Ca19-9 binding molecule

Abstract

The invention relates to binding molecule-payload conjugates (BPCs) comprising a binding molecule and one or more payload moieties, wherein the binding molecule specifically binds to CA19-9, such as for use in the treatment of pancreatic ductal adenocarcinoma (PDAC).

Description

[0001] P129624PCT CA19-9 BINDING MOLECULE FIELD OF THE INVENTION The present application is in the field of binding molecule-payload conjugates (BPCs), and specifically antibody-drug conjugates (ADCs) which comprise a binding molecule and one or 5 more payload moieties, wherein the binding molecule specifically binds to CA19-9. BACKGROUND TO THE INVENTION The Sialyl Lewis A (sLea) antigen is an epitope present on Carbohydrate Antigen 19-9 (CA19- 9), that has been shown to be overexpressed on epithelial cell tumors (Magnani et al., 1982, J Biol Chem.257:14365-14369; Magnani et al., 1983, Cancer Res.43:5489-5492). sLeais an 10 oligosaccharide expressed primarily as a proteoglycan that is secreted and circulates as a mucin form, and also as a less well studied glycolipid form (Magnani et al., 1983, Cancer Res. 43:5489-5492; Ringel et al., 2003, Mol Cancer 2:9). The sLeaantigen is expressed predominantly on cancer cells (Kannagi et al., 2007, Chang Gung Med J.30:189-209). As a ligand for E selectin, sLeafacilitates tumor adhesion and extravasation, key events for tumor 15 metastasis, and is thus a marker of an aggressive tumor phenotype (Sato et al., 1997, Anticancer Res.17:3505-3511). Glycolipids, such as sLea, are established targets for cancer immunotherapies (Feizi, 1985, Nature 314:53-57). CA19-9 is widely expressed on tumors of the gastrointestinal tract, with up to 94% of pancreatic cancers positive for CA19-9 expression and high expression rates also seen in bile duct carcinomas and transitional cell carcinomas 20 (Loy et al., 1993, Am J Clin Pathol. 99:726-728; Passerini et al., 2012, Am J Clin Pathol 138:281-287). Additionally, expression of CA19-9 is frequently seen in ovarian, colon, stomach, and distal esophagus / stomach cancers. Circulating serum levels of CA19-9 have been validated as a biomarker for assessing the metastatic potential of pancreatic ductal adenocarcinomas (PDAC) (Ballehaninna and 25 Chamberlain, 2012, J Gastrointest Oncol. 3(2):105-119; Dong, 2014, World J Surg Oncol. 12:171) and have been used to evaluate the aggressiveness of other epithelial cell cancers (Locker et al., 2006, J Clin Oncol.24:5313-5327; Nakayama, 1995, Cancer 75:2051-2056). As a known ligand for endothelial leukocyte adhesion molecules, CA19-9 expression is associated with increased metastatic potential in colon cancer (Matsui et al., 2004, Jpn J Clin 30 Oncol.34:588-593; Ben-David, 2008, Immunol Lett.116:218-224; Sato et al., 1997, Anticancer Res. 17:3505-3511) and pancreatic adenocarcinoma (Kishimoto et al., 1996, Int J Cancer 69:290-294). Serum CA19-9 levels have also been found to be informative with respect to 1 P129624PCT prognosis and treatment effect in subjects with pancreatic cancer, with several studies correlating increasingly higher serum levels with poorer survival outcomes (Ballehaninna and Chamberlain, 2012, J Gastrointest Oncol.3(2):105-119; Berger et al., 2004, Ann Surg Oncol. 11:644-649; Dong et al., 2014, World J Surg Oncol.12:171). In a phase I / II clinical trial of nab- 5 paclitaxel and gemcitabine in subjects with advanced pancreatic cancer, decreases in CA19- 9 levels correlated with tumor response, PFS, and OS (Von Hoff et al., 2011, J Clin Oncol. 29:4548-4554). In a phase II study of 5-fluorouracil-based chemoradiotherapy in subjects with locally advanced pancreatic cancer, a greater than 90% reduction in CA19-9 levels from baseline was associated with significantly improved median survival time, with a multivariate 10 analysis finding a-post therapy CA19-9 level of less than 85.5 u / mL to be an independent prognostic factor for survival (Yang et al., 2013, J Gastrointest Oncol.4:361-369). Serum CA19-9 levels may also be informative in other tumor types. In subjects with hepatocellular carcinoma, elevated CA19-9 levels were associated with increased mortality (Hsu et al., 2015, Clin Transl Gastroenterol.6:e74). In a study of 43 breast cancer subjects 15 with infiltrating ductal carcinoma, sLeawas found in 79% of specimens, with higher levels of expression correlating with greater nodal involvement (Steplewska-Mazur et al., 2000, Hybridoma 19:129-133). Pancreatic ductal adenocarcinoma (PDAC) is one of the most aggressive and difficult to treat human cancers. In 2015, there were an estimated 46,960 new cases of PDAC diagnosed in 20 the United States and 40,560 deaths from this disease (NCI 2015). Despite best available therapies, the 5-year overall survival rate remains a dismal 7.2%, a rate that has remain essentially unchanged since 1975 (NCI 2015). Currently, pancreatic cancer accounts for 3% of all newly diagnosed cancers in the United States, a figure that continues to rise, and is responsible for 7% of all cancer deaths. For the small percentage of subjects diagnosed with 25 early stage pancreatic cancer, a cure may be possible with surgery; however, approximately 90% of subjects initially present with advanced / unresectable disease (NCI 2015). Stage at diagnosis is prognostic for survival, though even subjects with localized disease and the best prognosis tend to have poor outcomes, with a 5-year survival rate of only 27%. Pancreatic cancer is considered to be resistant to most available chemotherapy and irradiation 30 regimens. Response to immunotherapies has been poor, possibly related to the presence of thick stroma surrounding the tumor, which has, until recently, rendered immunotherapy ineffective (Brower, 2014, J Natl Cancer Inst.106(12)). P129624PCT There have been modest improvements in treatment options for subjects with metastatic pancreas adenocarcinoma. The FOLFIRINOX chemotherapy regimen demonstrated improvements in tumor response, progression-free survival (PFS) and overall survival (OS) benefit compared to single agent gemcitabine (Conroy et al., 2011, N Engl J Med.364:1817- 5 1825). More recently, the combination of nab-paclitaxel (nanoparticle albumin-bound paclitaxel; Abraxane®) and gemcitabine demonstrated improvements in tumor response rate and PFS, with an OS benefit of approximately 2 months compared with gemcitabine alone. Based on these data, the combination of nab-paclitaxel and gemcitabine is a current standard of care as first-line therapy in pancreatic cancer subjects with good performance status (von 10 Hoff et al., 2013, N Engl J Med.369:1691-1703). Still, substantial improvements in treatment outcomes for pancreatic cancer subjects remain elusive. New therapies that extend survival in the absence of significant toxicity would substantially impact the outcome and quality of life for subjects with this disease. Antibody-drug conjugates (ADCs) comprise biologically active small molecule compounds 15 conjugated to monoclonal antibodies or antibody fragments by chemical methods, so as to fully utilize antibodies’ binding specificity to normal cell and to tumor cell surface antigens, and small molecule’s high anti-tumor biological activity, while avoiding defects such as the low specific efficacy of the former as well as toxic side effects of the latter. Compared with traditional chemotherapeutic or targeted drugs, antibody-drug conjugates can more accurately 20 bind to tumor cells and reduce their effects on normal cells. There is an unmet need for safe and effective treatments for CA19-9-positive cancers, in particular pancreatic cancers such as PDAC. SUMMARY OF THE INVENTION The present invention provides a binding molecule-payload conjugate (BPC) comprising a 25 binding molecule and one or more payload moieties; wherein: a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein the binding molecule specifically binds to CA19-9; and 30 b) the one or more payload moieties is covalently linked to the binding molecule. In some embodiments, the one or more payload moieties is covalently linked to the binding P129624PCT molecule via one or more linkers. In some embodiments, the BPC according to the invention comprises at least one of HCDRs 1-3 and / or LCDRs 1-3 selected from: a) HCDR1 comprising an amino acid sequence according to SEQ ID NO: 1, 5 b) HCDR2 comprising an amino acid sequence according to SEQ ID NO: 2, c) HCDR3 comprising an amino acid sequence according to SEQ ID NO: 3, d) LCDR1 comprising an amino acid sequence according to SEQ ID NO: 4, e) LCDR2 comprising an amino acid sequence according to SEQ ID NO: 5, and f) LCDR3 comprisng an amino acid sequence according to SEQ ID NO: 6. 