., Antibodies, 2017, 6(3): 12; or Monnet et al., mAbs, 2014, 6(2): 422-436.

[0352] Throughout this specification, amino acid residues in Fc regions, in antibody sequences or full-length antigen binding protein sequences, are numbered according to the EU index numbering convention.

[0353] Human IgGl constant regions containing specific mutations have been shown to enhance binding to Fc receptors. In some cases these mutations have also been shown to enhance effector functions, such as ADCC and CDC, as described below. Antibodies, or antigen binding fragments thereof, of the present invention may include any of the following mutations.

[0354] Enhanced CPC: Fc engineering can be used to enhance complement-based effector function. For example (with reference to IgGl), K326W / E333S; S267E / H268F / S324T; and IgGl / IgG3 cross subclass can increase Clq binding; E345R (Diebolder et al., Science, 2014, 343: 1260-1293) and E345R / E430G / S440Y results in preformed IgG hexamers (Wang et al., Protein Cell, 2018, 9(1): 63-73).

[0355] Enhanced ADCC: Fc engineering can be used to enhance ADCC. For example (with reference to IgGl), F243L / R292P / Y300L / V305VP396L; S239D / 1332E; and S298A / E333A / K334A increase FcyRIIIa binding; S239D / I332E / A330L increases FcyRIIIa binding and decreases FcyRIIb binding; G236A / S239D / I332E improves binding to FcyRIIa, improves the FcyRIIa / FcyRIIb binding ratio (activating / inhibitory ratio), and enhances phagocytosis of antibody-coated target cells by macrophages. An asymmetric Fc in which one heavy chain contains L234Y / L235Q / G236W / S239M / H268D / D270E / S298A mutations and D270E / K326D / A330M / K334E in the opposing heavy chain, increases affinity for FcyRIIIa F158 (a lower-affinity allele) and FcyRIIIa V158 (a higher-affinity allele) with no increased binding affinity to inhibitory FcyRIIb (Mimoto et al., mAbs, 2013, 5(2): 229-236).

[0356] Enhanced ADCP: Fc engineering can be used to enhance ADCP. For example (with reference to IgGl), G236A / S239D / I332E increases FcyRIIa binding and increases FcyRIIIa binding (Richards, J. et al., Mol. Cancer Ther., 2008, 7: 2517-2527).

[0357] Increased co-engagement: Fc engineering can be used to increase co-engagement with FcRs. For example (with reference to IgGl), S267E / L328F increases FcyRIIb binding;N325S / L328F increases FcyRIIa binding and decreases FcyRIIIa binding Wang et al., Protein Cell, 2018, 9(1): 63-73).

[0358] In a further embodiment, an antibody, or antigen binding fragment thereof, of the present invention may comprise a heavy chain constant region with an altered glycosylation profile, such that the antibody, or antigen binding fragment thereof, has an enhanced effector function, e.g., enhanced ADCC, enhanced CDC, or both enhanced ADCC and CDC. Examples of suitable methodologies to produce an antibody, or antigen binding fragment thereof, with an altered glycosylation profile are described in WO 2003 / 011878, WO 2006 / 014679 and EP1229125.

[0359] The absence of the al, 6 innermost fucose residues on the Fc glycan moiety on N297 of IgGl antibodies enhances affinity for FcyRIIIA. As such, afucosylated or low fucosylated monoclonal antibodies may have increased therapeutic efficacy (Shields et al., J Biol Chem., 2002, 277(30): 26733-40 and Monnet et al., mAbs, 2014, 6(2): 422-436).

[0360] In certain embodiments there is provided an antibody, or antigen binding fragment thereof, comprising a chimeric heavy chain constant region. In an embodiment, the antibody, or antigen binding fragment thereof, comprises an IgGl / IgG3 chimeric heavy chain constant region, such that the antibody, or antigen binding fragment thereof, has an enhanced effector function, for example enhanced ADCC or enhanced CDC, or enhanced ADCC and CDC functions. For example, a chimeric antibody, or antigen binding fragment thereof, of the invention may comprise at least one CH2 domain from IgG3. In one such embodiment, the antibody, or antigen binding fragment thereof, comprises one CH2 domain from IgG3 or both CH2 domains may be from IgG3. In a further embodiment, the chimeric antibody, or antigen binding fragment thereof, comprises an IgGl CHI domain, an IgG3 CH2 domain, and an IgG3 CH3 domain. In a further embodiment, the chimeric antibody, or antigen binding fragment thereof, comprises an IgGl CHI domain, an IgG3 CH2 domain, and an IgG3 CH3 domain except for position 435 that is histidine.

[0361] In a further embodiment, the chimeric antibody, or antigen binding fragment thereof, comprises an IgGl CHI domain and at least one CH2 domain from IgG3. In an embodiment, the chimeric antibody, or antigen binding fragment thereof, comprises an IgGl CHI domain and the following residues, which correspond to IgG3 residues, in a CH2 domain: 274Q, 276K, 296F, 300F and 339T. In an embodiment, the chimeric antibody, or antigen binding fragment thereof, also comprises 356E, which corresponds to an IgG3 residue, within a CH3 domain. In an embodiment, the antibody, or antigen binding fragment thereof, also comprises one or more of the following residues, which correspond to IgG3 residues within a CH3 domain: 358M, 384S, 392N, 397M, 4221, 435R, and 436F.

[0362] Also provided is a method of producing an antibody, or antigen binding fragment thereof, according to the invention comprising the steps of: a) culturing a recombinant host cell comprising an expression vector comprising a nucleic acid sequence encoding a chimeric Fc region having both IgGl and IgG3 Fc region aminoacid residues (e g. as described above); and b) recovering the antibody, or antigen binding fragment thereof.

[0363] Such methods for the production of antibody, or antigen binding fragment thereof, with chimeric heavy chain constant regions can be performed, for example, using the COMPLEGENT technology system available from BioWa, Inc. (Princeton, NJ) and Kyowa Hakko Kirin Co., Ltd. The COMPLEGENT system comprises a recombinant host cell comprising an expression vector in which a nucleic acid sequence encoding a chimeric Fc region having both IgGl and IgG3 Fc region amino acid residues is expressed to produce an antibody, or antigen binding fragment thereof, having enhanced CDC activity, i.e. CDC activity is increased relative to an otherwise identical antibody, or antigen binding fragment thereof, lacking such a chimeric Fc region, as described in WO 2007 / 011041 and US 2007 / 0148165, each of which are incorporated herein by reference. In an alternative embodiment, CDC activity may be increased by introducing sequence specific mutations into the Fc region of an IgG chain. Those of ordinary skill in the art will also recognize other appropriate systems.

[0364] Also provided is a method of producing an antibody, or antigen binding fragment thereof, according to the invention comprising the steps of: a) culturing a recombinant host cell comprising an expression vector comprising a nucleic acid encoding the antibody, or antigen binding fragment thereof, optionally wherein the FUT8 gene encoding alpha- 1 ,6-fucosyltransferase has been inactivated in the recombinant host cell; and b) recovering the antibody, or antigen binding fragment thereof.

[0365] Such methods for the production of an antibody, or antigen binding fragment thereof, can be performed, for example, using the POTELLIGENT technology system available from BioWa, Inc. (Princeton, NJ) in which CHOK1SV cells lacking a functional copy of the FUT8 gene produce monoclonal antibodies having enhanced ADCC activity that is increased relative to an identical monoclonal antibody produced in a cell with a functional FUT8 gene as described in US Patent No. 7,214,775, US Patent No. 6,946,292, WO 00 / 61739 and WO 02 / 31240, all of which are incorporated herein by reference. Those of ordinary skill in the art will also recognize other appropriate systems.

[0366] In certain embodiments, the antibody, or antigen binding fragment thereof, is produced in a host cell in which the FUT8 gene has been inactivated. In a further embodiment, the antibody, or antigen binding fragment thereof, is produced in a - / - FUT8 host cell. In a further embodiment, the antibody, or antigen binding fragment thereof, is afucosylated at Asn297 (IgGl).

[0367] It will be apparent to those skilled in the art that such modifications may not only be used alone but may be used in combination with each other in order to further enhance effector function.

[0368] In one such embodiment, there is provided an antibody, or antigen binding fragment thereof, comprising a heavy chain constant region that comprises a both a mutated and chimeric heavy chain constant region, individually described above. For example, an antibody, or antigen binding fragment thereof, comprising at least one CH2 domain from IgG3 and one CH2 domain from IgGl, and wherein the IgGl CH2 domain has one or more mutations at positions selected from 239, 332 and 330 (for example the mutations may be selected from S239D, I332E and A330L), such that the antibody, or antigen binding fragment thereof, has enhanced effector function, e.g. enhanced ADCC or enhanced CDC, or enhanced ADCC and enhanced CDC in comparison to an equivalent antibody, or antigen binding fragment thereof, with an IgGl heavy chain constant region lacking said mutations. In certain embodiments, the IgGl CH2 domain has the mutations S239D and I332E. In certain embodiments, the IgGl CH2 domain has the mutations S239D, A330L, and I332E.

[0369] In an alternative embodiment, there is provided an antibody, or antigen binding fragment thereof, comprising both a chimeric heavy chain constant region and an altered glycosylation profile, as individually described above. In an embodiment, the antibody, or antigen binding fragment thereof, comprises an altered glycosylation profile such that the ratio of fucose to mannose is 0.8:3 or less. In one such embodiment, the heavy chain constant region comprises at least one CH2 domain from IgG3 and one CH2 domain from IgGl and has an altered glycosylation profile such that the ratio of fucose to mannose is 0.8:3 or less, for example wherein the antibody, or antigen binding fragment thereof, is defucosylated. Said antibody, or antigen binding fragment thereof, has an enhanced effector function, e.g. enhanced ADCC or enhanced CDC, or enhanced ADCC and enhanced CDC, in comparison to an equivalentantibody, or antigen binding fragment thereof, with an IgGl heavy chain constant region lacking said glycosylation profde.

[0370] In an alternative embodiment, the antibody, or antigen binding fragment thereof, has at least one IgG3 heavy chain CH2 domain and at least one heavy chain constant domain from IgGl wherein both IgG CH2 domains are mutated in accordance with the limitations described herein.

[0371] In one aspect, there is provided a method of producing an antibody, or antigen binding fragment thereof, according to the invention described herein comprising the steps of: a) culturing a recombinant host cell containing an expression vector comprising a nucleic acid sequence encoding a chimeric Fc domain having both IgGl and IgG3 Fc domain amino acid residues (e g. as described above); and wherein the FUT8 gene encoding alpha- 1,6-fucosyltransferase has been inactivated in the recombinant host cell; and b) recovering the antibody, or antigen binding fragment thereof.

[0372] Such methods for the production of an antibody, or antigen binding fragment thereof, can be performed, for example, using the ACCRETAMAB technology system available from BioWa, Inc. (Princeton, NJ) that combines the POTELLIGENT and COMPLEGENT technology systems to produce an antibody, or antigen binding fragment thereof, having both enhanced ADCC and CDC activity relative to an otherwise identical monoclonal antibody that lacks a chimeric Fc domain and that is fucosylated.

[0373] In certain embodiments, there is provided an antibody, or antigen binding fragment thereof, comprising a mutated and chimeric heavy chain constant region wherein said antibody, or antigen binding fragment thereof, has an altered glycosylation profde such that the antibody, or antigen binding fragment thereof, has enhanced effector function, e.g. enhanced ADCC or enhanced CDC, or both enhanced ADCC and CDC. In certain embodiments the mutations are selected from positions 239, 332 and 330, e.g. S239D, I332E and A33OL. In a further embodiment the heavy chain constant region comprises at least one CH2 domain from IgG3 and one CHI domain from IgGl. In certain embodiments the heavy chain constant region has an altered glycosylation profde such that the ratio of fucose to mannose is 0.8:3 or less, e.g. the antibody, or antigen binding fragment thereof, is defucosylated, such that said antibody, orantigen binding fragment thereof, has an enhanced effector function in comparison with an equivalent non-chimeric antibody, or antigen binding fragment thereof, lacking said mutations and lacking said altered glycosylation profile.

[0374] In a further embodiment, the anti-cotinine antibody, or antigen binding fragment thereof, comprises a heavy chain CDR1 having SEQ ID NO: 1, a heavy chain CDR2 having SEQ ID NO: 2, a heavy chain CDR3 having SEQ ID NO: 3, a light chain CDR1 having SEQ ID NO: 4, a light chain CDR2 having SEQ ID NO: 5, and a light chain CDR3 having SEQ ID NO: 6. In a further embodiment, the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, and a CDR3 having SEQ ID NO: 3, and the light chain comprising a CDR1 having SEQ ID NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6. In a further embodiment, the anti- cotinine antibody is of IgGl isotype. In a further embodiment, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase or enhance ADCC activity. In a further embodiment, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase or enhance ADCC activity, wherein the substitution is S239D / I332E or S239D / I332E / A330L, wherein residue numbering is according to the EU Index. In a further embodiment, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase or enhance ADCC activity, wherein the substitution is S239D / I332E, wherein residue numbering is according to the EU Index.

[0375] In a further embodiment, the anti-cotinine antibody, or antigen binding fragment thereof, comprises a heavy chain variable region (VH) having SEQ ID NO: 7, a light chain variable region (VL) having SEQ ID NO: 8. In a further embodiment, the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8. In a further embodiment, the anti-cotinine antibody is of IgGl isotype. In a further embodiment, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase or enhance ADCC activity. In a further embodiment, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase or enhance ADCC activity, wherein the substitution is S239D / I332E or S239D / I332E / A330L, wherein residue numbering is according to the EU Index. In a further embodiment, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase or enhanceADCC activity, wherein the substitution is S239D / I332E, wherein residue numbering is according to the EU Index.

[0376] In a further embodiment, the anti-cotinine antibody has a heavy chain comprising SEQ ID NO: 9 and a light chain comprising SEQ ID NO: 10.

[0377] Also provided is a pharmaceutical composition comprising an anti-cotinine antibody, or antigen binding fragment thereof as disclosed herein, and a pharmaceutically acceptable excipient, carrier, or diluent.

[0378] Also provided is a combination comprising a heterobifunctional compound described herein (e.g., a compound of Formula (I) or (II)), and an anti-cotinine antibody, or antigen- binding fragment thereof as disclosed herein. The heterobifunctional compound and anti- cotinine antibody, or antigen binding fragment thereof can be present in the same composition or in separate compositions. In certain embodiments, a combination comprises a pharmaceutical composition comprising a heterobifunctional compound (e.g., a compound of Formula (I) or (II)) and an anti-cotinine antibody, or antigen binding fragment thereof as disclosed herein, and a pharmaceutically acceptable carrier, diluent, or excipient. In certain embodiments, a combination comprises a first pharmaceutical composition comprising a heterobifunctional compound (e.g., a compound of Formula (I) or (II)) and a pharmaceutically acceptable carrier, diluent, or excipient; and a second pharmaceutical composition comprising an anti-cotinine antibody or antigen binding fragment thereof as disclosed herein, and a pharmaceutically acceptable carrier, excipient, or diluent.

[0379] The heterobifunctional compounds (e.g., a compound of Formula (I) or (II)) and pharmaceutically acceptable salts thereof are capable of simultaneously binding a cell surface- expressed Nav1.8 and an anti-cotinine antibody, or antigen binding fragment thereof to form a ternary complex for the treatment and / or prevention of diseases or disorders associated with Nav1.8 -expressing cells.

[0380] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered simultaneously. In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered simultaneously from a single composition, including as a fixed-dose composition or by pre-mixing the compound and the antibody, or antigen-binding fragment thereof, prior to administration. For example, thecompound and the antibody, or antigen-binding fragment thereof, can be pre-mixed about 2 seconds to about 30 seconds, about 30 seconds to about 2 minutes, about 2 minutes to about 10 minutes, about 10 minutes to about 30 minutes, or about 30 minutes to about 2 hours prior to administration. In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered simultaneously from two separate compositions.