10 The at least one of HCDRs 1-3 and / or LCDRs 1-3 may comprise one, two or three amino acid mutations relative to the recited sequences. The present invention provides a binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain 15 complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, LCDR1 comprises an amino acid 20 sequence according to SEQ ID NO: 4, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 5, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, 25 optionally via one or more linkers. The invention provides a binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity 30 determining regions (LCDRs) 1-3 according to the Kabat numbering scheme, wherein: P129624PCT HCDR1 comprises an amino acid sequence according to SEQ ID NO: 15, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 16, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid 5 sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. 10 The invention provides a binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Chothia numbering scheme, 15 wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 20, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 21, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid 20 sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. 25 The binding molecule according to the invention may comprise a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID NO: 7 or a variant having at least 80% sequence identity thereto, and / or a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8 or a variant having at least 80% sequence identity thereto. 30 In some embodiments, the binding molecule further comprises an Fc region. The Fc region may be a modified Fc region. In some embodiments, the Fc region comprises an amino acid substitution at position 234, or P129624PCT an amino acid substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme. The one or more amino acid substitution(s) may be selected from the group consisting of: 5 a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); b) L234A, L235A, and K322A (LALA-KA); c) L234S, L235T, and G236R (STR); and d) L234A and L235A (LALA). In some embodiments, the BPC is an antibody drug conjugate (ADC), wherein the binding 10 molecule comprises a heavy chain and a light chain. The heavy chain may comprise an amino acid sequence according to SEQ ID NO: 10, or a variant having at least 80% sequence identity thereto. Alternatively, the heavy chain may comprise an amino acid sequence according to SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 or SEQ ID NO: 14, or a variant having at least 80% sequence identity thereto. The light chain may comprise an amino acid sequence 15 according to SEQ ID NO: 9, or a variant having at least 80% sequence identity thereto. In some embodiments, the linker comprises or is a peptide linker. The linker may comprise a first conjugation moiety for coupling with the binding molecule. The linker may comprise a second conjugation moiety for coupling with the payload moiety. The linker may comprise a peptide linker selected from AA1, AA1-Gly, Val-Cit, Val-Ala, Val- 20 AA1, Val-AA1-Gly, AA1-Ala-Asn, Ala-Ala-Ala, Ala-Ala-Asn and Gly-Gly-Phe-Gly. P129624PCT In some embodiments, the payload moiety is selected from a drug, a detectable marker, a 5 radioisotope, a fluorescent agent, a luminescent agent, a colored agent, an enzyme, polyethylene glycol, a nuclide, a nucleic acid, a small molecule toxin, a polypeptide having binding activity, a protein, a receptor, a ligand, another active agent that inhibits tumor cell growth, promotes tumor cell apoptosis or necrosis. In some embodiments, the payload moiety is a drug. The drug may be a cytotoxic drug, 10 immune modulator, or a STING inhibitor. In some embodiments, the payload or payload-linker comprises a structure shown as formula (III-A): or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a 15 pharmaceutically acceptable salt thereof, wherein R1is selected from the group consisting of: -O-, -(R2)N-, -P(=O)(R2)- and -S-; P129624PCT X is -L1-CH2-C(O)-; L1is -(C(R3a)(R3b))m-, wherein 0 or at least 1 methylene unit of L1is independently replaced by -C(O)-, -C(=S)-, -C(=NR4b)- or -C(=N2)-; wherein each R2, each R3a, each R3band each R4bare each independently hydrogen, protium, 5 deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, - C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, -S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), - OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Ra and each Rb are each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - 10 C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m is selected from the group consisting of integers ≥ 0, when R1is -O- or -HN-, at least 1 methylene unit of L1is independently replaced by -C(O)-, - C(=S)-, -C(=NR4b)- or -C(=N2)-, or each R3aand each R3bare not both hydrogen. 15 The payload-linker moiety of the conjugate may have the following structure: . In some embodiments, the payload-linker comprises a structure shown as formula (II-A): P129624PCT or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein, X1is saturated C, and X1is substituted with Rn; 5 ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated carbocyclyl, wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is substituted with p L2, and L2is not Rn; 10 or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, -15 C(O)O-, -NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, - C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, -20 C(O)O-, -NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, - C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; P129624PCT wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, - S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic 5 group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; 10 m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1. The payload-linker moiety may have the structure: . In some embodiments, the conjugate has the structure represented by formula I: 15 P129624PCT or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein, BM is the binding molecule; 5 each Z is independently selected from a direct bond, a carbon-carbon triple bond, a carbon- carbon double bond, and amido (preferably selected from a direct bond, a carbon- 10 carbon triple bond, and a carbon-carbon double bond); Rx and Ry are each independently selected from H and C1-4 alkyl; each m is independently selected from 0, 1, 2, 3, 4, 5 and 6; y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 15 (such as 6-15); 15 each y3 is independently selected from 1, 2, and 3; each y4 is independently selected from 0 and 1; position 1 is attached to BM via an S atom, and position 2 is attached to L2or L3; L2is absent or present, and when L2is present, L2is selected from: , P129624PCT and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 10 (such as 6-10); each y3 is independently selected from 1 or 2; each 5 y4 is independently selected from 0 and 1, position 1 is attached to L1, and position 2 is attached to L3; L3is selected from an amino acid residue or a short peptide consisting of 2-10 amino acid residues; the amino acid residue is selected from natural amino acid residues, non- natural amino acid residues, or selected from amino acid residue represented by AA110 or stereoisomer thereof; ; in the amino acid residue represented by AA1, any one of Raand Rbis H, and Rb, together with the carbon atom to which they are both attached, form a 5-6 membered heterocyclic ring, and said 5-6 membered heterocyclic ring is piperidine 15 ring or piperazine ring. r, r1, r1aand r1bare each independently 0, 1, 2, 3, 4 or 5; Rm1, Rn1, Rm1a, Rn1a, Rm1band Rn1bare each independently H, C1-6alkyl or -COORx1, wherein, Rx1is C1-6alkyl; or, Rm1and Rn1, Rm1aand Rn1a, and Rm1band Rn1b, together with the nitrogen atom to which 20 they are both attached, form a 5-6 membered heterocyclic ring, and of said 5-6 membered heterocyclic ring, the heteroatom is selected from 1 or 2 N atoms; the said 5-6 membered heterocyclic ring is optionally substituted with one or more R0’; Rzis selected from C1-6alkyl; P129624PCT R0and R0’are each independently selected from C1-6alkyl, -NRm2Rn2or 5-6 membered heterocyclyl optionally substituted with C1-6alkyl; of said 5-6 membered heterocyclyl, the heteroatom is selected from 1 or 2 N atoms; Rm2and Rn2are each independently selected from H and C1-6alkyl; 5 position 2 is attached to D; 10 R1and R2are each independently selected from H, halogens and C1-4 alkyl; or, R1and R2, together with the carbon atom to which they are both attached form a 5-6 membered heterocyclic ring, the heterocyclic ring contains 1, 2, or 3 of O, S, or N or any combination thereof; R3is selected from H and C1-4alkyl; or R3and X, together with the carbon atom to which they 15 are both attached, form a 5-6 membered carbon ring; W is absent or present, when W is present, W is selected from -O-, -S-, -NR4-, and , position 1 is attached to X, and position 2 is attached to L4or L3; X is selected from optionally substituted -(CH2)n1- position 1 is attached to the parent ring and position 2 is attached to W or L4; the 20 substituent is selected from one or two C1-4 alkyls; P129624PCT R4, R5, and R7are each independently selected from H and C1-4 alkyl; n, n1, n2, n3 are each independently selected from any integer between 0 and 6. The linker-payload moiety may comprise the structure: 5 The invention also provides an antibody comprising: a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, HCDR2 10 comprises an amino acid sequence according to SEQ ID NO: 2, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 4, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 5, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or 15 three amino acid mutations relative to the recited sequences; and b) a modified Fc region. The invention provides an antibody comprising: a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Kabat numbering 20 scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 15, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 16, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid P129624PCT sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) a modified Fc region. 5 The invention provides an antibody comprising: a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Chothia numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 20, HCDR2 10 comprises an amino acid sequence according to SEQ ID NO: 21, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises 15 one, two or three amino acid mutations relative to the recited sequences; and b) a modified Fc region. The antibody may comprise a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID NO: 7 or a variant having at least 80% sequence identity thereto. The antibody may comprise a light chain variable region (VL) comprising an amino 20 acid sequence according to SEQ ID NO: 8 or a variant having at least 80% sequence identity thereto. In some embodments, the Fc region comprises an amino acid substitution at position 234, or an amino acid substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 25 234, 235 and 236, according to the EU numbering scheme. The one or more amino acid substitution(s) may be selected from the group consisting of: a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); b) L234A, L235A, and K322A (LALA-KA); c) L234S, L235T, and G236R (STR); and 30 d) L234A and L235A (LALA). The invention also provides a method for producing a BPC according to the invention, P129624PCT comprising contacting an antibody according to the invention with a suitable linker-payload compound. The invention also provides one or more nucleic acid sequence(s) encoding a binding molecule as defined herein or an antibody according the invention. The one or more nucleic 5 acid sequence(s) may be an RNA sequence. The invention provides a BPC according to the invention for use in a method of therapy or a diagnostic method. The invention provides an antibody according to the invention for use in method of therapy or a diagnostic method. 10 The method may be a method of treating, preventing or diagnosing cancer. The cancer may express CA19-9. In some embodiments, the cancer is gastrointestinal cancer, pancreatic cancer, ovarian cancer, colorectal cancer, stomach cancer, oesophageal cancer, endometrial cancer, breast cancer, bile duct carcinoma, transitional cell carcinoma, or hepatocellular carcinoma. In 15 preferred embodiments, the cancer is pancreatic ductal adenocarcinoma (PDAC). BRIEF DESCRIPTION OF THE DRAWINGS Figure 1 – A) ADCC assay with 5B1-Fc-inert mAb variants. B) CDC assay with 5B1-Fc-inert mAb variants. C) ADCC assay with 5B1-Fc-inert ADC variants. D) CDC assay with 5B1-Fc- inert ADC variants. Fc-inert variants = STR, LALA, LALA-KA, LALA-deltaA. 20 Figure 2 – A) Injection schedule for 5B1-ADC (ADC-1) in BxPC3 tumor mouse model. B) 5B1- ADC treatment leads to potent elimination of advanced human PDAC tumor xenograft in mice. Hsd:Athymic Nude-Foxn1 nu / nu mice (n=14) carrying a s.c. human pancreatic ductal adenocarcinoma (BxPC3) xenograft were treated q1w with in total of seven i.p. doses of 3 or 8 mg / kg 5B1-ADC, 8 mg / kg ctrl IgG-ADC or the naked 5B1 mAb. Tumor growth was monitored 25 three times a week. C) The body weight of each mouse was examined twice per week using a laboratory scale. D) Kaplan-Meier survival curves of mice with indicated treatments. Figure 3 – A) Injection schedule for 5B1-ADC (ADC-2 and ADC-3) in BxPC3 tumor mouse model. B) 5B1-ADC treatment leads to potent elimination of advanced human PDAC tumor xenograft in mice. Hsd:Athymic Nude-Foxn1 nu / nu mice (n = 13-14) carrying a s.c. human 30 pancreatic ductal adenocarcinoma (BxPC3) xenograft were treated q1w with in total seven ip doses of 3 or 8 mg / kg 5B1-ADC linker 1 (L1; [ADC-3]), 3 or 8 mg / kg 5B1-ADC linker 2 (L2; P129624PCT [ADC-2]), 8 mg / kg ctrl IgG-ADC (comp. [ADC-2]) or the naked 5B1 mAb. Tumor growth was monitored three times a week. C) The body weight of each mouse was examined twice per week using a laboratory scale. D) Kaplan-Meier survival curves of mice with indicated treatments. 5 Figure 4 – Cell binding of 5B1-ADC Fc-inert was evaluated in four human cancer cell lines using flow cytometry. The test and control items were added to the target-positive COLO 205 (A), HT-1197 (B) and BxPC3 (C) cells as well as target-negative SK-OV-3 cell line (D) at concentrations ranging from 0.046 to 300 nM. A PE-conjugated anti-human IgG Fc antibody was used as a secondary antibody. Data are presented as mean ± SEM (technical replicate, 10 n=2). Figure 5 – (A) CDC activity of 5B1-ADC Fc-inert and the positive control 5B1-mAb Fc-comp. The test items were serially diluted and added to CA19-9-positive CHO-K1-CA19-9 target cells. Pooled normal human serum was then added to a final concentration of 25% and the samples were incubated for 4 h at 37°C and 5% CO2. Luciferase activity was measured as 15 readout for cell lysis. Means of three technical replicates ± SD are shown. (B) ADCC activity of 5B1-ADC Fc-inert and the positive control 5B1-mAb Fc-comp. The test items were serially diluted and added to CA19-9-positive COLO 205_luc target cells. Human PBMCs were then added at an E:T ratio of 40:1, and the samples were incubated for 12 h at 37°C with 5% CO2.Luciferase activity was measured as readout for cell lysis. Data are presented as mean ± SD 20 (technical replicates, n=3). Figure 6 – The ADCP activity of 5B1-ADC Fc-inert was evaluated in four human cancer cell lines using flow cytometry. M2c macrophages were added to the CellTrace Far Red dye labeled target-positive COLO 205 (A), HT-1197 (B) and BxPC3 (C), as well as target-negative SK-OV-3 cells (D) at an E:T ratio of 4:1. The test and control items were added at 25 concentrations ranging from 0.001 to 101 nM and incubated for four hours. An anti-human CD14 antibody was used to detect the effector cells via flow cytometry. The samples were gated for CellTrace Far Red and CD14 double positive cells and the proportion of double positive cells in CellTrace Far Red positive cells was calculated. Data are presented as mean ± SEM (technical replicates, n=3). 30 Figure 7 – Anti-proliferation effect of 5B1-ADC Fc-inert and control items in target-positive COLO 205 (A), HT-1197 (B) and BxPC3 (C), as well as target-negative SK-OV-3 (D) cells. Target cells were incubated with the test and control items at concentrations ranging from P129624PCT 0.001 nM to 200 nM for five days. Cell viability was measured using the CellTiter-Glo luminescent cell viability assay. Data are presented as mean ± SEM (technical replicates, n=3). Figure 8 – Internalization of Fc-inert 5B1-ADC and control items by target-positive COLO 205 5 (A), HT-1197 (B) and BxPC3 (C), as well as target-negative SK-OV-3 (D) cells, as determined by flow cytometry. The test and control items were labeled with the pH-sensitive fluorescent dye pHrodo and added to the target cells at a concentration of 40 nM. The samples were incubated for the indicated time points and analyzed by flow cytometry. Data are represented as mean ± SEM (technical replicates, n=2). 10 Figure 9 – Cell cycle analysis of COLO 205 (A) and BxPC3 (B) cells 24 hours post-treatment with DXd, Fc-inert 5B1-ADC and ADC control. The cell cycle of COLO 205 (A) and BxPC3 (B) cells was analyzed 24 h post treatment with 5B1-ADC Fc-inert or control items by measuring BrdU incorporation and DNA content via flow cytometry. DXd served as positive and BNT- ADC-IC as negative control. Data are presented as mean ± SEM (technical replicates, n=2). 15 * p < 0.05; ** p < 0.01; *** p < 0.001; **** p < 0.0001 compared to the control group. Figure 10 – Cell apoptosis in COLO 205 (A) and BxPC3 (B) cells 48 hours post treatment with 5B1-ADC Fc-inert, ADC-IC and DXd. Cell apoptosis was measured 48 h post treatment of COLO 205 (A) and BxPC3 (B) cells with 5B1-ADC Fc-inert or control items. Cells were stained with FITC-Annexin V and propidium iodide and analyzed by flow cytometry. Data are 20 presented as mean ± SEM (technical replicates, n=2). *p<0.05, **p<0.01, ***p<0.001 ****p<0.0001. Figure 11 – Bystander killing activity of 5B1-ADC Fc-inert. Target-negative SK-OV-3 cells were co-cultured with target-positive COLO 205 (A) or BxPC3 cells (B) at a ratio of 1:3 for 5 days. Bystander activity was measured by luciferase activity. Data are represented as mean ± SEM 25 (technical replicates, n=3). Figure 12 – Tolerability and therapeutic efficacy of 5B1-ADC Fc-inert in a human pancreas carcinoma CDX model. The study animals were injected with test and control items on Day 34 and received a total of six dose administrations on a weekly basis (dotted lines in A and B). On the day of tumor cell inoculation, each group comprised 15 mice (n = 15). However, the 30 number of mice per group differed over the study period due to premature death or euthanasia in accordance with GV-SOLAS guidelines. A) Mouse body weights were monitored at various time points throughout the experiment. Body weights are shown as means ± SEM. B) Tumor P129624PCT volumes were calculated based on the length and width of the tumor mass in each mouse. Mean tumor volumes ± SEM are shown. LOCF was used to impute missing data. C) Kaplan- Meier estimators of survival to visualize the therapeutic efficacy of 5B1-ADC Fc-inert. 