[0381] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered sequentially.

[0382] In certain embodiments, the compound and the antibody, or antigen-binding fragment thereof, whether administered simultaneously or sequentially, may be administered by the same route or may be administered by different routes. In certain embodiments, the compound and the antibody, or antigen-binding fragment thereof, are both administered intraveneously or subcutaneously, in the same composition or in separate compositions. In certain embodiments, the compound is administered orally and the antibody or antigen-binding fragment thereof is administered intravenously or subcutaneously.

[0383] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered in a molar ratio of compound to antibody, or antigen-binding fragment thereof, of about 2:1, about 1.8:1, about 1.6:1, about 1.5:1, about 1.4:1, about 1.3:1, about 1.2:1, about 1:1, about 1:1.2, about 1:1.3, about 1:1.4, about 1:1.5, about 1:1.6, about 1:1.8, about 1:2, about2:l to about 1.5:1, about 1.5:1 to about 1.2:1, about 1.2:1 to about 1:1, about 1:1 to about 1:1.2, about 1 : 1.2 to about 1 : 1.5, or about 1 : 1.5 to about 1 :2.

[0384] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are present as a combination in a molar ratio of compound to antibody, or antigen- binding fragment thereof, of about 2:1, about 1.8:1, about 1.6:1, about 1.5:1, about 1.4:1, about 1.3:1, about 1.2:1, about 1:1, about 1:1.2, about 1:1.3, about 1:1.4, about 1:1.5, about 1:1.6, about 1:1.8, about 1:2, about 2:1 to about 1.5:1, about 1.5:1 to about 1.2:1, about 1.2:1 to about 1:1, about 1 : 1 to about 1:1.2, about 1 : 1.2 to about 1:1.5, or about 1 : 1.5 to about 1 :2.

[0385] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered at a dosage of compound of 0.0001 mg / kg to 1 mg / kg and antibody of 0.01 mg / kg to 100 mg / kg. For example, in a further embodiment, the compound is administered at a dosage of about 0.0001 mg / kg to about 0.0002 mg / kg, about 0.0002 mg / kg to about 0.0003mg / kg, about 0.0003 mg / kg to about 0.0004 mg / kg, about 0.0004 mg / kg to about 0.0005 mg / kg, about 0.0005 mg / kg to about 0.001 mg / kg, about 0.001 mg / kg to about 0.002 mg / kg, about 0.002 mg / kg to about 0.003 mg / kg, about 0.003 mg / kg to about 0.004 mg / kg, about 0.004 mg / kg to about 0.005 mg / kg, about 0.005 mg / kg to about 0.01 mg / kg, about 0.01 mg / kg to about 0.02 mg / kg, about 0.02 mg / kg to about 0.03 mg / kg, about 0.03 mg / kg to about 0.04 mg / kg, about 0.04 mg / kg to about 0.05 mg / kg, about 0.05 mg / kg to about 0. 1 mg / kg, about 0.1 mg / kg to about 0.2 mg / kg, about 0.2 mg / kg to about 0.3 mg / kg, about 0.3 mg / kg to about 0.4 mg / kg, about 0.4 mg / kg to about 0.5 mg / kg, and / or about 0.5 mg / kg to about 1 mg / kg, and the antibody, or antigen-binding fragment thereof, is administered at a dosage of about 0.01 mg / kg to about 0.02 mg / kg, about 0.02 mg / kg to about 0.03 mg / kg, about 0.03 mg / kg to about 0.04 mg / kg, about 0.04 mg / kg to about 0.05 mg / kg, about 0.05 mg / kg to about 0.1 mg / kg, about 0.1 mg / kg to about 0.2 mg / kg, about 0.2 mg / kg to about 0.3 mg / kg, about 0.3 mg / kg to about 0.4 mg / kg, about 0.4 mg / kg to about 0.5 mg / kg, about 0.5 mg / kg to about 1 mg / kg, about 1 mg / kg to about 2 mg / kg, about 2 mg / kg to about 3 mg / kg, about 3 mg / kg to about 4 mg / kg, about 4 mg / kg to about 5 mg / kg, about 5 mg / kg to about 10 mg / kg, about 10 mg / kg to about 15 mg / kg, about 15 mg / kg to about 20 mg / kg, about 20 mg / kg to about 25 mg / kg, about 25 mg / kg to about 30 mg / kg, about 30 mg / kg to about 35 mg / kg, about 35 mg / kg to about 40 mg / kg, about 40 mg / kg to about 45 mg / kg, about 45 mg / kg to about 50 mg / kg, about 50 mg / kg to about 60 mg / kg, about 60 mg / kg to about 70 mg / kg, about 70 mg / kg to about 80 mg / kg, about 80 mg / kg to about 90 mg / kg, and / or about 90 mg / kg to about 100 mg / kg.

[0386] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered at a dosage of compound of 0.007 mg to 70 mg and antibody of 0.7 mg to 7000 mg. For example, in a further embodiment, the compound is administered at a dosage of about 0.007 mg to about 0.01 mg, about 0.01 mg to about 0.02 mg, about 0.02 mg to about 0.03 mg, about 0.03 mg to about 0.04 mg, about 0.04 mg to about 0.05 mg, about 0.05 mg to about 0.1 mg, about 0.1 mg to about 0.2 mg, about 0.2 mg to about 0.3 mg, about 0.3 mg to about 0.4 mg, about 0.4 mg to about 0.5 mg, about 0.5 mg to about 1 mg, about 1 mg to about 2 mg, about 2 mg to about 3 mg, about 3 mg to about 4 mg, about 4 mg to about 5 mg, about 5 mg to about 10 mg, about 10 mg to about 20 mg, about 20 mg to about 30 mg, about 30 mg to about 40 mg, about 40 mg to about 50 mg, about 50 mg to about 60 mg, and / or about 60 mg to about 70 mg, and the antibody, or antigen-binding fragment thereof, is administered at a dosage of about 0.7mg to about 1 mg, about 1 mg to about 2 mg, about 2 mg to about 3 mg, about 3 mg to about 4 mg, about 4 mg to about 5 mg, about 5 mg to about 10 mg, about 10 mg to about 20 mg, about 20 mg to about 30 mg, about 30 mg to about 40 mg, about 40 mg to about 50 mg, about 50 mg to about 100 mg, about 100 mg to about 500 mg, about 500 mg to about 1000 mg, about 1000 mg to about 1500 mg, about 1500 mg to about 2000 mg, about 2000 mg to about 2500 mg, about 2500 mg to about 3000 mg, about 3000 mg to about 3500 mg, about 3500 mg to about 4000 mg, about 4000 mg to about 4500 mg, about 4500 mg to about 5000 mg, about 5000 mg to about 5500 mg, about 5500 mg to about 6000 mg, about 6000 mg to about 6500 mg, and / or about 6500 mg to about 7000 mg.

[0387] In a further embodiment, the compound and the antibody, or antigen-binding fragment thereof, are administered in a molar ratio and / or dosage as described herein once every week, once every two weeks, once every three weeks, once every four weeks, once every five weeks, or once every six weeks for a period of one week to one year, such as a period of one week, one month, two months, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, or twelve months.III. Therapeutic Applications

[0388] One aspect of the invention provides a method of treating or preventing a disease or condition in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (e.g., a compound of Formula I or II, or a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0389] Another aspect of the invention provides a method of treating or preventing a Navl .8- associated disease or condition in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (such as a compound of Formula I or II, or a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0390] Another aspect of the invention provides a method of treating or preventing a disease or condition in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (such as a compound of Formula I or II, or a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof, wherein the disease or condition is selected from pain, cough, acute itch, or chronic itch.

[0391] In certain embodiments, the method is to treating the disease or condition. In certain embodiments, the method is to preventing the disease or condition.

[0392] Another aspect of the invention provides a method of treating or preventing pain in a patient in need thereof, wherein the method comprises administering to the patient a therapeutically effective amount of a heterobifunctional compound described herein (such as a compound of Formula I or II, or a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0393] In certain embodiments, the method is to treating pain. In certain embodiments, the method is to preventing pain.

[0394] In certain embodiments, the pain is chronic pain. In certain embodiments, the pain is acute pain. In certain embodiments, the pain is neuropathic pain. In certain other embodiments, the pain is inflammatory pain. In certain embodiments, the pain is arthritis pain. In certain embodiments, the pain is arthritis pain selected from osteoarthritis pain and rheumatoid arthritis pain.

[0395] In certain other embodiments, the pain is pain due to cancer. In certain embodiments, the pain is due to a cancer selected from the group consisting of a solid tumor, leukemia, and lymphoma. In certain embodiments, the pain is due to a cancer selected from the group consisting of a bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer, esophageal cancer, leukemia, lung cancer, liver cancer, skin cancer, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, renal cancer, stomach cancer, testicular cancer, and uterine cancer.

[0396] In certain other embodiments, the pain is complex regional pain syndrome. In certain embodiments, the complex regional pain syndrome is reflex sympathetic dystrophy pain. In certain other embodiments, the pain is trauma pain. In certain embodiments, the pain is due to surgery.

[0397] In certain other embodiments, the pain is located in the patient’s hand, wrist, arm, shoulder, back, leg, knee, ankle, foot, toe, neck, or head. In certain embodiments, the pain is low back pain. In certain embodiments, the pain is chronic low back pain.

[0398] In certain other embodiments, the pain is a neuropathic pain selected from the group consisting of low back pain, hip pain, leg pain, non-herpetic neuralgia, post-herpetic neuralgia, diabetic neuropathy pain, lumbosacral radiculopathy pain, nerve injury-induced pain, acquired immune deficiency syndrome (AIDS) related neuropathic pain, head trauma pain, phantom limb pain, multiple sclerosis pain, root avulsion pain, painful traumatic mononeuropathy, painful polyneuropathy, thalamic pain syndrome, post-stroke pain, central nervous system injury pain, post-surgical pain, carpal tunnel syndrome pain, trigeminal neuralgia pain, post mastectomy syndrome pain, post-thoracotomy syndrome pain, stump pain, repetitive motion pain, neuropathic pain associated hyperalgesia and allodynia, drug-induced pain, toxin-caused nerve injury pain, chemotherapy-caused nerve injury pain, and combinations thereof.Amount of Reduction in Pain Intensity

[0399] The method may be further characterized according to the amount of reduction in pain intensity relative to pain observed without performing the method. Accordingly, in certain embodiments, the method is characterized by achieving at least a 20% reduction in pain intensity relative to pain observed without performing the method. In certain embodiments, the method is characterized by achieving at least a 40% reduction in pain intensity relative to pain observed without performing the method. In certain embodiments, the method is characterized by achieving at least a 60% reduction in pain intensity relative to pain observed without performing the method. In certain embodiments, the method is characterized by achieving at least an 80% reduction in pain intensity relative to pain observed without performing the method. In certain embodiments, the method is characterized by achieving at least a 90% reduction in pain intensity relative to pain observed without performing the method.Duration of Reduction in Pain Intensity

[0400] The method may be further characterized according to the duration of reduction in pain intensity. Accordingly, in certain embodiments, the reduction in pain intensity lasts for at least 1 week. In certain embodiments, the reduction in pain intensity lasts for at least 2 weeks. In certain embodiments, the reduction in pain intensity lasts for at least 4 weeks. In certainembodiments, the reduction in pain intensity lasts for at least 2 months. In certain embodiments, the reduction in pain intensity lasts for at least 3 months. In certain embodiments, the reduction in pain intensity lasts for at least 6 months.

[0401] In certain embodiments, the reduction in pain intensity lasts for at a duration of 2 months to six months. In certain embodiments, the reduction in pain intensity lasts for a duration of 3 months to 9 months. In certain embodiments, the reduction in pain intensity lasts for a duration of 6 months to 9 months. In certain embodiments, the reduction in pain intensity lasts for a duration of 6 months to 12 months.Increasing Antibody-dependent Cell Cytotoxicity

[0402] Another aspect of the invention provides a method of increasing antibody-dependent cell cytotoxicity (ADCC) of voltage-gated sodium channel Navl ,8-expressing cells, wherein the method comprises contacting the cells with an effective amount of a heterobifunctional compound described herein (such as a compound of Formula I or II) and an anti-cotinine antibody, or antigen-binding fragment thereof.Depleting

[0403] Another aspect of the invention provides a method of depleting voltage-gated sodium channel Nav1.8-expressing cells, wherein the method comprises contacting the cells with an effective amount of a heterobifunctional compound described herein (such as a compound of Formula I or II) and an anti-cotinine antibody, or antigen-binding fragment thereof.Administration Aspects

[0404] In certain embodiments, the compound and the antibody, or antigen-binding fragment thereof, are administered simultaneously.

[0405] In certain embodiments, the compound and the antibody, or antigen-binding fragment thereof, are administered sequentially.Aspects of the Anti cotinine Antibody

[0406] In certain embodiments, the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, anda CDR3 having SEQ ID NO: 3, and the light chain comprising a CDR1 having SEQ ID NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6.

[0407] In certain embodiments, the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8.

[0408] In certain embodiments, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase ADCC activity.

[0409] In certain embodiments, the substitution in the Fc region is S239D / I332E, wherein residue numbering is according to the EU Index.

[0410] In certain embodiments, the anti-cotinine antibody has a heavy chain comprising SEQ ID NO: 9 and a light chain comprising SEQ ID NO: 10.Subjects

[0411] In certain embodiments, the subject is a human. In certain embodiments, the subject is an adult human. In certain embodiments, the subject is a pediatric human.Medical Uses

[0412] Another aspect of the invention provides for the use of a heterobifunctional compound described herein (such as a compound of Formula I or II, or a compound of Formula I, II, or III, or other compounds in Section I) in the manufacture of a medicament. In certain embodiments, the medicament is for treating a disorder described herein, such as pain.

[0413] Another aspect of the invention provides for the use of a heterobifunctional compound described herein (such as a compound of Formula I or II, or other compounds in Section I) for treating a medical disorder, such as a medical disorder described herein, such as pain.

[0414] Another aspect of the invention provides a heterobifunctional compound described herein (such as a compound of Formula I or II, or a compound of Formula I, II, or III, or other compounds in Section I) for use in treating a medical disorder, such as a medical disorder described herein, such as pain.Combination

[0415] Another aspect of the invention provides a combination comprising a heterobifunctional compound described herein (e.g., a compound of Formula I or II, or a compound of Formula I, II, or III) and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0416] In certain embodiments, the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, and a CDR3 having SEQ ID NO: 3, and the light chain comprising a CDR1 having SEQ ID NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6.

[0417] In certain embodiments, the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8.

[0418] In certain embodiments, the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase ADCC activity.

[0419] In certain embodiments, the substitution in the Fc region is S239D / I332E, wherein residue numbering is according to the EU Index.