5B1- ADC Fc-inert at 3 and 8 mg / kg were compared to 5B1-mAb Fc-comp, 5B1-ADC Fc-comp and 5 DPBS. *p<0.05, **p<0.01, ***p<0.001 ****p<0.0001. Figure 13 – Tolerability and therapeutic efficacy of 5B1-ADC Fc-inert in a human colon carcinoma CDX model. The study animals were injected with test and control items on Day 34 and received a total of six dose administrations on a weekly basis (dotted lines in A and B). On the day of tumor cell inoculation, each group included 20 mice (n = 20). However, the 10 number of mice per group differed over the study period due to premature death or euthanasia in accordance with GV-SOLAS guidelines. A) Mouse body weights were monitored at various time points throughout the experiment. Body weights are shown as means ± SEM. B) Tumor volumes were calculated based on the length and width of the tumor mass in each mouse. Mean tumor volumes ± SEM are shown. LOCF was used to impute missing data. *p<0.05, 15 **p<0.01, ***p<0.001 compared to the DPBS control group. C) Kaplan-Meier estimators of survival to visualize the therapeutic efficacy of 5B1-ADC Fc-inert. Figure 14 – Tolerability and therapeutic efficacy of 5B1-ADC Fc-inert in a human pancreas ductal adenocarcinoma CDX model. The study animals were injected with test and control items on Day 5 and received a total of four doses on a weekly basis (dotted lines). On the day 20 of tumor cell inoculation, each group included 10 mice (n = 10). However, the number of mice per group differed over the study period due to premature death or euthanasia in accordance with GV-SOLAS guidelines. A) Mouse body weights were monitored at various time points throughout the experiment. Body weights are shown as means ± SEM. B) Tumor volumes were calculated based on length and width of the tumor mass in each mouse. Mean tumor 25 volumes ± SEM are shown. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001 compared to the DPBS control group. DETAILED DESCRIPTION OF THE INVENTION Binding molecule The present invention provides a binding molecule-payload conjugate (BPC) comprising a 30 binding molecule and one or more payload moieties, wherein the binding molecule specifically binds to CA19-9. 19 P129624PCT In some embodiments, CA19-9 is considered the antigen of the binding molecules according to the present invention. In some embodiments “specifically binds to” may indicate that the binding molecule binds to the antigen, i.e. CA19-9 in preference to other antigens. 5 In embodiments, it will be understood herein that “specifically binds to” refers to the antibody- like binding of the binding molecule, which may be via heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3, to the target CA19-9. Thus, in embodiments, it will be understood herein that the term “specifically” does not exclude the binding molecule from having other targets. 10 The term “CA19-9” relates to Carbohydrate Antigen 19-9 and includes any modifications which can comprise the Sialyl Lewis A (sLea) antigen epitope. The sLeaantigen may have the following structure: In some embodiments, the binding molecule does not show cross reactivity to sLex, Leaand / or 15 LeYantigens. Suitable assays and techniques for measuring / quantifying binding activity of the binding molecule according to the invention may include, but are not limited to, ELISA, surface plasmon resonance (SPR), bio-layer interferometry (BLI), quartz crystal microbalance (QCM), bioluminescence assays and flow cytometry. Other suitable techniques will be known in the 20 art. For example, it will be understood that EC50 is a measure of the concentration of a binding molecule that induces a specific response that is 50% between the maximum response and the baseline response. As such, EC50 can be used to assess the ability of a binding molecule to bind to a target. The binding molecule according to the present invention is an antibody or a fragment thereof. P129624PCT The term “antibody” refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, and includes any molecule comprising an antigen binding portion thereof. The term “antibody” includes monoclonal antibodies and fragments or derivatives of antibodies, including, without limitation, human antibodies, 5 humanized antibodies, chimeric antibodies, single chain antibodies, e.g., scFvs and antigen- binding antibody fragments such as Fab and Fab' fragments and also includes all recombinant forms of antibodies, e.g., antibodies expressed in prokaryotes, unglycosylated antibodies, and any antigen-binding antibody fragments and derivatives as described herein. Within an antibody, each heavy chain is comprised of a heavy chain variable region 10 (abbreviated herein as VH) and a heavy chain constant region, and each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more 15 conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various 20 cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system. A CDR refers to one of three hypervariable regions (H1, H2 or H3) within the non-framework region of the immunoglobulin (Ig or antibody) VH β-sheet framework, or one of three hypervariable regions (L1, L2 or L3) within the non-framework region of the antibody VL β- 25 sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains (Kabat et al., 1977, J. Biol. Chem. 252:6609-6616; Kabat, 1978, Adv. Prot. Chem.32:1-75). CDR region sequences also have been defined structurally by Chothia 30 as those residues that are not part of the conserved β-sheet framework, and thus are able to adapt different conformations (Chothia and Lesk, 1987, J. Mol. Biol. 196:901-917). Alternatively, IMGT or EU numbering may be used. These terminologies are well recognized in the art. The positions of CDRs within a canonical antibody variable domain have been P129624PCT determined by comparison of numerous structures (Al-Lazikani et al., 1997, J. Mol. Biol. 273:927-948; Morea et al., 2000, Methods 20:267-279). Because the number of residues within a hypervariable region varies in different antibodies, additional residues relative to the canonical positions are conventionally numbered with a, b, c and so forth next to the residue 5 number in the canonical variable domain numbering scheme (Al-Lazikani et al., supra). Such nomenclature is similarly well known to those skilled in the art. For example, CDRs defined according to either the Kabat, Chothia, or IMGT designations, are set forth in the Table 1 below. Table 1: CDR Definitions 10 The binding molecule according to the invention may be an antibody or a fragment thereof comprising heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein the binding molecule specifically binds to CA19-9. 15 The binding molecule according to the present invention may be an antibody or a fragment thereof comprising HCDRs 1-3 and LCDRs 1-3 according to the IMGT numbering scheme, wherein at least one of the HCDRs 1-3 and / or LCDRs 1-3 is selected from: a) HCDR1 comprising an amino acid sequence according to SEQ ID NO: 1, b) HCDR2 comprising an amino acid sequence according to SEQ ID NO: 2, 20 c) HCDR3 comprising an amino acid sequence according to SEQ ID NO: 3, d) LCDR1 comprising an amino acid sequence according to SEQ ID NO: 4, e) LCDR2 comprising an amino acid sequence according to SEQ ID NO: 5, and f) LCDR3 comprisng an amino acid sequence according to SEQ ID NO: 6. In some embodiments, the binding molecule comprises one, two, three, four, five or six of the P129624PCT HCDRs 1-3 and / or LCDRs 1-3 selected from: a) HCDR1 comprising an amino acid sequence according to SEQ ID NO: 1, b) HCDR2 comprising an amino acid sequence according to SEQ ID NO: 2, c) HCDR3 comprising an amino acid sequence according to SEQ ID NO: 3, 5 d) LCDR1 comprising an amino acid sequence according to SEQ ID NO: 4, e) LCDR2 comprising an amino acid sequence according to SEQ ID NO: 5, and f) LCDR3 comprisng an amino acid sequence according to SEQ ID NO: 6. In some embodiments, at least one of HCDRs 1-3 and / or LCDRs 1-3 comprises one, two or three amino acid mutations relative to the recited sequences. 10 The binding molecule according to the present invention may be an antibody or a fragment thereof comprising heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein: a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, 15 b) HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, c) HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, d) LCDR1 comprises an amino acid sequence according to SEQ ID NO: 4, e) LCDR2 comprises an amino acid sequence according to SEQ ID NO: 5, f) LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6; 20 optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences. The binding molecule according to the present invention may be an antibody or a fragment thereof comprising heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Kabat numbering 25 scheme, wherein: a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 15, b) HCDR2 comprises an amino acid sequence according to SEQ ID NO: 16, c) HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, d) LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, 30 e) LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, f) LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6; P129624PCT optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences. The binding molecule according to the present invention may be an antibody or a fragment thereof comprising heavy chain complementarity determining regions (HCDRs) 1-3 and light 5 chain complementarity determining regions (LCDRs) 1-3 according to the Chothia numbering scheme, wherein: a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 20, b) HCDR2 comprises an amino acid sequence according to SEQ ID NO: 21, c) HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, 10 d) LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, e) LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, f) LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6; optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences. 15 P129624PCT In some embodiments, one or more of the CDRs may comprise one, two or three amino acid mutations. In some embodiments, HCDR1 may comprise one, two or three amino acid mutations. In some embodiments, HCDR2 may comprise one, two or three amino acid mutations. In some embodiments, HCDR3 may comprise one, two or three amino acid 5 mutations. In some embodiments, LCDR1 may comprise one, two or three amino acid mutations. In some embodiments, LCDR2 may comprise one, two or three amino acid mutations. In some embodiments, LCDR3 may comprise one, two or three amino acid mutations. It will be understood that a mutation in any of the CDRs described herein may encompass a 10 deletion of an amino acid, an insertion of an amino acid, or a substitution of an amino acid. It will also be understood that such a mutation may not prevent the binding molecule according to the invention from binding to CA19-9. In other words, a binding molecule according to the invention comprising a mutation in one or more CDRs described herein may suitably maintain the capacity (e.g. affinity) to bind to CA19-9. In some embodiments, the mutation suitably 15 maintains the same capacity (e.g. affinity) to bind to CA19-9 as the parent binding molecule. The term “parent binding molecule” in this context refers to the binding molecule without the mutation in question. In some embodiments, the binding molecule according to the present invention comprises a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID 20 NO: 7, or a variant having at least 80% sequence identity thereto. In some embodiments, the binding molecule according to the present invention comprises a VH comprising an amino acid sequence according to SEQ ID NO: 7. In some embodiments, the binding molecule according to the present invention comprises a VH consisting of an amino acid sequence according to SEQ ID NO: 7. 25 In some embodiments, the binding molecule according to the present invention comprises a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8, or a variant having at least 80% sequence identity thereto. In some embodiments, the binding molecule according to the present invention comprises a VL comprising an amino acid sequence according to SEQ ID NO: 8. In some embodiments, 30 the binding molecule according to the present invention comprises a VL consisting of an amino acid sequence according to SEQ ID NO: 8. P129624PCT In some embodiments, the binding molecule according to the present invention comprises a VH comprising an amino acid sequence according to SEQ ID NO: 7, or a variant having at least 80% sequence identity thereto, and a VL comprising an amino acid sequence according to SEQ ID NO: 8, or a variant having at least 80% identity thereto. 5 It will be understood that a VH and / or VL having a percentage identity to the SEQ ID NO of any VH and / or VL defined herein may have an equivalent function to the VH and / or VL having the sequence set forth in the SEQ ID NO defined herein and may suitably maintain the capacity to bind to CA19-9, e.g. the same capacity as the VH and / or VL domain having the sequence set forth in the SEQ ID NO defined herein. 10 In some embodiments, the VH has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 7. In some embodiments, the VL has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID 15 NO: 8. In some embodiments, the binding molecule comprises one or more immunoglobulin constant domains. In some embodiments, the immunoglobulin constant domains comprise a constant light chain domain (CL). In some embodiments, the immunoglobulin constant domains 20 comprise a constant heavy 1 (CH1) domain. In some embodiments, the immunoglobulin constant domains comprise a constant heavy 3 (CH3) domain. In some embodiments, the immunoglobulin constant domains comprise a constant heavy 2 (CH2) domain. In some embodiments, the immunoglobulin constant domains comprise a CH2 and a CH3 domain. In some embodiments, the CH2 and CH3 domains are considered to be an Fc (fragment 25 crystallisable) region. In some embodiments, the immunoglobulin constant domains comprise a CL, CH1, CH2 and CH3 domain. P129624PCT In some embodiments, the binding molecule comprises an Fc region. In some embodiments, the binding molecule comprises a modified Fc region. In some embodiments, the binding molecule further comprises a CL domain comprising an amino acid sequence according to SEQ ID NO: 22, or a variant having at least 70% identity 5 thereto. In some embodiments, the CL has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 22. 10 In some embodiments, the binding molecule further comprises CH1, CH2 and CH3 domains comprising an amino acid sequence according to SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 or SEQ ID NO: 27, or a variant having at least 70% identity thereto. In some embodiments, the CH1, CH2 and CH3 domain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 15 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to any one of SEQ ID NOs: 23 to 27. In one embodiment the binding molecule is an antibody. In one embodiment the binding molecule is a monoclonal antibody. In one embodiment the binding molecule is 5B1. P129624PCT P129624PCT The binding molecule may be an antibody comprising a heavy chain(s) and a light chain(s). The term “heavy chain” refers to a large protein subunit of an immunoglobulin. Heavy chains can be of any immunoglobulin isotype (for example IgG, IgE, IgM, IgD, IgA or IgY), subtype (for example lgG1, lgG2, lgG2a, lgG2b, lgG2c, lgG3, lgG4, lgA1 or lgA2) or allotype. 5 The term “light chain” refers to a small protein subunit of an immunoglobulin. Light chains can be of any type (for example kappa or lambda), subtype or allotype. Antibodies described herein include polyclonal and monoclonal antibodies and include IgA such as IgA1 or IgA2, IgG such as IgG1, IgG2, IgG3, or IgG4, IgE, IgM, and IgD antibodies. In various embodiments, the antibody is an IgG1 antibody, more particularly an IgG1, kappa 10 or IgG1, lambda isotype (i.e. IgG1, κ, λ), an IgG2a antibody (e.g. IgG2a, κ, λ), an IgG2b antibody (e.g. IgG2b, κ, λ), an IgG3 antibody (e.g. IgG3, κ, λ) or an IgG4 antibody (e.g. IgG4, κ, λ). In preferred embodiments the antibody is an IgG1, preferably IgG1, lambda. The antibody may be of any species (for example human, monkey, camel, llama, goat, sheep, rabbit, mouse, rat, mouse, hamster or chicken) or it may be a hybrid derived from more than 15 one species. It may be naturally occurring or it may be non-naturally occurring (i.e. an isolated antibody). The antibody may be created by genetic engineering (for example a chimeric antibody, humanised antibody, camelised antibody, intrabody, bispecific antibody). In some embodiments, the binding molecule comprises a light chain comprising an amino acid sequence according to SEQ ID NO: 9, or a variant having at least 70% sequence identity 20 thereto. In some embodiments, the light chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 9. In some embodiments, the binding molecule comprises a heavy chain comprising an amino 25 acid sequence according to SEQ ID NO: 10, or a variant having at least 70% sequence identity thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 10. P129624PCT In some embodiments, the binding molecule comprises a heavy chain comprising an amino acid sequence according to SEQ ID NO: 11, or a variant having at least 70% sequence identity thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 5 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 11. In some embodiments, the binding molecule comprises a heavy chain comprising an amino acid sequence according to SEQ ID NO: 12, or a variant having at least 70% sequence identity thereto. 