[0420] In certain embodiments, the anti-cotinine antibody has a heavy chain comprising SEQ ID NO: 9 and a light chain comprising SEQ ID NO: 10.IV. Biological Assays for Evaluating Compound Activity

[0421] Heterobifunctional compounds may be evaluated for biological activity using one or more of the assays described below.Assay 1: Antibody Dependent Cellular Cytotoxicity Reporter Assay

[0422] An antibody dependent cellular cytoxocity reporter assay is conducted using the following four assay components: (i) ARM compound of Formula (I) targeting Nav1.8 (concentrations ranging from 1 pM to 10 pM) (ii) anti-cotinine antibody having a heavy chain sequence of SEQ ID NO: 11 and a light chain sequence of SEQ ID NO: 12 (rabbit variable region with human IgGl Fc domain containing a DE mutation (S239D / I332E)) (concentrations ranging from 0.01 pg / mL to 200 pg / mL); (iii) target cells: cells engineered to overexpresseither human Navl .8 (typically 1000-20,000 cells per well) and (iv) reporter cells: Reagents are combined in a final volume of 20 pL in a 384 - well tissue culture treated plate. All four assay components are incubated together for about 12-18 hours. Thereafter, BioGio Detection reagent (Promega) is added to the wells to lyse the cells and provide a substrate for the luciferase reporter protein. Luminescence signal is measured on a microplate reader and signal Lackground is calculated by dividing the signal of a test well by the signal obtained when no heterobivalent compound of Formula (I) was added. EC50 calculations are done using Graphpad Prism Software, specifically a nonlinear regression curve fit ( Y = Bottom + ( Top - Bottom ) / ( 1 + 10A( ( Log EC50 - X ) * HillSlope ) ) ).Assay 2; Binding of Anti-Cotinine Antibody to ARM Compounds of Formula I or TI Measured by Surface Plasmon Resonance (SPR)

[0423] Anti-cotinine antibodies having a heavy chain sequence of SEQ ID NO: 11 and a light chain sequence of SEQ ID NO: 12 (rabbit variable region with human IgGl Fc domain containing a DE mutation (S239D / I332E)) can be captured on one or more flow cells of a protein A sensor chip (Cytiva) using a Biacore T200 while reserving flow cell 1 as a reference.Following capture, a 3000 second wait step is included to reduce drift during compound analysis. ARM compounds (e.g., of Formula I or II) are then injected at 100 pL / min with 200 and 2000 second association and dissociation times. The entire experiment may be run at 37°C with running buffer containing 10 mM HEPES pH 7.4, 150 mM NaCl, 0.005% P20 and 1% DMSO. ARM compounds of Formula (I) are titrated with a top concentration of 200 nM using a 3-fold 5- point dilution series and a corresponding 5-injection buffer cycle is run for blank subtraction. Data are double referenced by subtracting the response of the reference flow cell from that of the antibody-containing flow cell and subsequently subtracting the referenced blank sensorgrams. Following compound analysis, the surface is regenerated using a 30 second injection of pH 1.5 glycine at a flow rate of 30 pL / min after which antibody is re-captured. The experiment may be run using Biacore T200 control software and evaluated using Biacore T200 Evaluation software. Curves are fit with a 1 : 1 kinetic binding model to obtain kon(1 / Ms), koir (1 / s), Kd (M) determined as koff / kon, and residence time determined as l / kOff. (s).

[0424] Anti-cotinine antibodies having a heavy chain sequence of SEQ ID NO: 9 and a light chain sequence of SEQ ID NO: 10 (humanized version) or a heavy chain sequence of SEQ IDNO: 11 and a light chain sequence of SEQ ID NO: 12 (rabbit version) may be captured via the Fc domain to a protein A or A / G surface on flow cell 2 of a CM5 sensor chip using the Biacore 8k. Both antibodies may have a human IgGl Fc domain containing a DE mutation (S239D / I332E).

[0425] After antibody capture, a 1500 second wait step is included to reduce drift in the binding step. ARM compounds of Formula (I) are then flowed over the captured antibodies at varying top concentrations ranging from 250 nM to 4 pM. The top concentration is diluted 4-fold over 5 dilutions (with a 0 nM compound cycle included to blank subtract the data). Association and dissociation times of the ARMs compounds of Formula (I) may vary between experiments as follows: reference 1- association for 600 seconds and dissociation for 1200 seconds at 20pl / min; reference 2- association for 240 seconds and dissociation for 300 seconds at 30pl / min; reference 3- association for 360 seconds and dissociation for 600 seconds at 30pl / min. Anti-cotinine antibody bound to the protein A or A / G surface is regenerated using 50mM NaOH. Experiments are run at 25°C at pH 7.4 using HBS-EP+ buffer using Biacore 8K control software and evaluated using Biacore Insight Evaluation software. Curves are fit with the 1 : 1 kinetic fit inherent to the software, utilising a local Rmax and local drift setting.V. Combination Therapy

[0426] Another aspect of the invention provides for combination therapy. Heterobifunctional compounds described herein (such as a compound of Formula I or II, or other compounds in Section I) or their pharmaceutically acceptable salts may be used in combination with additional therapeutic agents to treat medical disorders, such as pain.

[0427] In some embodiments, the present invention provides a method of treating a disclosed disease or condition comprising administering to a patient in need thereof an effective amount of a compound disclosed herein or a pharmaceutically acceptable salt thereof and co-administering simultaneously or sequentially an effective amount of one or more additional therapeutic agents, such as those described herein. In some embodiments, the method further comprises administering an anti-cotinine antibody, or antigen-binding fragment thereof. In some embodiments, the method includes co-administering one additional therapeutic agent. In some embodiments, the method includes co-administering two additional therapeutic agents. In someembodiments, the combination of the disclosed compound and the additional therapeutic agent or agents acts synergistically.

[0428] One or more other therapeutic agent may be administered separately from a compound or composition of the invention, as part of a multiple dosage regimen. Alternatively, one or more other therapeutic agents may be part of a single dosage form, mixed together with a compound of this invention in a single composition. If administered as a multiple dosage regime, one or more other therapeutic agent and a compound or composition of the invention may be administered simultaneously, sequentially or within a period of time from one another, for example within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 18, 20, 21, 22, 23, or 24 hours from one another. In some embodiments, one or more other therapeutic agent and a compound or composition of the invention are administered as a multiple dosage regimen more than 24 hours apart.

[0429] Additional therapeutic agents for treating pain include, for example, an opioid analgesic (e.g., alfentanil, allylprodine, alphaprodine, anileridine, benzylmorphine, bezitramide, buprenorphine, butorphanol, clonitazene, codeine, cyclazocine, desomorphine, dextromoramide, dezocine, diampromide, dihydrocodeine, dihydromorphine, dimenoxadol, dimepheptanol, dimethylthiambutene, dioxaphetyl butyrate, dipipanone, eptazocine, ethoheptazine, ethylmethylthiambutene, ethylmorphine, etonitazene fentanyl; heroin, hydrocodone, hydromorphone, hydroxypethidine, isomethadone, ketobemidone, levallorphan, levorphanol, levophenacyl morphan, lofentanil, meperidine, meptazinol, metazocine, methadone, metopon, morphine, myrophine, nalbuphine, narceine, nicomorphine, norlevorphanol, normethadone, nalorphine, normorphine, norpipanone, opium, oxycodone, oxymorphone, papaveretum, pentazocine, phenadoxone, phenomorphan, phenazocine, phenoperidine, piminodine, piritramide, propheptazine, promedol, properidine, propiram, propoxyphene, sufentanil, tramadol, tilidine, salts thereof and mixtures thereof), a non-steroidal anti-inflammatory drug (e.g., aspirin, ibuprofen, diclofenac, diflunisal, ibuprofen, naproxen, fenoprofen, piroxicam, flurbiprofen, mefenamic acid, sulindac, salts thereof and mixtures thereof), and acetaminophen.Additional Considerations

[0430] The doses and dosage regimen of the active ingredients used in the combination therapy may be determined by an attending clinician. In certain embodiments, the compounddescribed herein (such as a compound of Formula I or II, or other compounds in Section I) and the additional therapeutic agent(s) are administered in doses commonly employed when such agents are used as monotherapy for treating the disorder. In other embodiments, the compound described herein (such as a compound of Formula I or II, or other compounds in Section I) and the additional therapeutic agent(s) are administered in doses lower than the doses commonly employed when such agents are used as monotherapy for treating the disorder. In certain embodiments, the compound described herein (such as a compound of Formula I or II, or other compounds in Section I) and the additional therapeutic agent(s) are present in the same composition, which is suitable for oral administration.

[0431] In certain embodiments, the compound described herein (such as a compound of Formula I or II, or other compounds in Section I) and the additional therapeutic agent(s) may act additively or synergistically. A synergistic combination may allow the use of lower dosages of one or more agents and / or less frequent administration of one or more agents of a combination therapy. A lower dosage or less frequent administration of one or more agents may lower toxicity of the therapy without reducing the efficacy of the therapy.

[0432] Another aspect of this invention is a kit comprising a therapeutically effective amount of the compound described herein (such as a compound of Formula I or II, or other compounds in Section I), a pharmaceutically acceptable carrier, vehicle or diluent, and optionally at least one additional therapeutic agent listed above. In some embodiments, the kit further comprises an anti-cotinine antibody, or antigen-binding fragment thereof.VI. Pharmaceutical Compositions and Dosing Considerations

[0433] As indicated above, the invention provides pharmaceutical compositions, which comprise a therapeutically effective amount of one or more of the compounds described above, formulated together with one or more pharmaceutically acceptable carriers (additives) and / or diluents. The pharmaceutical compositions may be specially formulated for administration in solid or liquid form, including those adapted for the following: (1) oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; (2) parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension,or sustained-release formulation; (3) topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin; (4) intravaginally or intrarectally, for example, as a pessary, cream or foam; (5) sublingually; (6) ocularly; (7) transdermally; or (8) nasally. In certain embodiments, the invention provides a pharmaceutical composition comprising a compound described herein (such as a compound of Formula I or II, or a compound of Formula I, II, or III, or other compounds in Section I) and a pharmaceutically acceptable carrier.

[0434] The phrase “therapeutically effective amount” as used herein means that amount of a compound, material, or composition comprising a compound of the present invention which is effective for producing some desired therapeutic effect in at least a sub-population of cells in an animal at a reasonable benefit / risk ratio applicable to any medical treatment.

[0435] The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and / or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit / risk ratio.

[0436] Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.

[0437] Examples of pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.

[0438] Formulations of the present invention include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and / or parenteral administration. The formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. The amount of active ingredient which can becombined with a carrier material to produce a single dosage form will vary depending upon the host being treated, the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.1 percent to about ninety-nine percent of active ingredient, preferably from about 5 percent to about 70 percent, most preferably from about 10 percent to about 30 percent.

[0439] In certain embodiments, a formulation of the present invention comprises an excipient selected from the group consisting of cyclodextrins, celluloses, liposomes, micelle forming agents, e. ., bile acids, and polymeric carriers, e.g., polyesters and polyanhydrides; and a compound of the present invention. In certain embodiments, an aforementioned formulation renders orally bioavailable a compound of the present invention.

[0440] Methods of preparing these formulations or compositions include the step of bringing into association a compound of the present invention with the carrier and, optionally, one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association a compound of the present invention with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.

[0441] Formulations of the invention suitable for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and / or as mouth washes and the like, each containing a predetermined amount of a compound of the present invention as an active ingredient. A compound of the present invention may also be administered as a bolus, electuary or paste.

[0442] In solid dosage forms of the invention for oral administration (capsules, tablets, pills, dragees, powders, granules, trouches and the like), the active ingredient is mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and / or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and / or silicic acid; (2) binders, such as, for example, carboxymethylcellulose,alginates, gelatin, polyvinyl pyrrolidone, sucrose and / or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds and surfactants, such as poloxamer and sodium lauryl sulfate; (7) wetting agents, such as, for example, cetyl alcohol, glycerol monostearate, and non-ionic surfactants; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, zinc stearate, sodium stearate, stearic acid, and mixtures thereof; (10) coloring agents; and (11) controlled release agents such as crospovidone or ethyl cellulose. In the case of capsules, tablets and pills, the pharmaceutical compositions may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-shelled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.

[0443] A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared using binder (for example, gelatin or hydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine a mixture of the powdered compound moistened with an inert liquid diluent.

[0444] The tablets, and other solid dosage forms of the pharmaceutical compositions of the present invention, such as dragees, capsules, pills and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art. They may also be formulated so as to provide slow or controlled release of the active ingredient therein using, for example, hydroxypropylmethyl cellulose in varying proportions to provide the desired release profde, other polymer matrices, liposomes and / or microspheres. They may be formulated for rapid release, e.g., freeze-dried. They may be sterilized by, for example, filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved in sterile water, or some other sterile injectable medium immediately before use. These compositions may also optionally contain opacifying agents and may be of a composition that they release the active ingredient(s) only, or preferentially, in a certain portion of thegastrointestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes. The active ingredient can also be in micro-encapsulated form, if appropriate, with one or more of the above-described excipients.

[0445] Liquid dosage forms for oral administration of the compounds of the invention include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredient, the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, com, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.

[0446] Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming and preservative agents.

[0447] Suspensions, in addition to the active compounds, may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.

[0448] Formulations of the pharmaceutical compositions of the invention for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing one or more compounds of the invention with one or more suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active compound.

[0449] Formulations of the present invention which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.

[0450] Dosage forms for the topical or transdermal administration of a compound of this invention include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patchesand inhalants. The active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.

[0451] The ointments, pastes, creams and gels may contain, in addition to an active compound of this invention, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.

[0452] Powders and sprays can contain, in addition to a compound of this invention, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances. Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.

[0453] Transdermal patches have the added advantage of providing controlled delivery of a compound of the present invention to the body. Such dosage forms can be made by dissolving or dispersing the compound in the proper medium. Absorption enhancers can also be used to increase the flux of the compound across the skin. The rate of such flux can be controlled by either providing a rate controlling membrane or dispersing the compound in a polymer matrix or gel.

[0454] Ophthalmic formulations, eye ointments, powders, solutions and the like, are also contemplated as being within the scope of this invention.

[0455] Pharmaceutical compositions of this invention suitable for parenteral administration comprise one or more compounds of the invention in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain sugars, alcohols, antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.

[0456] Examples of suitable aqueous and nonaqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol,propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.

[0457] These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms upon the subject compounds may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.

[0458] In some cases, in order to prolong the effect of a drug, it is desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material having poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle.

[0459] Injectable depot forms are made by forming microencapsule matrices of the subject compounds in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.

[0460] When the compounds of the present invention are administered as pharmaceuticals, to humans and animals, they can be given per se or as a pharmaceutical composition containing, for example, 0.1 to 99% (more preferably, 10 to 30%) of active ingredient in combination with a pharmaceutically acceptable carrier.

[0461] The preparations of the present invention may be given orally, parenterally, topically, or rectally. They are of course given in forms suitable for each administration route. For example, they are administered in tablets or capsule form, by injection, inhalation, eye lotion, ointment, suppository, etc. administration by injection, infusion or inhalation; topical by lotion or ointment; and rectal by suppositories. Oral administrations are preferred.

[0462] The phrases “parenteral administration” and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion.

[0463] The phrases “systemic administration,” “administered systemically,” “peripheral administration” and “administered peripherally” as used herein mean the administration of a compound, drug or other material other than directly into the central nervous system, such that it enters the patient’s system and, thus, is subject to metabolism and other like processes, for example, subcutaneous administration.

[0464] These compounds may be administered to humans and other animals for therapy by any suitable route of administration, including orally, nasally, as by, for example, a spray, rectally, intravaginally, parenterally, intraci sternally and topically, as by powders, ointments or drops, including buccally and sublingually.

[0465] Regardless of the route of administration selected, the compounds of the present invention, which may be used in a suitable hydrated form, and / or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.

[0466] Actual dosage levels of the active ingredients in the pharmaceutical compositions of this invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.

[0467] The selected dosage level will depend upon a variety of factors including the activity of the particular compound of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion or metabolism of the particular compound being employed, the rate and extent of absorption, the duration of the treatment, other drugs, compounds and / or materials used in combination with the particular compound employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.

[0468] A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.

[0469] In general, a suitable daily dose of a compound of the invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. Preferably, the compounds are administered at about 0.01 mg / kg to about 200 mg / kg, more preferably at about 0.1 mg / kg to about 100 mg / kg, even more preferably at about 0.5 mg / kg to about 50 mg / kg. When the compounds described herein are co-administered with another agent (e.g., as sensitizing agents), the effective amount may be less than when the agent is used alone.