10 In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 12. In some embodiments, the binding molecule comprises a heavy chain comprising an amino acid sequence according to SEQ ID NO: 13, or a variant having at least 70% sequence identity 15 thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 13. In some embodiments, the binding molecule comprises a heavy chain comprising an amino 20 acid sequence according to SEQ ID NO: 14, or a variant having at least 70% sequence identity thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 14. 25 In some embodiments, the binding molecule comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID NO: 10 or a variant having at least 70% sequence identity thereto. In some embodiments, the binding molecule comprises a light chain which consists of SEQ ID NO: 9 and a heavy chain which consists of SEQ ID NO: 10. P129624PCT In some embodiments, the binding molecule comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID NO: 11 or a variant having at least 70% sequence identity thereto. In some embodiments, the binding molecule comprises a light chain which consists of SEQ ID NO: 9 5 and a heavy chain which consists of SEQ ID NO: 11. In some embodiments, the binding molecule comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID NO: 12 or a variant having at least 70% sequence identity thereto. In some embodiments, the binding molecule comprises a light chain which consists of SEQ ID NO: 9 10 and a heavy chain which consists of SEQ ID NO: 12. In some embodiments, the binding molecule comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID NO: 13 or a variant having at least 70% sequence identity thereto. In some embodiments, the binding molecule comprises a light chain which consists of SEQ ID NO: 9 15 and a heavy chain which consists of SEQ ID NO: 13. In some embodiments, the binding molecule comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID NO: 14 or a variant having at least 70% sequence identity thereto. In some embodiments, the binding molecule comprises a light chain which consists of SEQ ID NO: 9 20 and a heavy chain which consists of SEQ ID NO: 14. P129624PCT P129624PCT Antibody The invention further provides an antibody comprising a modified Fc region, wherein the antibody specifically binds to CA19-9. 5 In some embodiments, CA19-9 is considered the antigen of the antibodies according to the present invention. The invention provides an antibody comprising heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein: 10 a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, b) HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, c) HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, d) LCDR1 comprises an amino acid sequence according to SEQ ID NO: 4, e) LCDR2 comprises an amino acid sequence according to SEQ ID NO: 5, 15 f) LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and a modified Fc region. The invention provides an antibody comprising heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 20 according to the Kabat numbering scheme, wherein: P129624PCT a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 15, b) HCDR2 comprises an amino acid sequence according to SEQ ID NO: 16, c) HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, d) LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, 5 e) LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, f) LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and a modified Fc region. The invention provides an antibody comprising heavy chain complementarity determining 10 regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Chothia numbering scheme, wherein: a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 20, b) HCDR2 comprises an amino acid sequence according to SEQ ID NO: 21, c) HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, 15 d) LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, e) LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, f) LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and a modified Fc region. 20 In some embodiments, one or more of the CDRs may comprise one, two or three amino acid mutations. In some embodiments, HCDR1 may comprise one, two or three amino acid mutations. In some embodiments, HCDR2 may comprise one, two or three amino acid mutations. In some embodiments, HCDR3 may comprise one, two or three amino acid mutations. In some embodiments, LCDR1 may comprise one, two or three amino acid 25 mutations. In some embodiments, LCDR2 may comprise one, two or three amino acid mutations. In some embodiments, LCDR3 may comprise one, two or three amino acid mutations. It will be understood that a mutation in any of the CDRs described herein may encompass a deletion of an amino acid, an insertion of an amino acid, or a substitution of an amino acid. It 30 will also be understood that such a mutation may not prevent the antibody according to the invention from binding to CA19-9. In other words, an antibody according to the invention P129624PCT comprising a mutation in one or more CDRs described herein may suitably maintain the capacity (e.g. affinity) to bind to CA19-9. In some embodiments, the mutation suitably maintains the same capacity (e.g. affinity) to bind to CA19-9 as the parent antibody. The term “parent antibody” in this context refers to the antibody without the mutation in question. 5 The term “antibody” refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, and includes any molecule comprising an antigen binding portion thereof. The term “antibody” includes monoclonal antibodies and fragments or derivatives of antibodies, including, without limitation, human antibodies, humanized antibodies, chimeric antibodies, single chain antibodies, e.g., scFvs and antigen- 10 binding antibody fragments such as Fab and Fab' fragments and also includes all recombinant forms of antibodies, e.g., antibodies expressed in prokaryotes, unglycosylated antibodies, and any antigen-binding antibody fragments and derivatives as described herein. In some embodiments, the antibody according to the present invention comprises a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID NO: 7, 15 or a variant having at least 80% sequence identity thereto. In some embodiments, the antibody according to the present invention comprises a VH comprising an amino acid sequence according to SEQ ID NO: 7. In some embodiments, the antibody according to the present invention comprises a VH consisting of an amino acid sequence according to SEQ ID NO: 7. 20 In some embodiments, the antibody according to the present invention comprises a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8, or a variant having at least 80% sequence identity thereto. In some embodiments, the antibody according to the present invention comprises a VL comprising an amino acid sequence according to SEQ ID NO: 8. In some embodiments, the 25 antibody according to the present invention comprises a VL consisting of an amino acid sequence according to SEQ ID NO: 8. In some embodiments, the antibody according to the present invention comprises a VH comprising an amino acid sequence according to SEQ ID NO: 7, or a variant having at least 80% sequence identity thereto, and a VL comprising an amino acid sequence according to 30 SEQ ID NO: 8, or a variant having at least 80% identity thereto. It will be understood that a VH and / or VL having a percentage identity to the SEQ ID NO of P129624PCT any VH and / or VL defined herein may have an equivalent function to the VH and / or VL having the sequence set forth in the SEQ ID NO defined herein and may suitably maintain the capacity to bind to CA19-9, e.g. the same capacity as the VH and / or VL domain having the sequence set forth in the SEQ ID NO defined herein. 5 In some embodiments, the VH has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 7. In some embodiments, the VL has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID 10 NO: 8. In some embodiments, the antibody comprises a light chain comprising an amino acid sequence according to SEQ ID NO: 9, or a variant having at least 70% sequence identity thereto. In some embodiments, the light chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 15 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 9. The antibody according to the present invention comprises a modified Fc region. In some embodiments, the antibody comprises a heavy chain comprising an amino acid sequence according to SEQ ID NO: 11, or a variant having at least 70% sequence identity 20 thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 11. In some embodiments, the antibody comprises a heavy chain comprising an amino acid 25 sequence according to SEQ ID NO: 12, or a variant having at least 70% sequence identity thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 12. P129624PCT In some embodiments, the antibody comprises a heavy chain comprising an amino acid sequence according to SEQ ID NO: 13, or a variant having at least 70% sequence identity thereto. In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 5 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 13. In some embodiments, the antibody comprises a heavy chain comprising an amino acid sequence according to SEQ ID NO: 14, or a variant having at least 70% sequence identity thereto. 