[0470] If desired, the effective daily dose of the active compound may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. Preferred dosing is one administration per day.

[0471] The invention further provides a unit dosage form (such as a tablet or capsule) comprising a compound described herein in a therapeutically effective amount for the treatment of a medical disorder described herein.VII. SEQUENCE LISTINGS

[0472] Heavy chain CDR1 amino acid sequence (SEQ ID NO: 1): NYWMS

[0473] Heavy chain CDR2 amino acid sequence (SEQ ID NO: 2):DIHGNRGFNYHASWAKG

[0474] Heavy chain CDR3 amino acid sequence (SEQ ID NO: 3): ADDSGSHDI

[0475] Light chain CDR1 amino acid sequence (SEQ ID NO: 4): QSSQSVYSAKLS

[0476] Light chain CDR2 amino acid sequence (SEQ ID NO: 5): YGSTLAS

[0477] Light chain CDR3 amino acid sequence (SEQ ID NO: 6): QGTFYGPDWYFA

[0478] Variable heavy chain amino acid sequence (SEQ ID NO: 7):EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVGDIHG NRGFNYHASWAKGRFTVSRSKNTLYLQMNSLRAEDTAVYYCAKADDSGSHDIW GQGTLVTVSS

[0479] Variable light chain amino acid sequence (SEQ ID NO: 8):DIQMTQSPSSLSASVGDRVTITCQSSQSVYSAKLSWYQQKPGKAPKLLIYYGSTLASGVP SRFSGSGSGTQFTLTISSLQPEDFATYYCQGTFYGPDWYFAFGGGTKVEIK

[0480] Heavy chain amino acid sequence (SEQ ID NO: 9):EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVGDIHGNRGF NYHASWAKGRFTVSRSKNTLYLQMNSLRAEDTAVYYCAKADDSGSHDIWGQGTLVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ S SGL YSL S S VVTVP S S SLGTQT YICNVNHKP SNTKVDKK VEPK SCDKTHTCPPCP APELL GGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPEEKTISKAKGQPREPQVYTL PP SRDELTKNQ VSLTCLVKGF YP SDIAVEWESNGQPENNYKTTPP VLD SDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

[0481] Light chain amino acid sequence (SEQ ID NO: 10):DIQMTQSPSSLSASVGDRVTITCQSSQSVYSAKLSWYQQKPGKAPKLLIYYGST LASGVPSRFSGSGSGTQFTLTISSLQPEDFATYYCQGTFYGPDWYFAFGGGTKV EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGN SQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

[0482] Heavy chain amino acid sequence (SEQ ID NO: 11): OOQLVESGGRLVTPGGSLTL TCTASGFSLN NYWMSWVRQA PGKGLEWIGD IHGNRGFNYHASWAKGRFTV SRTSTTVDLR MTSLTTEDTA IYFCARADDS GSHDIWGPGT LVTVSSASTK GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP EPVTVSWNSG ALTSGVHTFP AVLQSSGLYS LSSVVTVPSS SLGTQTYICN VNHKPSNTKV DKKVEPKSCD KTHTCPPCPA PELLGGPDVF LFPPKPKDTL MISRTPEVTC VVVDVSHEDP EVKFNWYVDG VEVHN AKTKP REEQYNSTYR VVS VLTVLHQ DWLNGKEYKC KVSNKALPAP EEKTISKAKG QPREPQVYTL PPSRDELTKN QVSLTCLVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLYSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK

[0483] Light chain amino acid sequence (SEQ ID NO: 12):ELDLTQTPSPVSAAVGDTVTINCOSSOSVYSAKLSWYOOKPGOPPKLLIYYGSTLASGV PSRFKGSGSGTQFSLTISDVOCADAATYYCQGTYYGPDWYFAFGGGTEVVVKRTVAA PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

[0484] Heavy chain amino acid sequence (SEQ ID NO: 13):QOOLVESGGRLVTPGGSLTLTCTASGFSLNNYWMSWVRQAPGKGLEWIGDIHGNRGFNYHASWAKGRFTVSRTSTTVDLRMTSLTTEDTA1YFCARADDSGSHDIWGPGTLVTVS S AKTTAPS VYPLAP VC GDTTGS S VTLGCL VKGYFPEP VTLTWNSGSL S SGVHTFP AVLQ S DLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGG PSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVLTAQTQTHREDYN STLRVVSALPIQHQDWMSGKEFKCKVNNKALPAPIERTISKPKGSVRAPQVYVLPPPEEE MTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEK KNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

[0485] Light chain amino acid sequence (SEQ ID NO: 14):ELDLTQTPSPVSAAVGDTVTINCOSSOSVYSAKLSWYOQKPGOPPKLLIYYGSTLASGV PSRFKGSGSGTQFSLTISDVQCADAATYYCOGTYYGPDWYFAFGGGTEVVVKRADAA PTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECVIII. ENUMERATED EMBODIMENTS

[0486] The following exemplary embodiments are provided:

[0487] Embodiment 1. A compound represented by Formula (I):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C2 -10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, or three methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, or - O-;X2is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein is a bond to L;Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, wherein Formula 1-1 is represented by:whereinR2and R4are independently C1-3 alkyl;R3is C1-3 haloalkyl;R?is C1-4 alkoxyl, -O-(C3-6 cycloalkyl), or C1-4 alkyl;R6represents independently for each occurrence fluoro or chloro;R7, R9, and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1-4 alkyl;R8represents independently for each occurrence fluoro, chloro, or C1.4 alkyl;R11is a bond to X1; x is 0 or 1; y is 0, 1, or 2; z is 0 or 1; is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched C1-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(CI-6alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -wherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2.10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(L-e) wherein n is an integer of 3 to 50;( ) (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2tis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -0-; andL2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;(L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(0)-, -C(0)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L3his a bond, -C(0)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(0)-, -CH2C(0)-, or - C(0)CH2-; and m is 1, 2, or 3;(L-i) wherein L11is a bond, C1.12 linear alkylene, or**, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(0)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5areN; L1' is -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2' is Ci-6 linear alkylene or*** I _ 11 , wherein n is 1 or 2, and « represents a covalent bond to L1J; and " represents a single bond or a double bond;wherein Ring A is phenylene or a 5 or 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH- or -NHC(O)-; and L2kis a C3-8 _ straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(L-m) wherein Z1is CH or N; m is 1 or 2; p is 1 or 2; 0, 1, or 2 hydrogen atoms ofare replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and I?nis C3-6linear alkylene,C3-6 cycloalkylene, or, wherein n is 1 or 2, and represents acovalent bond to Llm;(L-p) wherein Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atoms ofare replaced with F; Llpis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteratoms independently selected from nitrogen oxygen, and sulfur)-C(O))-; and wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

[0488] Embodiment 2. The compound of embodiment 1, wherein the compound is a compound of Formula I.

[0489] Embodiment 3. The compound of embodiment 1 or 2, wherein R1is -CHg.273

[0490] Embodiment 4. The compound of any one of embodiments 1-3, wherein X2is $-(Ci-s alkylene)-N(H)-.

[0491] Embodiment 5. The compound of any one of embodiments 1-3, wherein X2is <[>- CH2CH2-N(H)-.

[0492] Embodiment 6. The compound of any one of embodiments 1-3, wherein X2is $- C(H)(CH3)-N(H)-.

[0493] Embodiment 7. The compound of any one of embodiments 1-6, wherein Y1is

[0494] Embodiment 8. The compound of any one of embodiments 1-6, wherein Y1is one of the following:

[0495] Embodiment 9. The compound of any one of embodiments 1-6, wherein Y1is

[0496] Embodiment 10. The compound of any one of embodiments 1-6, wherein Y1is one of the following:

[0497] Embodiment 11 . The compound of any one of embodiments 1-6, wherein Y1is

[0498] Embodiment 12. The compound of any one of embodiments 1-6, wherein Y1is one of the following:

[0499] Embodiment 13. The compound of embodiment 1, wherein the compound is represented by Formula la or a pharmaceutically acceptable salt thereof:

[0500] Embodiment 14. The compound of embodiment 1, wherein the compound is represented by Formula lb or a pharmaceutically acceptable salt thereof:

[0501] Embodiment 15. The compound of embodiment 1, wherein the compound is represented by Formula Ic or a pharmaceutically acceptable salt thereof:

[0502] Embodiment 16. The compound of any one of embodiments 1-7, 9, 11, or 13-15, wherein R2is methyl.

[0503] Embodiment 17. The compound of any one of embodiments 1-7, 9, 11, or 13-16, wherein R3is trifluoromethyl .

[0504] Embodiment 18. The compound of any one of embodiments 1-7, 9, 11, or 13-17, wherein R4is methyl.

[0505] Embodiment 19. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein R5is Ci-4 alkoxyl.

[0506] Embodiment 20. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein R5is methoxy.

[0507] Embodiment 21. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein R5is -O-(C.3-6 cycloalkyl).

[0508] Embodiment 22. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein R5is -O-(cyclopropyl).

[0509] Embodiment 23. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein R5is Ci-4 alkyl.

[0510] Embodiment 24. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein R5is methyl.

[0511] Embodiment 25. The compound of any one of embodiments 1-7, 9, 11, or 13-24, wherein x is 1.

[0512] Embodiment 26. The compound of any one of embodiments 1-7, 9, 11, or 13-25, wherein R6is fluoro.

[0513] Embodiment 27. The compound of any one of embodiments 1-7, 9, 11, or 13-26, wherein y is 1.

[0514] Embodiment 28. The compound of any one of embodiments 1-7, 9, 11, or 13-26, wherein y is 2.

[0515] Embodiment 29. The compound of any one of embodiments 1-7, 9, 11, or 13-18, wherein x is 0, and y is 0.

[0516] Embodiment 30. The compound of any one of embodiments 1-7, 9, 11, or 13-29, wherein R7is hydrogen.

[0517] Embodiment 31. The compound of any one of embodiments 1-7, 9, 11, or 13-30, wherein R9and R10are hydrogen.

[0518] Embodiment 32. The compound of any one of embodiments 1-7, 9, 11, or 13-31, wherein R8is fluoro.

[0519] Embodiment 33. The compound of any one of embodiments 1-7, 9, 11, or 13-32, wherein z is 1.

[0520] Embodiment 34. The compound of any one of embodiments 1-7, 9, 11, or 13-31, wherein z is 0.

[0521] Embodiment 35. The compound of any one of embodiments 1-34, wherein X1is -(Ci- 3 alkylene)-N(H)-'P, wherein T is a bond to L.

[0522] Embodiment 36. The compound of any one of embodiments 1-34, wherein X1is - (propylene)-N(H)-T, wherein T is a bond to L.

[0523] Embodiment 37. The compound of any one of embodiments 1-34, wherein X1is - (CEbCH2)-N(EI)-'P, wherein T is a bond to L.

[0524] Embodiment 38. The compound of any one of embodiments 1-34, wherein X1is - (CH2)-N(H)-T, wherein T is a bond to L.

[0525] Embodiment 39. The compound of any one of embodiments 1-34, wherein X1is -(C2- 3 alkylene)-O-(C2-3 alkylene)-N(H)-vP, wherein T is a bond to L.

[0526] Embodiment 40. The compound of any one of embodiments 1-34, wherein X1is - (propylene)-O-(propylene)-N(H)-T, wherein T is a bond to L.

[0527] Embodiment 41. The compound of any one of embodiments 1-34, wherein X1is -(Ci- 3 alkylene)-N(H)-(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-'P, wherein T is a bond to L.

[0528] Embodiment 42. The compound of any one of embodiments 1-34, wherein X1is - (CH2)-N(H)-(CH2CH2)-O-(CH2CH2)-N(H)-'P, wherein T is a bond to L.

[0529] Embodiment 43. The compound of any one of embodiments 1-34, wherein X1is -O- (C2-4 alkylene)-N(H)-'P, wherein T is a bond to L.

[0530] Embodiment 44. The compound of any one of embodiments 1-34, wherein X1is -O- (CH2CH2CH2)-N(H)-'P, wherein T is a bond to L.

[0531] Embodiment 45. The compound of any one of embodiments 1-34, wherein X1is -O- (C2-3 alkylene)-O-(C2-6 alkylene)-N(H)-T, wherein T is a bond to L.

[0532] Embodiment 46. The compound of any one of embodiments 1-34, wherein X1is -O- (CH2CH2)-O-(CH2CH2CH2)-N(H)-T, wherein T is a bond to L.

[0533] Embodiment 47. The compound of any one of embodiments 1-34, wherein X1is -(C2-3 alkylene)-O-(C2-4 alkyl ene)-N(H)-T, wherein T is a bond to L.

[0534] Embodiment 48. The compound of any one of embodiments 1-34, wherein X1is - (CH2CH2)-O-(CH2CH2CH2)-N(H)-T, wherein T is a bond to L.

[0535] Embodiment 49. The compound of any one of embodiments 1-6, wherein Y^X1- is

[0536] Embodiment 50. A compound represented by Formula (II):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C2 -10 bivalent saturated straight or branched hydrocarbon chain wherein one or two methylene units of the chain are independently replaced by -N(H)-, -N(CH.3)-, or -O-;X2is cf)-(C 1-5 alkylene)-N(H)- or a covalent bond, wherein <j) is a bond to L;Y1is defined by Formula II-l that is substituted by one occurrence of R11, wherein Formula II-l is represented by:whereinR2is C1-3 haloalkyl;R3is hydrogen, chloro, or fluoro;R4represents independently for each occurrence fluoro, chloro, or C1.4 alkyl;R5is hydrogen or C1-4 alkyl;, each of which is substituted with 0 or1 occurrence of C1.4 alkyl;R11is a bond to X1; x is 1 or 2;L is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, - S-, -N(H)-, -N(CI-6alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, - C(O)N(H)-, -C(O)N(C 1-6 alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-i2linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-, -C(O)NRlb-, or -NRlbC(O)-; or L2bis wherein n is 1 , 2, 3, or 4, andrepresents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Llcis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-; *(L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;wherein n is an integer of 3 to 50; *(L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH; *(viii) (L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; andL2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg;(L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or_, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L3his a bond, -C(0)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(0)-, -CH2C(0)-, or - C(0)CH2-; and m is 1, 2, or 3;(L-i) wherein L11is a bond, C1.12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(0)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-, -C(0)NH-, -NHC(O)-, or -0-; L2' is Ci-6 linear alkylene or, wherein n is 1 or 2, and represents a covalent bond to L1'; andrepresents a single bond or a double bond;wherein Ring A is phenylene or a 5 or 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2isindependently CH or N; Llkis a bond, -C(O)-, -C(O)NH- or -NHC(O)-; and L2kis a C3-8 _ straight chain alkylene or, wherein n is 1, 2, or 3, and representsa covalent bond to Llk;(xiii)) wherein Z1is CH or N; m is 1 or 2; p is 1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llrais a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2mis C3-6linear alkylene,C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;(xv) (L-p) wherein Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atoms of' are replaced with F; Llpis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteratoms independently selected from nitrogen oxygen, and sulfur)-C(O))-; and _ wherein eachrepresents a covalent bond to X1, and each represents acovalent bond to X2.

[0537] Embodiment 51. The compound of embodiment 50, wherein the compound is a compound of Formula II.

[0538] Embodiment 52. The compound of embodiment 50 or 51, wherein R1is -CH3.

[0539] Embodiment 53. The compound of any one of embodiments 50-52, wherein X2is <f>- (C1-5 alkylene)-N(H)-.

[0540] Embodiment 54. The compound of any one of embodiments 50-52, wherein X2is - CH2CH2-N(H)-.

[0541] Embodiment 55. The compound of any one of embodiments 50-52, wherein X2is - C(H)(CH3)-N(H)-.

[0542] Embodiment 56. The compound of any one of embodiments 50-55, wherein Y1is

[0543] Embodiment 57. The compound of any one of embodiments 50-56, wherein R6is

[0544] Embodiment 58. The compound of any one of embodiments 50-56, wherein R6is

[0545] Embodiment 59. The compound of any one of embodiments 50-56, wherein R6is

[0546] Embodiment 60. The compound of any one of embodiments 50-55, wherein Y1is one of the following:

[0547] Embodiment 61. The compound of any one of embodiments 50-55, wherein Y1is one of the following:

[0548] Embodiment 62. The compound of any one of embodiments 50-55, wherein Y1is one of the following:

[0549] Embodiment 63. The compound of any one of embodiments 50-55, wherein Y1is

[0551] Embodiment 65. The compound of any one of embodiments 50-55, wherein Y1is

[0554] Embodiment 68. The compound of any one of embodiments 50-55, wherein Y1is

[0555] Embodiment 69. The compound of embodiment 50, wherein the compound is represented by Formula Ila or a pharmaceutically acceptable salt thereof

[0556] Embodiment 70. The compound of embodiment 50, wherein the compound is represented by Formula lib or a pharmaceutically acceptable salt thereof:

[0557] Embodiment 71 . The compound of embodiment 50, wherein the compound is represented by Formula lie or a pharmaceutically acceptable salt thereof:

[0558] Embodiment 72. The compound of embodiment 50, wherein the compound is represented by Formula lid or a pharmaceutically acceptable salt thereof:lid.

[0559] Embodiment 73. The compound of any one of embodiments 50-55 or 70-72, wherein x is 1.

[0560] Embodiment 74. The compound of any one of embodiments 50-55 or 70-72, wherein x is 2.

[0561] Embodiment 75. The compound of any one of embodiments 50-59, 63, 65, 67, or 69- 74, wherein R2is trifluoromethyl.

[0562] Embodiment 76. The compound of any one of embodiments 50-59, 63, 65, 67, or 69- 75, wherein R3is hydrogen.

[0563] Embodiment 77. The compound of any one of embodiments 50-59, 63, 65, 67, or 69- 75, wherein R3is chloro.

[0564] Embodiment 78. The compound of any one of embodiments 50-59, 63, 65, 67, or 69- 74, wherein R4represents independently for each occurrence fluoro.

[0565] Embodiment 79. The compound of any one of embodiments 50-59, 63, 65, 67, or 69- 74, wherein R4represents independently for each occurrence fluoro or methyl.

[0566] Embodiment 80. The compound of any one of embodiments 50-59, 63, 65, 67, or 69- 79, wherein R5is hydrogen.

[0567] Embodiment 81. The compound of any one of embodiments 50-80, wherein X1is -O- (C2-4 alkylene)-N(H)-'P, wherein T is a bond to L.

[0568] Embodiment 82. The compound of any one of embodiments 50-80, wherein X1is -O- (CH2CH2CH2)-N(H)-T, wherein is a bond to L.

[0569] Embodiment 83. The compound of any one of embodiments 50-80, wherein X1is - (C2-4 alkylene)-N(H)-'P, wherein is a bond to L.

[0570] Embodiment 84. The compound of any one of embodiments 50-80, wherein X1is - (CH2CH2CH2)-N(H)-'P, wherein T is a bond to L.

[0571] Embodiment 85. The compound of any one of embodiments 50-55, wherein Y'-X1- is one of the following:

[0572] Embodiment 86. The compound of any one of embodiments 1-85, wherein L is a divalent linker of Formula (L-a-i):are as defined for Formula (L-a).

[0573] Embodiment 87. The compound of any one of embodiments 1-85, wherein L is a divalent linker of Formula (L-a-ii):defined for Formula (L-a); p is 1 or 2; and m is 1 or 2.

[0574] Embodiment 88. The compound of any one of embodiments 1-85, wherein L is a divalent linker of Formula (L-a-iii):

[0575] Embodiment 89. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of:

[0576] Embodiment 90. The compound of any one of embodiments 1-85, wherein L is a divalent linker of Formula (L-b-i):(L-b-i) wherein Llb, L2bare as defined forFormula (L-b); p is 1 or 2; and m is 1 or 2.

[0577] Embodiment 91. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of

[0578] Embodiment 92. The compound of any one of embodiments 1-85, wherein L is adivalent linker of Formula (L-c-i): 6 (L-c-i), wherein Llc, L2c,are as defined for Formula (L-c); p is 1 or 2; and m is 1 or 2.

[0579] Embodiment 93. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of

[0580] Embodiment 94. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of

[0581] Embodiment 95. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of:

[0582] Embodiment 96. The compound of any one of embodiments 1-85, wherein L is a divalent linker of Formula (wherein Llg, L2g,and are as defined for Formula (L-g); Z1, Z2, and Z3are each independently selected fromN or CH, provided that one or two of Z1, Z2, and Z3is N.

[0583] Embodiment 97. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of:

[0584] Embodiment 98. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of:

[0585] Embodiment 99. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of

[0586] Embodiment 100. The compound of any one of embodiments 1-85, wherein L is a selected from the group consisting of:

[0587] Embodiment 101. The compound of any one of embodiments 1-85, wherein L is selected from the group consisting of:

[0588] Embodiment 102. The compound of any one of embodiments 1-85, wherein L is(L-p) wherein Z1is CH or N; m is 1 or 2; p is 1 or 2; 0, 1,or 2 hydrogen atomsare replaced with F; Llpis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH- or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteratoms independently selected from nitrogen oxygen, and sulfur)-C(O))-.

[0589] Embodiment 103. The compound of any one of embodiments 1-85, wherein L is

[0590] Embodiment 104. The compound of any one of embodiments 1-85, wherein L is one of the following:

[0591] Embodiment 105. The compound of any one of embodiments 1-85, whereintaken together are one of the following:

[0592] Embodiment 106. A compound in Table 1 or 2, or a pharmaceutically acceptable salt thereof.

[0593] Embodiment 107. A pharmaceutical composition, comprising a compound of embodiment of any one of embodiments 1-106 and pharmaceutically acceptable carrier.

[0594] Embodiment 108. A method of treating or preventing a Nav1.8 -associated disease or condition in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of embodiments 1-106 and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0595] Embodiment 109. The method of embodiment 108, wherein the Navl ,8-associated disease or condition is pain, cought, acute itch, or chronic itch.

[0596] Embodiment 110. A method of treating or preventing pain in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of embodiments 1-106 and an anti -cotinine antibody, or antigen-binding fragment thereof.

[0597] Embodiment 111. The method of embodiment 110, wherein the method is to treating pain.

[0598] Embodiment 112. The method of embodiment 110 or 111, wherein the pain is chronic pain.

[0599] Embodiment 113. The method of embodiment 110 or 111, wherein the pain is acute pain.

[0600] Embodiment 114. The method of any one of embodiments 110-113, wherein the pain is neuropathic pain.

[0601] Embodiment 115. The method of any one of embodiments 110-113, wherein the pain is inflammatory pain.

[0602] Embodiment 116. The method of any one of embodiments 110-113, wherein the pain is arthritis pain.

[0603] Embodiment 117. The method of any one of embodiments 110-113, wherein the pain is arthritis pain selected from osteoarthritis pain and rheumatoid arthritis pain.

[0604] Embodiment 118. The method of any one of embodiments 110-113, wherein the pain is due to cancer.

[0605] Embodiment 119. The method of any one of embodiments 110-113, wherein the pain is due to a cancer selected from the group consisting of a solid tumor, leukemia, and lymphoma.

[0606] Embodiment 120. The method of any one of embodiments 110-113, wherein the pain is complex regional pain syndrome.

[0607] Embodiment 121. The method of embodiment 120, wherein the complex regional pain syndrome is reflex sympathetic dystrophy pain.

[0608] Embodiment 122. The method of any one of embodiments 110-113, wherein the pain is trauma pain.

[0609] Embodiment 123. The method of any one of embodiments 110-113, wherein the pain is due to surgery.

[0610] Embodiment 124. The method of any one of embodiments 110-123, wherein the pain is located in the patient’s hand, wrist, arm, shoulder, back, leg, knee, ankle, foot, toe, neck, or head.

[0611] Embodiment 125. The method of any one of embodiments 110-113, wherein the pain is low back pain.

[0612] Embodiment 126. The method of embodiment 110 or 111, wherein the pain is chronic low back pain.

[0613] Embodiment 127. The method of any one of embodiments 110-113, wherein the pain is a neuropathic pain selected from the group consisting of low back pain, hip pain, leg pain, non-herpetic neuralgia, post-herpetic neuralgia, diabetic neuropathy pain, lumbosacral radiculopathy pain, nerve injury -induced pain, acquired immune deficiency syndrome (AIDS) related neuropathic pain, head trauma pain, phantom limb pain, multiple sclerosis pain, root avulsion pain, painful traumatic mononeuropathy, painful polyneuropathy, thalamic pain syndrome, post-stroke pain, central nervous system injury pain, post-surgical pain, carpal tunnel syndrome pain, trigeminal neuralgia pain, post mastectomy syndrome pain, post-thoracotomy syndrome pain, stump pain, repetitive motion pain, neuropathic pain associated hyperalgesia and allodynia, drug-induced pain, toxin-caused nerve injury pain, chemotherapy-caused nerve injury pain, and combinations thereof.

[0614] Embodiment 128. The method of any one of embodiments 108-127, wherein the compound and the antibody, or antigen-binding fragment thereof, are administered simultaneously.

[0615] Embodiment 129. The method of any one of embodiments 108-128, wherein the compound and the antibody, or antigen-binding fragment thereof, are administered sequentially.

[0616] Embodiment 130. A method of increasing antibody-dependent cell cytotoxicity (ADCC) of voltage-gated sodium channel Nav1.8-expressing cells, comprising contacting thecells with an effective amount of the compound of any one of embodiments 1-106 and an anti- cotinine antibody, or antigen-binding fragment thereof.

[0617] Embodiment 131. A method of depleting voltage-gated sodium channel Nav1.8- expressing cells, comprising contacting the cells with an effective amount of the compound of any one of embodiments 1-106 and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0618] Embodiment 132. The method of any one of embodiments 108-131, wherein the anti- cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, and a CDR3 having SEQ ID NO: 3, and the light chain comprising a CDR1 having SEQ ID NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6.

[0619] Embodiment 133. The method of any one of embodiments 108-131, wherein the anti- cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8.

[0620] Embodiment 134. The method of any one of embodiments 108-133, wherein the anti- cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase ADCC activity.

[0621] Embodiment 135. The method of embodiment 134, wherein the substitution in the Fc region is S239D / I332E, wherein residue numbering is according to the EU Index.

[0622] Embodiment 136. The method of any one of embodiments 108-131, wherein the anti- cotinine antibody has a heavy chain comprising SEQ ID NO: 9 and a light chain comprising SEQ ID NO: 10.

[0623] Embodiment 137. A combination comprising the compound of any one of embodiments 1-106 and an anti-cotinine antibody, or antigen-binding fragment thereof.

[0624] Embodiment 138. The combination of embodiment 137, wherein the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, and a CDR3 having SEQ ID NO: 3, and the lightchain comprising a CDR1 having SEQ TD NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6.

[0625] Embodiment 139. The combination of embodiment 137, wherein the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8.

[0626] Embodiment 140. The combination of any one of embodiments 137-139, wherein the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase ADCC activity.

[0627] Embodiment 141. The combination of embodiment 139, wherein the substitution in the Fc region is S239D / I332E, wherein residue numbering is according to the EU Index.

[0628] Embodiment 142. The combination of embodiment 137, wherein the anti-cotinine antibody has a heavy chain comprising SEQ ID NO: 9 and a light chain comprising SEQ ID NO: 10.EXAMPLES

[0629] The invention now being generally described, will be more readily understood by reference to the following examples, which are included merely for purposes of illustration of certain aspects and embodiments of the present invention, and are not intended to limit the invention.EXAMPLE 1 - Synthesis of (2X,3^-f-(2-(((l^,4X)-4-(4-(((lr,47?)-4-((3-(2-(3-(5-(4- chIorophenyl)furan-2-carboxamido)-5-methoxyphenoxy)ethoxy)propyl)carbamoyl) cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamide (ITI-2)

[0630] Step 1: Preparation of methyl 5-(4-chlorophenyl)furan-2-carboxylate (3). To a solution of methyl 5-bromofuran-2-carboxylate (1) (7.5 g, 36.6 mmol) in 1,4-dioxane (67.5 mL) and water (7.5 mL) were added (4-chlorophenyl)boronic acid (2) (6.86 g, 43.9 mmol) andsodium carbonate (1 1 .63 g, 110 mmol). The resulting mixture was stirred under a N2 atmosphere at room temperature for 10 minutes. Tetrakis(triphenylphosphine)palladium (0.846 g, 0.732 mmol) was added, and the resulting mixture was stirred at 100 °C for 2 hours. The reaction was cooled to room temperature, diluted with water (60 mL), and extracted with ethyl acetate (EtOAc) (3 x 80 mL). The combined extracts were washed with brine (50 mL), dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography (7-10% EtOAc / petroleum ether) to afford the title compound 3 (6.22 g, 26.3 mmol, 72 % yield) as a solid. LC-MS m / z 237.1 (M+H)+.

[0631] Step 2: Preparation of 5-(4-chlorophenyl)furan-2-carboxylic acid (4). To a solution of methyl 5-(4-chlorophenyl)furan-2-carboxylate (3) (6.2 g, 26.2 mmol) in methanol (MeOH) (55 mL) and tetrahydrofuran (THF) (9 mL), a NaOH solution (4 M, 36 mL, 26.2 mmol) was added. The resulting reaction was stirred at room temperature for 10 hours. After completion, the reaction mixture was concentrated under reduced pressure, diluted with water (20 mL), and acidified with aqueous hydrochloric acid (1.5 N, 20 mL). The resulting precipitate was collected, washed with water, and dried to afford the title compound 4 (5.51 g, 24.26 mmol, 93 % yield) as an off-white solid. LC-MS m / z 221.0 (M-H)’.

[0632] Step 3: Preparation of 5-(4-chlorophenyl)-JV-(3-hydroxy-5-methoxyphenyl)furan-2-carboxamide (6). To a solution of 5-(4-chlorophenyl)furan-2-carboxylic acid (4) (3 g, 13.48 mmol) and / v',Af-diisopropylcthylaminc (DIPEA) (4.35 g, 33.7 mmol) in A^V-di methyl form ami de (DMF) (45 mL), hexafluorophosphate azabenzotri azole tetramethyl uronium (HATU) (6.66 g, 17.52 mmol) was added. The reaction mixture was stirred at room temperature for 10 minutes.3-Amino-5-methoxyphenol (5) (1.875 g, 13.48 mmol) was added, and the mixture was stirred at room temperature for 12 hours. Once completed, the reaction was diluted with cold water (50 mL) and extracted with EtOAc (70 mL x 3). The combined extracts were dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography (55-70% EtOAC / petroleum ether) to afford the title compound (3.2 g, 9.03 mmol, 67 % yield) as an off-white solid. LC-MS m / z 344.1 (M+H)+.

[0633] Step 4: Preparation of tert-butyl (3-(2-(3-(5-(4-chlorophenyl)furan-2- carboxamido)-5-methoxyphenoxy)ethoxy)propyl)carbamate (8). To a solution of 5-(4-chlorophenyl)-A-(3-hydroxy-5-methoxyphenyl)furan-2-carboxamide (6) (0.6 g, 1.745 mmol) and te / 7-butyl (3-(2-hydroxyethoxy)propyl)carbamate (7) (0.574 g, 2.62 mmol) in THF (15 mL) at 0 °C, triphenylphosphine (0.687 g, 2.62 mmol) and diethyl azodi carb oxy late (DEAD) (0.456 g, 2.62 mmol) were added. The resulting reaction mixture was allowed to warm to room temperature. After stirring for 12 hours, the reaction mixture was diluted with water (10 mL) and extracted with EtOAc (25 mL x 3). The combined extracts were dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography (40-50% EtOAC / petroleum ether) to afford the title compound 8 (0.3 g, 0.539 mmol, 31 % yield) as a gummy solid. LC-MS m / z 567.2 (M+Na)+.