10 In some embodiments, the heavy chain has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to SEQ ID NO: 14. In some embodiments, the antibody comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID 15 NO: 11 or a variant having at least 70% sequence identity thereto. In some embodiments, the antibody comprises a light chain which consists of SEQ ID NO: 9 and a heavy chain which consists of SEQ ID NO: 11. In some embodiments, the antibody comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID 20 NO: 12 or a variant having at least 70% sequence identity thereto. In some embodiments, the antibody comprises a light chain which consists of SEQ ID NO: 9 and a heavy chain which consists of SEQ ID NO: 12. In some embodiments, the antibody comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID 25 NO: 13 or a variant having at least 70% sequence identity thereto. In some embodiments, the antibody comprises a light chain which consists of SEQ ID NO: 9 and a heavy chain which consists of SEQ ID NO: 13. In some embodiments, the antibody comprises a light chain comprising SEQ ID NO: 9 or a variant having at least 70% sequence identity thereto and a heavy chain comprising SEQ ID 30 NO: 14 or a variant having at least 70% sequence identity thereto. In some embodiments, the antibody comprises a light chain which consists of SEQ ID NO: 9 and a heavy chain which P129624PCT consists of SEQ ID NO: 14. Modified Fc region In some embodiments, the binding molecule, e.g. via the Fc region, binds to one or more or all of the Fc receptors. In preferred embodiments, the Fc receptors comprise one or more or 5 all of FcγRI (CD64), FcγRIIa (CD32A), FcγRIIb (CD32B), FcγRIII (CD16), C1q and FcRn. In some embodiments, the binding molecule, e.g. via the Fc region, binds to FcγRI. It will be understood that the Fc region may interact with Fc receptors presented on the surface of a cell and / or may interact with proteins of the complement system. The Fc receptors may be Fc gamma receptors, e.g. FcγRI. The proteins of the complement system may include C1q. 10 In other embodiments the Fc region of the binding molecule is silenced to reduce, negate or abolish one or more Fc receptor binding and / or functionalities. In some embodiments, the Fc region of the binding molecule is modified to negate one or more Fc receptor functionalities. In some embodiments, the Fc region of the binding molecule is silenced in respect of one or more or all of FcγRI (CD64), FcγRIIa (CD32A), FcγRIIb (CD32B), FcγRIII (CD16) and C1q 15 functionality. Thus, in some embodiments, the Fc region of the binding molecule as defined herein is a modified Fc region. In some embodiments, the Fc region of the binding molecule according to the invention may not be capable of binding to immune cells and / or recruiting immune cells. 20 The antibody according to the invention comprises a modified Fc region. That is, the Fc region of the antibody of the invention molecule is silenced to reduce, negate or abolish one or more Fc receptor binding and / or functionalities. In some embodiments, the Fc region of the antibody of the invention is modified to negate one or more Fc receptor functionalities. In some embodiments, the Fc region of the antibody of the invention is silenced in respect of one or 25 more or all of FcγRI (CD64), FcγRIIa (CD32A), FcγRIIb (CD32B), FcγRIII (CD16) and C1q functionality. In some embodiments, the Fc region of the antibody according to the invention may not be capable of binding to immune cells and / or recruiting immune cells. The binding of the modified Fc region to FcγRI (CD64), FcγRIIa (CD32A), FcγRIIb (CD32B), P129624PCT FcγRIII (CD16), C1q and FcRn may be reduced compared to a wild-type Fc region. In some embodiments, the binding of the modified Fc region to FcγRI may be reduced compared to a wild-type Fc region. By “reduced binding” is meant at least 10%, at least 20%, at least 30%, at least 40%, at least 5 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% reduced binding compared to a wild-type Fc region. In an embodiment, the binding molecule comprises an Fc region comprising an amino acid substitution at position 234, or an amino acid substitution at position 235, or an amino acid 10 substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme. The Fc region may comprise further amino acid substitutions. The substitution(s) may be relative to a wild-type Fc region. In an embodiment, the antibody comprises an Fc region comprising an amino acid substitution 15 at position 234, or an amino acid substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme. The Fc region may comprise further amino acid substitutions. The substitution(s) may be relative to a wild-type Fc region. 20 For example, a wild-type Fc region may comprise the amino acid sequence according to SEQ ID NO: 28. SEQ ID NO: 28 (Human IgG1 Fc region) TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP 25 QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK In some embodiments, the binding molecule comprises an Fc region comprising amino acid substitutions at positions 234 and 235, according to the EU numbering scheme. In some embodiments, the binding molecule comprises an Fc region comprising amino acid P129624PCT substitutions at positions 234, 235 and 236, according to the EU numbering scheme. In some such embodiments, the Fc region of the binding molecule comprises a silencing modification selected from the STR mutation, the LALA mutation, the LALA-∆A mutation and the LALA-KA mutation as defined herein. 5 In some embodiments, the antibody comprises an Fc region comprising amino acid substitutions at positions 234 and 235, according to the EU numbering scheme. In some embodiments, the antibody comprises an Fc region comprising amino acid substitutions at positions 234, 235 and 236, according to the EU numbering scheme. In some such embodiments, the Fc region of the antibody comprises a silencing modification 10 selected from the STR mutation, the LALA mutation, the LALA-∆A mutation and the LALA-KA mutation as defined herein. The amino acid substitution(s) may be selected from the group consisting of: a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); b) L234A, L235A, and K322A (LALA-KA); 15 c) L234S, L235T, and G236R (STR); and d) L234A and L235A (LALA). In an embodiment, the Fc region of the binding molecule or antibody comprises the LALA Mutation: L234A, L235A by EU numbering (or L247A, L248A by Kabat numbering; or L4A, L5A by IMGT(CH2) numbering). 20 In an embodiment, the Fc region of the binding molecule or antibody comprises the LALA delta-A mutation: L234A, L235A, A327G, A330S, P331S by EU numbering (or L247A, L248A, A346G, A349S, P350S by Kabat numbering; or L4A, L5A, A97G, A100S, P101S by IMGT(CH2) numbering). In an embodiment, the Fc region of the binding molecule or antibody comprises the LALA-KA 25 mutation: L234A, L235A, K322A by EU numbering (or L247A, L248A, K341A by Kabat numbering; or L4A, L5A, K92A by IMGT(CH2) numbering) In an embodiment, the Fc region of the binding molecule or antibody comprises the amino acid residue A at position 234 and A at position 235 by EU numbering. P129624PCT In an embodiment, the Fc region of the binding molecule or antibody comprises the amino acid residue A at position 234, A at position 235, G at position 327, S at position 330 and S at position 331 by EU numbering. In an embodiment, the Fc region of the binding molecule or antibody comprises the amino 5 acid residue A at position 234, A at position 235 and A at position 322 by EU numbering. In an embodiment, the Fc region of the binding molecule or antibody comprises the STR Mutation: L234S, L235T, G236R by EU numbering (or L247S, L248T, G249R by Kabat numbering; or L4S, L5T, G6R by IMGT(CH2) numbering). In an embodiment, the Fc region of the binding molecule or antibody comprises the amino 10 acid residue S at position 234, T at position 235 and R at position 236 by EU numbering. The Fc region may comprise amino acid substitution(s) selected from the group consisting of: L234A / L235A / G236R, L234A / L235S / G236R , L234A / L235T / G236R, L234D / L235H / G236R, L234D / L235K / G236R, L234D / L235Q / G236R, L234D / L235S / G236R, L234D / L235T / G236R, L234E / L235D / G236R, L234E / L235H / G236R, L234E / L235I / G236R, L234E / L235V / G236R, 15 L234G / L235H / G236R, L234G / L235Q / G236R, L234G / L235S / G236R, L234H / L235I / G236R, L234H / L235S / G236R, L234K / L235Q / G236R, L234K / L235R / G236R, L234K / L235S / G236R, L234K / L235T / G236R, L234K / L235V / G236R, L234Q / L235A / G236R, L234Q / L235D / G236R, L234Q / L235H / G236R, L234Q / L235Q / G236R , L234Q / L235R / G236R, L234Q / L235S / G236R, L234Q / L235T / G236R, L234Q / L235V / G236R, L234R / L235D / G236R, L234R / L235E / G236R, 20 