[0634] Step 5: Preparation of A-(3-(2-(3-aminopropoxy)ethoxy)-5-methoxyphenyl)-5-(4- chlorophenyl)furan-2-carboxamide (9). To a solution of rt-butyl (3-(2-(3-(5-(4- chlorophenyl)furan-2-carboxamido)-5-methoxyphenoxy)ethoxy)propyl)carbamate (8) (0.3 g, 0.550 mmol) in di chloromethane (DCM) (5 mL) at 0 °C, HC1 (4 M in dioxane, 1 mL, 4.00 mmol) was added. The reaction mixture was slowly warmed to room temperature. After 16 hours, the reaction was concentrated, triturated with petroleum ether, and dried under vacuum to afford the title compound 9 (0.24 g, 0.529 mmol, 96 % yield) as an off-white solid. LC-MS m / z 445.1 (M+H)+.

[0635] Step 6: Preparation of (2 .3.S)- -(2-(((l / .4,S)-4-(4-(((l ,4 / ?)-4-((3-(2-(3-(5-(4- chlorophenyI)furan-2-carboxamido)-5-methoxyphenoxy)ethoxy)propyl)carbamoyl) cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)-l-methyl-5-oxo-2-(pyridin-3- yl)pyrrolidine-3-carboxamide (HI-2). To a solution of (17?,4r)-4-(4-(((15,47?)-4-(2-((2S,3S)-l- methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyl)oxy)butanamido) cyclohexane- 1 -carboxylic acid (10) (0.15 g, 0.262 mmol) in DMF (3 mL) at 0 °C, DIPEA (0.114 mL, 0.655 mmol) and HATU (0.149 g, 0.393 mmol) were added. The reaction was stirred at room temperature for 10 minutes before A-(3-(2-(3 -aminopropoxy)ethoxy)-5-methoxyphenyl)-5 - (4-chlorophenyl)furan-2-carboxamide (9) (0.128 g, 0.288 mmol) was added. After stirring for 12 hours at room temperature, the reaction was diluted with cold water (10 mL) and extracted with DCM (20 mL x 3). The combined extracts were washed with a cold brine solution (30 mL), dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the titlecompound III-2 (0.037 g, 0.034 mmol, 12.89 % yield) as an off-white solid. LC-MS m'z 999.3 (M+H)+.EXAMPLE 2 - Synthesis of (2.S.3A)-A-(2-((( 1 / ?,4.S)-4-(4-((( 1 / ?,4 / ?)-4-((2-((( 1 / ?,4 / ?)-4-(4- (((lr,47?)-4-((3-(2-(3-(5-(4-chlorophenyl)furan-2-carboxamido)-5-methoxyphenoxy)ethoxy) propyl)carbamoyl)cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyI)carbamoyl) cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)-l-methyl-5-oxo-2-(pyridin-3- yl)pyrrolidine-3-carboxamide (I1I-1)

[0636] Step 1 : Preparation of benzyl (2-((( 17?,4 )-4-(4-(((l r,4 / ?)-4-((3-(2-(3-(5-(4- chlorophenyl)furan-2-carboxamido)-5-methoxyphenoxy)ethoxy)propyl)carbamoyl) cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)carbamate (13). To a solution of compound 12 (0.2 g, 0.396 mmol) in DMF (2 mL), DIPEA (0.173 mL, 0.991 mmol) was added. The reaction was cooled to 0 °C before HATU (0.226 g, 0.595 mmol) was added. The reaction was stirred at room temperature for 10 minutes before compound 9 (0.194 g, 0.436 mmol) was added. After 12 hours, the reaction was diluted with cold water (10 mL) and extracted with DCM (20 mL x 3). The combined extracts were washed with cold water (20 mL), cold brine (20 mL), dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the title compound 13 (0.09 g, 0.092 mmol, 23.30 % yield) as an off-white solid. LC-MS m / z 931.4 (M+H)+.

[0637] Step 2: Preparation of V-(3-(2-(3-((l / ?.4r)-4-(4-((( lr.4 / ?)-4-(2-aniinoethoxy) cyclohexyl)oxy)butanamido)cyclohexane-l-carboxamido)propoxy)ethoxy)-5- methoxyphenyl)-5-(4-chlorophenyl)furan-2-carboxamide (14). To a solution of compound 13 (0.055 g, 0.059 mmol) in acetonitrile (ACN) (0.8 mL) and DCM (0.5 mL), trimethyl silyliodide (0.034 mL, 0.236 mmol) was added. The resulting mixture was stirred at room temperature for 12 hours, then diluted with water (3 mL) and extracted with DCM (5 mL x 3). The combined extracts were dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the title compound 14 (0.021 g, 0.026 mmol, 43.3 % yield) as a solid. LC-MS m / z 797.3 (M+H)+.

[0638] Step 3: Preparation of (2S.3.S)-\-(2-(((l / ?.4.S)-4-(4-(((l / ?.4 / ?)-4-((2-(((l / ?.4 / ?)-4-(4- (((lr,47?)-4-((3-(2-(3-(5-(4-chlorophenyl)furan-2-carboxamido)-5-methoxyphenoxy)ethoxy) propyl)carbamoyl)cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyI)carbamoyl) cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)-l-methyl-5-oxo-2-(pyridin-3-yl) pyrrolidine-3-carboxamide (III-l). To a solution of compound 10 (0.01 g, 0.017 mmol) in DMF (0.8 mL) and DCM (0.2 mL) at 0 °C, DIPEA (5.64 mg, 0.044 mmol) and HATU (9.96 mg, 0.026 mmol) were added. The reaction was stirred at room temperature for 10 minutes. Compound 14 (0.015 g, 0.019 mmol) was added, and the reaction was stirred at room temperature for 12 hours. Next, the reaction mixture was diluted with cold water (3 mL) andextracted with DCM (5 mL x 3). The combined extracts were washed with cold brine (10 mL), dried over anhydrous sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the title compound III-l (0.007 g, 5.13 pmol, 29.4 % yield) as an off-white solid. LC-MS m / z 1351.6 (M+H)+.EXAMPLE 3 - Synthesis of 4-((21?,3^4^51?)-3-(3,4-difluoro-2-methoxyphenyl)-4,5-dimethyl- 5-(trifluoromethyl)tetrahydrofuran-2-carboxamido)-JV-(2-(2-((l / ?,4r)-4-(4-(((Ly,4 / ?)-4-(2- ((25,35)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyl)oxy) butanamido)cyclohexane-l-carboxamido)ethoxy)ethyl)picolinamide (1-81)

[0639] Step 1: Preparation of tert-butyl ( 2-(2-( ( 1 / ?.4 / )-4-(4-( (( 1 ,S.4 / ?)-4-( 2-(( 2.S.3.S)- 1 - methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyl)oxy) butanamido)cyclohexane-l-carboxamido)ethoxy)ethyl)carbamate (17). To a stirred solution of (lA,4r)-4-(4-(((15,4A)-4-(2-((25,35)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3- carboxamido)ethoxy)cyclohexyl)oxy)butanamido)cyclohexane-l -carboxylic acid (10) (0.2 g, 0.349 mmol) in DMF (5 ml), HATU (0.199 g, 0.524 mmol) and DIPEA (0.135 g, 1.048 mmol) were added. The reaction was stirred at room temperature. After 10 minutes, tert-butyl (2-(2- aminoethoxy)ethyl)carbamate (16) (0.107 g, 0.524 mmol) was added. After 2 hours of stirring at room temperature, the reaction was quenched with cold water and extracted with DCM. The combined extracts were washed with water, dried over Na2SO i, filtered, and concentrated. The crude product was purified by neutral alumina column chromatography (2-4% DCM / MeOH) to afford the title compound 17 (240 mg, 0.316 mmol, 91 % yield) as a foamy, off-white solid. LC- MS m / z 759.4 (M+H)+.

[0640] Step 2: Preparation of (2>y,3»V)-A-(2-(((17?,45)-4-(4-(((lr,47?)-4-((2-(2-aniinoethoxy) ethyl)carbamoyl)cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)-l-methyl-5-oxo-2- (pyridin-3-yl)pyrrolidine-3-carboxamide (18). To a stirred solution of Zc / 7-butyl (2-(2- ((lA,4r)-4-(4-(((15,47?)-4-(2-((25’,3S)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyl)oxy)butanamido)cyclohexane-l-carboxamido)ethoxy)ethyl) carbamate (17) (0.25 g, 0.329 mmol) inl,4-dioxane (10 mL) at 0 °C, HC1 (4 M in 1,4-dioxane, 0.412 mL, 1.647 mmol) was added. The reaction was stirred at room temperature for 2 hours and then concentrated under reduced pressure and dried under vacuum to afford the title compound 18 (215 mg, 0.294 mmol, 89 % yield). LC-MS m / z 659.4 (M+H)~.

[0641] Step 3: Preparation of 4-((21?,35,45,51?)-3-(3,4-difluoro-2-methoxyphenyl)-4,5- dimethyl-5-(trifluoromethyl)tetrahydrofuran-2-carboxamido)-2V-(2-(2-((ll?,4r)-4-(4- (((15,47?)-4-(2-((25,35)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy) cyclohexyl)oxy)butanamido)cyclohexane-l-carboxamido)ethoxy)ethyl)picolinamide (1-81). To a stirred solution of 4-((25, 35,45, 55)-3-(3,4-difluoro-2-methoxyphenyl)-4,5-dimethyl-5- (trifluoromethyl)tetrahydrofuran-2-carboxamido)picolinic acid (19) (0.15 g, 0.316 mmol) in DMF (5 mL), (25,35)-A-(2-(((17?,45)-4-(4-(((lr,4A)-4-((2-(2-aminoethoxy)ethyl)carbamoyl) cyclohexyl)amino)-4-oxobutoxy)cyclohexyl)oxy)ethyl)-l-methyl-5-oxo-2-(pyridin-3- yl)pyrrolidine-3 -carboxamide (18) (0.167 g, 0.253 mmol), DIPEA (0.170 mL, 0.949 mmol), and HATU (0.144 g, 0.379 mmol) were added. The reaction was stirred at room temperature and monitored for completion by liquid chromatography-mass spectrometry (LCMS). After 16 hours, the reaction was quenched with cold water and extracted with DCM. The combined extracts were washed with water, dried over Na2SC>4, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the title compound 1-81 (45 mg, 0.039 mmol, 12 % yield). LC-MS m ,'z 1115.4 (M+H)+. 'H NMR (400 MHz, DMSO-d6) 8 0.73 (d, J = 6.00 Hz, 3H), 1.09-1.12 (m, 6H), 1.34-1.37 (m, 2H), 1.61-1.85 (m, 14H), 2.04-2.06 (m, 1H), 2.69-2.78 (m, 2H), 2.91-2.99 (m, 1H), 3.17-3.18 (m, 10H), 3.33-3.53 (m, 14H), 3.95 (s, 3H), 4.19 - 4.35 (m, 3H), 4.65 (d, J= 6.40 Hz, 1H), 5.12 (d, J = 10.40 Hz, 1H), 7.16 (d, J= 7.20 Hz, 2H), 7.42-7.44 (m, 1H), 7.88-7.61 (m, 3H), 7.86-7.87 (m, 1H), 8.02 (t, J = 5.60 Hz, 1H), 8.28 (d, J= 2.00 Hz, 1H), 8.49-8.51 (m, 3H), 8.66 (t, 5.60 Hz,1H).EXAMPLE 4 - Synthesis of 4-((2 / ?,35,45,5^)-3-(3,4-difluoro-2-(2-(3-((l / ?,419)-4-(4-(((15,4 / ?)-4- (2-((25',3^)-l-methyl-5-oxo-2-(pyridin-3-yl)pyrrolidine-3-carboxamido)ethoxy)cyclohexyl) oxy)butanamido)cyclohexane-l-carboxamido)propoxy)ethoxy)phenyl)-4,5-dimethyl-5- (trifluoromethyl)tetrahydrofuran-2-carboxainido)picolinamide (1-15)

[0642] Step 1 : Preparation of 2-(3-((tert-butoxycarbonyl)amino)propoxy)ethyl 4- methylbenzenesulfonate (21). To a stirred solution of te / 7-butyl (3 -(2-hydroxy ethoxy )propyl) carbamate (7) (1 g, 4.56 mmol) in ACN (5 mL) and THF (1 mL) at 0 °C, tri ethylamine (TEA) (1.384 g, 13.68 mmol) and -toluenesulfonyl chloride (Ts-Cl) (1.739 g, 9.12 mmol) were added. The reaction was slowly warmed to room temperature. After 16 hours, the reaction was concentrated under reduced pressure. The resulting residue was dissolved in water (10 mL) and extracted with EtOAc (2 x 25 mL). The combined extracts were washed with brine, dried over Na2SC>4, filtered, and concentrated under reduced pressure to afford the title compound 21 (1.2 g, 2.313 mmol, 50.7 % yield) as a pale-yellow gum. LC-MS m / z 396.2 (M+Na)+.

[0643] Step 2: Preparation of tert-butyl (3-(2-iodoethoxy)propyl)carbamate (22). Sodium iodide (0.401 g, 2.68 mmol) was added to a stirred solution of 2-(3-((tert-butoxycarbonyl)amino) propoxy)ethyl 4-methylbenzenesulfonate (21) (1 g, 2.68 mmol) in DMF (15 mL) and the reaction was stirred at room temperature for 5 minutes before being heated to 60 °C. After 16 hours, the reaction was cooled, quenched with water, and extracted with EtOAc (3 x 20 mL). The combined extracts were washed with brine, dried over sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the title compound 22 (800 mg, 2.421 mmol, 90 % yield) as a pale-yellow gum. LC-MS m / z 230.0 (M+H-Boc)+.

[0644] Step 3: Preparation of 4-((27?,3‘^45,5 / ?)-3-(3,4-difluoro-2-hydroxyphenyl)-4,5- dimethyl-5-(trifluoromethyl)tetrahydrofuran-2-carboxamido)picolinamide (24). A solution of 4-((2A,3S,45,5A)-3-(3,4-difluoro-2-methoxyphenyl)-4,5-dimethyl-5-(trifluoromethyl) tetrahydrofuran-2-carboxamido)picolinamide (23) (0.25 g, 0.528 mmol) in DCM was cooled to - 78 °C before tribromoborane (1 M in DCM, 5 mL, 5.00 mmol) was added. The reaction was slowly warmed to room temperature. After 16 hours, the reaction was quenched with a saturated NaHCOs solution and extracted with DCM (3 x 25 mL). The combined extracts were washed with brine, dried over sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by preparative supercritical fluid chromatography to afford the title product 24 (0.1 g, 0.215 mmol, 40.6 % yield) as an off-white solid. LC-MS m / z 460.1 (M+H)+.

[0645] Step 4. Preparation of tert-butyl (3-(2-(6-((27?,3^45,51?)-2-((2-carbamoylpyridin- 4-yl)carbamoyl)-4,5-dimethyl-5-(trifluoromethyl)tetrahydrofuran-3-yl)-2,3-difluorophenoxy)ethoxy)propyl)carbamate (25). To a stirred solution of 4-((2R,3S,4S,5R)-3- (3,4-difluoro-2-hydroxyphenyl)-4,5-dimethyl-5-(trifluoromethyl)tetrahydrofuran-2- carboxamido)picolinamide (24) (0.09 g, 0.196 mmol) in ACN (2 mL), / crt-butyl (3-(2- iodoethoxy)propyl)carbamate (22) (0.077 g, 0.235 mmol) was added. The reaction was stirred at room temperature for 5 minutes before being heated to 60 °C. After 6 hours, the reaction was quenched with water (3 mL) and extracted with EtOAc (3 x 10 mL). The combined extracts were washed with brine, dried over sodium sulphate, filtered, and concentrated under reduced pressure. The crude product was purified by reverse phase preparative chromatography to afford the title compound 25 (0.04 g, 0.059 mmol, 30 % yield) as an off-white solid. LC-MS m / z 561.2 (M+H-Boc)+.

[0646] Step 5. Preparation of 4-((21?,35,45,51?)-3-(2-(2-(3-aminopropoxy)ethoxy)-3,4- difluorophenyl)-4,5-dimethyl-5-(trifluoromethyl)tetrahydrofuran-2-carboxamido) picolinamide (26). HC1 (4 M in dioxane, 0.2 mL, 0.800 mmol) was added to a solution of tert- butyl (3-(2-(6-((27?, 35,45, 57?)-2-((2-carbamoylpyridin-4-yl)carbamoyl)-4,5-dimethyl-5- (trifluoromethyl)tetrahydrofuran-3-yl)-2,3-difluorophenoxy)ethoxy)propyl)carbamate (25) (0.04 g, 0.061mmol) in DCM (1 mL) at 0 °C. The reaction was slowly warmed to room temperature and stirred for 2 hours. Once complete, the reaction was concentrated, triturated with petroleum ether, and dried under vacuum to affo...

Claims

Claims:

1. A compound represented by Formula (I):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C 1-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3-C6 cycloalkylene; or X1is a covalent bond;X2is cf)-(C 1-5 alkylene)-N(H)- or a covalent bond, wherein <j) is a bond to L;Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, whereinFormula 1-1 is represented by:whereinR2and R4are independently C1-3 alkyl;R3is C1-3 haloalkyl;R?is C1-4 alkoxyl, -O-(C3-6 cycloalkyl), or C1-4 alkyl;R6represents independently for each occurrence fluoro or chloro;R7, R9, and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturated heterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from C1-4 alkyl;R8represents independently for each occurrence fluoro, chloro, or C1.4 alkyl;R11is a bond to X1; x is 0 or 1; y is 0, 1, or 2; z is 0 or 1; andL is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched C1-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(C 1-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(CI-6alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis Ce-i2linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-,wherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) O (L-c) wherein Lleis C2 -10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-; -( ) (L-e) wherein n is an integer of 3 to 50;( ) (L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2fis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and _L2giswherein n is 1, 2, 3, 4, or 5, and represents a covalent bondto Llg;*(L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L3his a bond, -C(0)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or-C(O)CH2-; and m is 1, 2, or 3;(x (L-i) wherein L11is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z5is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; L1' is -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2is Ci-6 linear alkylene or, wherein n is 1 or 2, and represents a covalent bond to Llj; and I'represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(0)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;(xiii)) wherein Z1is CH or N; m is 1 or 2; p is 1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llmis a bond,-C(O)-, -C(0)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3-6linear alkylene,***C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;), or(xv) (L-p) wherein Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atoms ofare replaced with F; Llpis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-; or(xvi)wherein RingA, Ring B, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently -O-, -NHC(O)-, or -CH2-O-;(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

2. The compound of claim 1, wherein the compound is a compound of Formula I.

3. The compound of claim 1 or 2, wherein R1is -CH3.

4. The compound of any one of claims 1-3, wherein X2is ^-CH2CH2-N(H)-.

5. The compound of any one of claims 1-4, wherein6. The compound of any one of claims 1-4, wherein Y1is one of the following:The compound of any one of claims 1-4, wherein8. The compound of any one of claims 1-4, wherein Y1is one of the following:

9. The compound of any one of claims 1-4, wherein10. The compound of any one of claims 1-4, wherein Y1is one of the following:

11. The compound of any one of claims 1- ■5 , 7, or 9, wherein:R2is methyl;R3is trifluorom ethyl; and R4is methyl.

12. The compound of any one of claims 1- ■5 , 7, 9, or 11, wherein R5is methoxy.

13. The compound of any one of claims 1- ■5 , 7, 9, or 11, wherein R5is -O-(cyclopropyl).

14. The compound of any one of claims 1- ■5 , 7, 9, or 11, wherein R5is methyl.

15. The compound of any one of claims 1- ■5 , 7, 9, or 11-14, wherein x is 1.

16. The compound of any one of claims 1-5, 7, 9, or 11-15, wherein:R6is fluoro; y is 1 or 2;R7is hydrogen;R9and R10are hydrogen; and z is 0.

17. The compound of any one of claims 1-16, wherein X1is -(C1-3 alkylene)-N(H)-'P, -(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-'P, or - (C1-3 alkylene)-N(H)-(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-T, wherein T is a bond to L.

18. The compound of any one of claims 1-16, wherein X1is -(propylene)-N(H)-vP, -(CH2CH2)-N(H)-T, or -(CH2)-N(H)-T, wherein T is a bond to L.

19. The compound of any one of claims 1-16, wherein X1is -(propylene)-O-(propylene)- N(H)-% -(CH2CH2)-O-(CH2CH2CH2)-N(H)-'P, -(CH2CH2)-O-(CH2CH2)-N(H)-T, or -(CH2)-N(H)-(CH2CH2)-O-(CH2CH2)-N(H)-T, wherein T is a bond to L.

20. The compound of any one of claims 1-16, wherein X1is -O-(C2-4 alkyl ene)-N(H)-'P or -O-(C2-3 alkylene)-O-(C2-6 alkylene)-N(H)-T, wherein T is a bond to L.

21. The compound of any one of claims 1-16, wherein X1is -O-(CH2CH2)-N(H)-T, -O- (CH2CH2CH2)-N(H)-T, -O-(CH2CH2)-O-(CH2CH2)-N(H)-T or -O-(CH2CH2)-O- (CH2CH2CH2)-N(H)-'P, wherein T is a bond to L.

22. The compound of any one of claims 1-4, wherein Y^X1- is one of the following:

23. The compound of any one of claims 1-4, wherein Y^X1- is one of the following:

25. A compound represented by Formula (II):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C 1-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3-C6 cycloalkylene; or X1is a covalent bond;X2is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein is a bond to L;Y1is defined by Formula II-l, III- 1 , or IV-1, each of which is substituted by one occurrence of R11, wherein R11is a bond to X1;Formula IT-1 is represented by:wherein:R2is Ci-3 haloalkyl, chloro, or fluoro;R3represents independently for each occurrence hydrogen, chloro, or fluoro;R4represents independently for each occurrence fluoro, chloro, C1-3 haloalkoxyl, C1-3 haloalkyl, -OH, Ci-4 alkoxyl, or C1-4 alkyl;R5is hydrogen or C1-4 alkyl;which is substituted with 0 or 1 occurrence of C1-4 alkyl;Ynis N or C(R3);Znis -O- or -CH2-; and x is 1 or 2;Formula III- 1 is represented by:wherein:Rin-irepresentsindependently for each occurrence halo;RHI-2representsindependently for each occurrence C1-4 alkoxyl or C1-4 alkyl;Rni-3 •shydrogenorQ1 4alkyl ; and x-III and y-III are independently 0, 1, or 2;Formula IV- 1 is represented by:wherein:RIV-1represents independently for each occurrence halo;RIV’2, RIV‘3, RI 4, and RIV‘5are independently hydrogen or Ci-4 alkyl; or RI 2and RIV’3or RIV'4and RIV'5are taken together with the nitrogen atom to which they are attached to form an azetidinyl, pyrrolidinyl, or piperidinyl ring; and x-IV is 0, 1, 2, 3, or 4; andL is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(C i-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(Ci-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(C i-6 alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(0)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12 linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-,-C(O)NRlb-, or -NRlbC(O)-; or L2biswherein n is 1, 2, 3, or 4, and represents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3 alkyl;(iv) 0 (L-c) wherein Llcis C2.10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; •( ) (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vi)(L-e) wherein n is an integer of 3 to 50;(vii)(L-f) wherein Llfis a bond; Ci-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L2tis a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; andL2Siswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to Llg; *(ix)(L-h) wherein each Z1is independently N orCH; L,his a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or ** , wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L311is a bond, -C(0)CH2-, -O-(C3-6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or-C(0)CH2-; and m is 1, 2, or 3;(x)(L-i) wherein L11is a bond, C1-12 linear alkylene, or*, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C 1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;(L-j) wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z~ is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; Lljis -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2' is Ci-6 linear alkylene or* 11, wherein n is 1 or 2, andrepresents a covalent bond to Llj; and " represents a single bond or a double bond;wherein Ring A is phenylene or a 5- or6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or , wherein n is 1, 2, or 3, andrepresentsa covalent bond to Llk;(L-m) wherein Z1is CH or N; m is 1 or 2; pY is 1 or 2; 0, 1, or 2 hydrogen atoms of' are replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3-6linear alkylene,* _C3-6 cycloalkylene, or, wherein n is 1 or 2, andrepresents a covalent bond to Llm;n Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llpis a bond, - C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-;(xvi)wherein RingA, Ring B, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently -O-, -NHC(O)-, or -CH2-O-; or(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with - O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, - NHC(O)-, or -C(O)NH-; wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

26. The compound of claim 25, wherein the compound is a compound of Formula II.

27. The compound of claim 25 or 26, wherein R1is -CH3.

28. The compound of any one of claims 25-27, wherein X2is <j)-CH2CH2-N(H)-.

29. The compound of any one of claims 25-28, whereinsubstituted by one occurrence of R1130. The compound of any one of claims 25-28, wherein31. The compound of any one of claims 25-30, wherein R6is32. The compound of any one of claims 25-30, wherein R6isor33. The compound of any one of claims 25-28, wherein Y1is one of the following:

34. The compound of any one of claims 25-33, wherein Ynis N.

35. The compound of any one of claims 25-33, wherein Ynis C(H).

36. The compound of any one of claims 25-35, wherein Znis -O-.

37. The compound of any one of claims 25-35, wherein Znis -CH2-.

38. The compound of any one of claims 25-37, wherein:R2is trifluoromethyl or chloro;R4represents independently for each occurrence fluoro, -OCF3, or methyl; and R3is hydrogen.

39. The compound of any one of claims 25-28, wherein Y1is one of the following:

40. The compound of any one of claims 25-28, wherein Y1is one of the following:

41. The compound of any one of claims 25-28, wherein Y1is one of the following:

42. The compound of any one of claims 25-28, wherein Y1issubstituted by one occurrence of R11.

43. The compound of any one of claims 25-28, wherein Y1is44. The compound of any one of claims 25-28, wherein Y1is45. The compound of any one of claims 25-28 or 42-44, wherein:R111 1is chloro;R111'2is -OCH3;R111'3is hydrogen; x-III is 1 or 0; and y-III is 1 or 2.

46. The compound of any one of claims 25-28, wherein Y1is47. The compound of any one of claims 25-28, wherein Y1is48. The compound of any one of claims 25-28, wherein Y1is, substituted by one occurrence of R11.The compound of any one of claims 25-28, wherein50. The compound of any one of claims 25-28, wherein51. The compound of any one of claims 25-28 or 48-50, wherein:RIV-1is chloro;RIV-2and RI 1are hydrogen;RIV'3, if present, is hydrogen; RIV'5, if present, is -CH3; and x-IV is 2, 3, or 4.

52. The compound of any one of claims 25-28, wherein53. The compound of any one of claims 25-28, wherein54. The compound of any one of claims 25-53, wherein X1is -O-(C2-4 alkylene)-N(H)-T or - O-(C2-3 alkyl ene)-O-(C2-6 alkylene)-N(H)-vP, wherein T is a bond to L.

55. The compound of any one of claims 25-53, wherein X1is -O-(CH2CH2)-N(H)-T, -O- (CH2CH2CH2)-N(H)-T, -O-(CH2)4-N(H)-T, or -O-(CH2CH2)-O-(CH2CH2CH2)-N(H)-T, wherein T is a bond to L.

56. The compound of any one of claims 25-53, wherein X1is -(C0-3 alkylene)-N(H)-'P or -(C2-3 alkylene)-O-(C2-3 alkylene)-N(H)-vP, wherein T is a bond to L.

57. The compound of any one of claims 25-53, wherein X1is -CH2-N(H)-'P, -(CH2)2-N(H)- T, -(CH2)3-N(H)-T, -(CH2)2-O-(CH2)2-N(H)-'P, -(CH2)2-O-(CH2)3-N(H)-% or -(CH2)3- O-(CH2)3-N(H)-VP, wherein T is a bond to L.

58. The compound of any one of claims 25-28, wherein Y'-X1- is one of the following:

59. The compound of any one of claims 25-28, wherein Y'-X1- is one of the following:

60. The compound of any one of claims 25-28, wherein Y'-X1- is one of the following:

61. The compound of any one of claims 25-28, wherein Y'-X1- is one of the following:

62. The compound of any one of claims 1-61, wherein L is a divalent linker of Formula (L-a-are as defined for Formula (L-a).

63. The compound of any one of claims 1-61, wherein L is a divalent linker of Formula (L-a- ii):defined for Formula (L-a); p is 1 or 2; and m is 1 or 2.

64. The compound of any one of claims 1-61, wherein L is a divalent linker of Formula (L-a-(L-a-iii) wherein p is 1 or 2; m is 1 or 2; n is 1, 2, or3; andare as defined for Formula (L-a).The compound of any one of claims 1-61, wherein L is selected from the group consisting of:, and; wherein the point of attachment indicated on the cycloalkyl-bound carbonyl group is the attachment point to X1.

66. The compound of any one of claims 1-61, wherein L is a divalent linker of Formula (L-b-(L-b-i) wherein Llb, L2b,are as defined forFormula (L-b); p is 1 or 2; and m is 1 or 2.

67. The compound of any one of claims 1-61, wherein L is selected from the group consisting of:indicated on the cycloalkyl-bound carbonyl group is the attachment point to X1.

68. The compound of any one of claims 1-61, wherein L is a divalent linker of Formula (L-, andare as defined forFormula (L-c); p is 1 or 2; and m is 1 or 2.

69. The compound of any one of claims 1-61, wherein L is selected from the group consi sting of:and; wherein the point of attachment indicated on the carbonyl group is the attachment point to X1.

70. The compound of any one of claims 1-61, wherein L is selected from the group consisting of:wherein the point of attachment indicated on the carbon-bound carbonyl group is the attachment point to X1.71 . The compound of any one of claims 1 -61 , wherein L is selected from the group consisting of:point of attachment indicated on the carbonyl group is the attachment point to X1.

72. The compound of any one of claims 1-61, wherein L is a divalent linker of Formula (L- g-i):are as defined for Formula (L-g); Z1, Z2, and Z3are each independently selected from N or CH, provided that one or two of Z1, Z2, and Z3is N.

73. The compound of any one of claims 1-61, wherein L is selected from the group consisting of:; wherein the point of attachment indicated on the carbonyl group is the attachment point to X1.

74. The compound of any one of claims 1-61, wherein L is selected from the group consisting of:indicated on the carbonyl group or cyclic group is the attachment point to X1.The compound of any one of claims 1-61, wherein L is selected from the group consisting ofindicated on the carbonyl group is the attachment point to X1.

76. The compound of any one of claims 1-61, wherein L is a selected from the group consisting of:; wherein the point of attachment indicated on the carbonyl group is the attachment point to X1.

77. The compound of any one of claims 1-61, wherein L is selected from the group consisting of:the carbonyl group is the attachment point to X1.

78. The compound of any one of claims 1-61, wherein L is(L-p) wherein Z1is CH or N; m is 1 or 2; p is 1 or2; 0, 1, or 2 hydrogen atoms ofare replaced with F; Llpis a bond, -C(O)-,-C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-.

79. The compound of any one of claims 1-61, wherein L iswherein the point of attachment indicated on the cycloalkyl-bound carbonyl group is the attachment point to X1.

80. The compound of any one of claims 1-61, wherein L is one of the following:

81. The compound of any one of claims 1-61, wherein L is one of the following:wherein the point of attachment indicated on the carbon-bound carbonyl group is the attachment point to X1.

82. The compound of any one of claims 1-61, whereintaken together are one of the following:

83. A compound in Table 1, 1-A, 2, 2-A, 3, or 4, or a pharmaceutically acceptable salt thereof.

84. A pharmaceutical composition, comprising a compound of any one of claims 1-83 and pharmaceutically acceptable carrier.

85. A method of treating or preventing a Navl ,8-associated disease or condition in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of claims 1-83 and an anti-cotinine antibody, or antigen-binding fragment thereof.

86. The method of claim 85, wherein the Navl 8-associated disease or condition is pain, cough, acute itch, or chronic itch.

87. A method of treating or preventing pain in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of claims 1-83 and an anti-cotinine antibody, or antigen-binding fragment thereof.

88. The method of claim 87, wherein the method is to treating pain.

89. The method of claim 87 or 88, wherein the pain is chronic pain.

90. The method of claim 87 or 88, wherein the pain is acute pain.

91. The method of any one of claims 87-90, wherein the pain is neuropathic pain.

92. The method of any one of claims 87-90, wherein the pain is inflammatory pain.

93. The method of any one of claims 87-92, wherein the pain is arthritis pain.

94. The method of any one of claims 87-92, wherein the pain is due to cancer.

95. The method of any one of claims 87-90, wherein the pain is complex regional pain syndrome.

96. The method of any one of claims 87-95, wherein the pain is located in the patient’s hand, wrist, arm, shoulder, back, leg, knee, ankle, foot, toe, neck, or head.

97. The method of any one of claims 87-91, wherein the pain is a neuropathic pain selected from the group consisting of low back pain, hip pain, leg pain, non-herpetic neuralgia, post-herpetic neuralgia, diabetic neuropathy pain, lumbosacral radiculopathy pain, nerve injury-induced pain, acquired immune deficiency syndrome (AIDS) related neuropathic pain, head trauma pain, phantom limb pain, multiple sclerosis pain, root avulsion pain, painful traumatic mononeuropathy, painful polyneuropathy, thalamic pain syndrome, post-stroke pain, central nervous system injury pain, post-surgical pain, carpal tunnel syndrome pain, trigeminal neuralgia pain, post mastectomy syndrome pain, post- thoracotomy syndrome pain, stump pain, repetitive motion pain, neuropathic pain associated hyperalgesia and allodynia, drug-induced pain, toxin-caused nerve injury pain, chemotherapy-caused nerve injury pain, and combinations thereof.

98. The method of any one of claims 85-97, wherein the compound and the antibody, or antigen-binding fragment thereof, are administered simultaneously.

99. The method of any one of claims 85-97, wherein the compound and the antibody, or antigen-binding fragment thereof, are administered sequentially.

100. A method of increasing antibody-dependent cell cytotoxicity (ADCC) of voltage-gated sodium channel Nav1.8-expressing cells, comprising contacting the cells with an effective amount of the compound of any one of claims 1-83 and an anti-cotinine antibody, or antigen-binding fragment thereof.101 . A method of depleting voltage-gated sodium channel Navl 8-expressing cells, comprising contacting the cells with an effective amount of the compound of any one of claims 1-83 and an anti-cotinine antibody, or antigen-binding fragment thereof.

102. A combination comprising the compound of any one of claims 1-83 and an anti-cotinine antibody, or antigen-binding fragment thereof.

103. The method of any one of claims 85-101 or the combination of claim 102, wherein the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, and a CDR3 having SEQ ID NO: 3, and the light chain comprising a CDR1 having SEQ ID NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6.

104. The method of any one of claims 85-101 or the combination of claim 102, wherein the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8.

105. The method of any one of claims 85-101, the combination of claim 102, or the method or combination of claim 103 or 104, wherein the anti-cotinine antibody is of IgGl isotype comprising a substitution in an Fc region to increase ADCC activity.

106. The method, combination, or method or combination of claim 105, wherein the substitution in the Fc region is S239D / I332E, wherein residue numbering is according to the EU Index.

107. The method of any one of claims 85-101 or the combination of claim 102, wherein the anti-cotinine antibody has a heavy chain comprising SEQ ID NO: 9 and a light chain comprising SEQ ID NO: 10.

108. A compound represented by Formula (III):or a pharmaceutically acceptable salt thereof, wherein:R1is Ci-4 alkyl or C3-6 cycloalkyl;X1is a C 1-10 bivalent saturated straight or branched hydrocarbon chain wherein one, two, three, or four methylene units of the chain are independently replaced by -N(H)-, -N(CH3)-, -O-, -C(O)-, piperidinylene, piperazinylene, or C3-C6 cycloalkylene; or X1is a covalent bond;X2is $-(Ci-5 alkylene)-N(H)- or a covalent bond, wherein is a bond to L;Y1is defined by Formula 1-1 that is substituted by one occurrence of R11, whereinFormula 1-1 is represented by:whereinR2and R4are independently C1-3 alkyl;R3is C1-3 haloalkyl;R5is Ci-4halolkoxyl;R6represents independently for each occurrence fluoro or chloro;R7, R9, and R10are independently hydrogen or C1.4 alkyl; or R9and R10are taken together with the nitrogen atom to which they are attached to form a 4 to 6 membered saturatedheterocyclic ring containing 1 or 2 nitrogen atoms, wherein the heterocyclic ring is substituted by 0, 1, or 2 substituents independently selected from Ci-4 alkyl;R8represents independently for each occurrence fluoro, chloro, or Ci-4 alkyl;R11is a bond to X1; x is 0 or 1; y is 0, 1, or 2; z is 0 or 1; andL is a divalent linker selected from:(i) a bivalent, saturated or unsaturated, straight or branched Ci-60 hydrocarbon chain, wherein 0-20 methylene units of the hydrocarbon are independently replaced with -O-, -S-, -N(H)-, -N(C i-6 alkyl)-, -OC(O)-, -C(O)O-, -S(O)-, -S(O)2-, -N(H)S(O)2-, -N(CI-6alkyl)S(O)2-, -S(O)2N(H)-, -S(O)2N(CI-6alkyl)-, -N(H)C(O)-, -N(CI-6alkyl)C(O)-, -C(O)N(H)-, -C(O)N(C i-6 alkyl)-, -OC(O)N(H)-, -OC(O)N(CI-6alkyl)-, -N(H)C(O)O- , -N(CI-6 alkyl)C(O)O-, optionally substituted 3-10 membered carbocyclyl, optionally substituted 3-10 membered heterocyclyl containing 1, 2, 3, or 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or optionally substituted 5-6 membered heteroaryl containing 1, 2, or 3 heteroatoms independently selected from nitrogen, oxygen, and sulfur;wherein Ring A and Ring B are each independently C4-6 cycloalkylene; Llais C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -O- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2ais -O-, -NHC(O)-, or -CH2-O-;(iii)) wherein Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; Llbis -CH2-NH-C(O)-, -NHC(O)-, or -C(O)NH-; L2bis C6-12linear alkylene, wherein 1, 2, 3, or 4 methylene units are replaced with -O-, -NRlb-,-C(O)NR1b-, or -NR1bC(O)-; or L2biswherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llb; and each Rlbis independently hydrogen or C1-3(iv) O (L-c) wherein Llcis C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A is C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L2cis -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-;(v) O (L-d) wherein Lldis C 12-22 linear alkylene, wherein 1, 2, 3, 4, or 5 methylene units are replaced with -NH-, -O-, -C(O)NH-, -NHC(O)-, or -NHC(O)-NH-;(vi)(L-e) wherein n is an integer of 3 to 50; “(vii)(L-f) wherein Llfis a bond; C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-, -NH-, or -C(O)-; or -(C3-6 cycloalkylene)-NHC(O)-; L21is a bond, -NHC(O)-, -C(O)NH-, or a C1-6 linear alkylene, wherein 0, 1, or 2 methylene units are replaced with -O-; and each of Z1and Z2is independently N or CH;O(viii)(L-g) wherein Ring A is a 5 to 6 membered heteroarylene having 1 or 2 nitrogen ring atoms; Llgis a bond, -CH2-, -NH-, or -O-; and***L2giswherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to L1g; *( ) (L-h) wherein each Z1is independently N orCH; Llhis a bond, -C(O)-, -C(O)-NH-, or -NHC(O)-; L2his C2-10 linear alkylene or, wherein n is 1, 2, 3, or 4, andrepresents a covalent bond to Llhrepresents a covalent bond to L3h; L311is a bond, -C(0)CH2-, -O-(C3.6 cycloalkylene)-O-, or -C(O)NH(CH2)3OCH2-; L4his a bond, -C(O)-, -CH2C(O)-, or-C(O)CH2-; and m is 1, 2, or 3;(x)(L-i) wherein L11is a bond, C i-i2linear alkylene, or* _, wherein n is 1, 2, 3, 4, or 5, and represents a covalentbond to L31andrepresents a covalent bond to NH; L21is a bond, C1-12 linear alkylene, or, wherein n is 1, 2, 3, 4, or 5, andrepresents a covalent bond to HN; and L31is a bond or -C(O)-;(xi)(L-j) wherein Z1is C, CH, or N; each of Z2, Z3, Z4and Z?is independently CH or N, provided that no more than two of Z2, Z3, Z4and Z5are N; L1jis -NH-, -C(O)NH-, -NHC(O)-, or -O-; L2jis Ci-6 linear alkylene or* , wherein n is 1 or 2, andrepresents a covalent bond to L1-"; andrepresents a single bond or a double bond;wherein Ring A is phenylene or a 5- or 6-membered heteroarylene having 1 or 2 nitrogen ring atoms; each of Z1and Z2is independently CH or N; Llkis a bond, -C(O)-, -C(O)NH-, or -NHC(O)-; and L2kis a C3-8 straight chain alkylene or, wherein n is 1, 2, or 3, andrepresents a covalent bond to Llk;o (L-m) wherein Z1is CH or N; m is 1 or 2; pY is 1 or 2; 0, 1, or 2 hydrogen atoms ofare replaced with F; Llmis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2NH-, or -NHS(O)2-; and L2mis C3-6 linear alkylene,C3-6 cycloalkylene, or, wherein n is 1 or 2, and represents acovalent bond to Llm;(xiv) onen Z1is CH or N; m is 1 or 2; p is1 or 2; 0, 1, or 2 hydrogen atomsare replaced with F; Llpis a bond, -C(O)-, -C(O)NH-, -NHC(O)-, -S(O)2-, -S(O)2NH-, or -NHS(O)2-; and L2pis -(4-6 membered saturated heterocyclylene containing 1 or 2 heteroatoms independently selected from nitrogen, oxygen, and sulfur)-C(O))-; or(xvi)wherein RingA, Ring B, Ring C, and Ring D are each independently C4-6 cycloalkylene; Llqand L3qare each independently C3-5 linear alkylene, wherein 1 or 2 methylene units are replaced with -0- or -NRa-; each Rais independently hydrogen or C1-3 alkyl; and L2qand L3qare each independently -O-, -NHC(O)-, or -CH2-O-;(xvii) O (L-r) wherein Llrand L2rare each independently C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; Ring A and Ring B are each independently C4-6 cycloalkylene or C7-9 bridged bicyclic cycloalkylene; and L3ris -O- or a saturated C2-10 linear alkylene, wherein 1, 2, or 3 methylene units are replaced with -O-, -NH-, -NHC(O)-, or -C(O)NH-; wherein eachrepresents a covalent bond to X1, and eachrepresents a covalent bond to X2.

109. The compound of claim 108, wherein the compound is a compound of Formula III.

110. The compound of claim 108 or 109, wherein R1is -CH3.

111. The compound of any one of claims 108-110, wherein X2is $-CH2CH2-N(H)-.

112. The compound of any one of claims 108-111, wherein Y1is113. The compound of any one of claims 108-111, wherein Y1is one of the following:

114. The compound of any one of claims 108-111, wherein Y1is115. The compound of any one of claims 108-111, wherein Y1is one of the following:

116. The compound of any one of claims 108-111, wherein Y1is117. The compound of any one of claims 108-111, wherein Y1is one of the following:

118. The compound of any one of claims 108-112, 114, or 116, wherein:R2is methyl;R3is trifluoromethyl; andR4is methyl.

119. A compound in Table 1-B, or a pharmaceutically acceptable salt thereof.

120. A pharmaceutical composition, comprising a compound of any one of claims 108-119 and pharmaceutically acceptable carrier.

121. A method of treating or preventing a Nav1.8-associated disease or condition in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of claims 108-119 and an anti-cotinine antibody, or antigen-binding fragment thereof.

122. The method of claim 121, wherein the Nav1.8-associated disease or condition is pain, cough, acute itch, or chronic itch.

123. A method of treating or preventing pain in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of claims 108-119 and an anti-cotinine antibody, or antigen-binding fragment thereof.

124. The method of claim 123, wherein the method is to treating pain.

125. The method of claim 123 or 124, wherein the pain is chronic pain.

126. The method of claim 123 or 124, wherein the pain is acute pain.

127. The method of claim 123 or 124, wherein the pain is a neuropathic pain selected from the group consisting of low back pain, hip pain, leg pain, non-herpetic neuralgia, post- herpetic neuralgia, diabetic neuropathy pain, lumbosacral radiculopathy pain, nerve injury-induced pain, acquired immune deficiency syndrome (AIDS) related neuropathic pain, head trauma pain, phantom limb pain, multiple sclerosis pain, root avulsion pain, painful traumatic mononeuropathy, painful polyneuropathy, thalamic pain syndrome, post-stroke pain, central nervous system injury pain, post-surgical pain, carpal tunnel syndrome pain, trigeminal neuralgia pain, post mastectomy syndrome pain, post- thoracotomy syndrome pain, stump pain, repetitive motion pain, neuropathic pain associated hyperalgesia and allodynia, drug-induced pain, toxin-caused nerve injury pain, chemotherapy-caused nerve injury pain, and combinations thereof.

128. A method of increasing antibody-dependent cell cytotoxicity (ADCC) of voltage-gated sodium channel Nav1.8-expressing cells, comprising contacting the cells with an effective amount of the compound of any one of claims 108-119 and an anti-cotinine antibody, or antigen-binding fragment thereof.

129. A method of depleting voltage-gated sodium channel Navl 8-expressing cells, comprising contacting the cells with an effective amount of the compound of any one of claims 1 OS- 119 and an anti-cotinine antibody, or antigen-binding fragment thereof.

130. A combination comprising the compound of any one of claims 108-119 and an anti- cotinine antibody, or antigen-binding fragment thereof.

131. The method of any one of claims 121-129 or the combination of claim 130, wherein the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a CDR1 having SEQ ID NO: 1, a CDR2 having SEQ ID NO: 2, and a CDR3 having SEQ ID NO: 3, and the light chain comprising a CDR1 having SEQ ID NO: 4, a CDR2 having SEQ ID NO: 5, and a CDR3 having SEQ ID NO: 6.

132. The method of any one of claims 121-129 or the combination of claim 13, wherein the anti-cotinine antibody has a heavy chain and a light chain, the heavy chain comprising a heavy chain variable region (VH) having SEQ ID NO: 7, and the light chain comprising a light chain variable region (VL) having SEQ ID NO: 8.

Images