L234R / L235H / G236R, L234R / L235I / G236R, L234R / L235K / G236R, L234R / G236R, L234R / L235Q / G236R, L234R / L235R / G236R, L234R / L235T / G236R, L234S / L235D / G236R, L234S / L235E / G236R, L234S / L235G / G236R, L234S / L235H / G236R, L234S / L235I / G236R, L234S / G236R, L234S / L235R / G236R, L234S / L235T / G236R, L234S / L235V / G236R, L234T / L235A / G236R, L234T / L235I / G236R, L234T / L235K / G236R, L234T / L235Q / G236R, 25 L234T / L235R / G236R, L234T / L235S / G236R, L234T / L235T / G236R, and L234T / L235V / G236R. Binding molecule-payload construct The present invention provides a binding molecule-payload conjugate (BPC) comprising a binding molecule as defined herein and one or more payload moieties wherein the one or 30 more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. Where more than one payload moiety is covalently linked to the binding molecule, P129624PCT optionally via one or more linkers, the payload moieties may be the same or different, and / or the linkers may be the same or different. It will be understood that the term “payload” may be interchangeable with “cargo”. It is to be understood herein that the term “BPC” is analogous to the term “ADC”, as in 5 “antibody-drug conjugate”, except that the term “binding molecule” as used herein encompasses antibodies and fragments thereof, and is not limited to full-length antibodies per se. ADCs are a class of targeted therapeutics that can improve the selectivity and the cytotoxic activity of cancer drugs. Upon binding of an ADC to a target antigen present on the surface of 10 a cell, the ADC may become internalised and trafficked to intracellular compartments (e.g. a lysosome) where the payload is released from the ADC. When the payload is a drug, the release of the drug from the ADC may allow the drug to exert its effect on the cell. The payload may be released from the ADC by proteolysis of a cleavable linker (if present) or by degradation of the antibody of the ADC. 15 In some embodiments, the payload moiety is selected from a drug, a detectable marker, a radioisotope (which may be a radiotherapeutic agent and / or a radioimaging agent), a fluorescent agent, a luminescent agent, a colored agent, an enzyme, polyethylene glycol, a nuclide, a nucleic acid, a small molecule toxin, a polypeptide having binding activity, a protein, a receptor, a ligand, another active agent that inhibits tumor cell growth, promotes tumor cell 20 apoptosis or necrosis. In some embodiments, the payload moiety is a drug. Preferably, the payload moiety is a cytotoxic drug, an immune modulator, or a STING inhibitor The cytotoxic drug may be a tubulin inhibitor, a DNA damaging agent, a TOPO1 inhibitor, an auristatin, a maytansinoid, or a calicheamicin. 25 In some embodiments, the cytotoxic drug is a topoisomerase inhibitor, which may be a type I topoisomerase (TOPO1) inhibitor or a type II topoisomerase (TOPO2) inhibitor. In some embodiments, the TOPO1 inhibitor is a camptothecin or an exatecan. Camptothecins may include topotecan, irinotecan, and belotecan. In some embodiments, the cytotoxic drug is a tubulin inhibitor (also known as a microtubule 30 inhibitor). In some embodiments, the cytotoxic drug is an auristatin. In some embodiments, P129624PCT the auristatin is monomethyl auristatin E. In some embodiments, the auristatin is monomethyl auristatin F. In some embodiments, the cytotoxic drug is a maytansinoid. Where more than one payload moiety is covalently linked to the binding molecule, optionally via one or more linkers, in one embodiment a first payload moiety is a topoisomerase inhibitor 5 (as defined and exemplified above) and a second payload moiety is a tubulin inhibitor (as defined and exemplified above). It will be understood that a cytotoxic drug, chemotherapeutic drug, or chemotherapeutic entity may refer to a drug or molecule that: • is destructive to a cell; 10 • induces apoptosis in a cell; • inhibits or prevents the function of a cell; • inhibits or prevents a cell from proliferating; and / or • reduces the viability of a cell. In some embodiments, the invention comprises a BPC compound as defined herein. In other 15 embodiments, the invention comprises a tautomer of the BPC as defined herein. In other embodiments, the invention comprises a mesomer of the BPC as defined herein. In other embodiments, the invention comprises a racemate of the BPC as defined herein. In other embodiments, the invention comprises an enantiomer of the BPC as defined herein. In other embodiments, the invention comprises a diastereoisomer of the BPC as defined herein. In 20 other embodiments, the invention comprises a composition which is a mixture of the BPCs as defined herein. In other embodiments, the invention comprises a pharmaceutically acceptable salt of the BPC as defined herein. Linker and payload moieties Typically, in the BPCs of the present invention, one or more payload moieties is covalently 25 linked to the binding molecule via a linker to form the BPC. The moiety linked to the binding molecule is generally referred to herein as the “linker-payload moiety”. Typically, when the BPC is administered to the subject, the linker-payload moiety is released by breakdown of the BPC in vivo. The linker-payload moiety then typically breaks down to release the payload in vivo. 30 The drug-antibody ratio (DAR) is the number of linker-payload molecules attached to each P129624PCT binding molecule (it can be understood that the term “drug-antibody ratio” applies equally whether the binding molecule is an antibody or a fragment thereof). As indicated above, the drug-antibody ratio (DAR) of the BPCs according to the invention may vary. In this specification the terms “drug-antibody ratio”, “DAR” and “connection number” are 5 synonymous. In some embodiments, the DAR is an integer from 1 to 16. In some embodiments, the DAR is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments, the DAR is an integer from 4 to 12. In some embodiments, DAR is an integer from 6 to 10. In some embodiments, the DAR is an integer from 7 to 9. In some embodiments, the DAR is 6. 10 In some embodiments, the DAR is 7. In some embodiments, the DAR is 8. In some embodiments, the DAR is 9. In some embodiments, the DAR is 10. In some embodiments, the linker unit comprises a first conjugation moiety for coupling with the binding molecule. In some embodiments, the linker unit comprises a second conjugation moiety for coupling with 15 the payload moiety. In some embodiments, the linker unit comprises a peptide linker. In some embodiments, the linker unit consists essentially of a peptide linker. In some embodiments, the linker unit consists of a peptide linker. Typically, the peptide linker comprises, essentially of or consist of 1 to 10 amino acid residues. The peptide linker may comprise, consist essentially of or 20 consist of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid residues. In some embodiments, the peptide linker comprises, consists essentially of or consists of 1 to 6 amino acid residues. In some embodiments, the peptide linker comprises, consists essentially of or consists of 1 to 5 amino acid residues. In some embodiments, the peptide linker comprises, consists essentially of or consists of 2 amino acid residues. In some embodiments, the peptide linker comprises, 25 consists essentially of or consists of 3 amino acid residues. In some embodiments, the peptide linker comprises, consists essentially of or consists of 4 amino acid residues. In some embodiments, the peptide linker comprises, consists essentially of or consists of 5 amino acid residues. In some embodiments, the linker comprises a peptide linker selected from AA1, AA1-Gly, Val-30 Cit, Val-Ala, Val-AA1, Val-AA1-Gly, AA1-Ala-Asn, Ala-Ala-Ala, Ala-Ala-Asn and Gly-Gly-Phe- Gly. P129624PCT In some embodiments, the amino acid residue represented by AA1is selected from 5 where position 1 is connected, optionally via a further conjugation moiety, to the portion of the molecule bearing the binding compound and position 2 is connected, optionally via a further conjugation moiety, to the portion of the molecule bearing the payload compound. In some embodiments, the first conjugation moiety comprises a pyrimidine-sulfone moiety. In some embodiments, the pyrimidine-sulfone moiety is linked to the peptide moiety via a C1-10 10 alkynoyl group. In some embodiments, the linker unit comprises a peptide linker comprising the peptide sequence Gly-Gly-Phe-Gly. In some embodiments, the first moiety comprises a maleimide moiety which is capable of adding to a sulfhydryl moiety on the binding compound such that the conjugate comprises a 15 sulfur-linked succinimidyl group. In some embodiments, the maleimide moiety is linked to the peptide moiety via a C1-10 alkanoyl group. In some embodiments, the payload or payload-linker moiety comprises a structure shown as formula (III-A): P129624PCT wherein R1is selected from the group consisting of: -O-, -(R2)N-, -P(=O)(R2)- and -S-; X is -L1-CH2-C(O)-; L1is -(C(R3a)(R3b))m-, wherein 0 or at least 1 methylene unit of L1is independently replaced by 5 -C(O)-, -C(=S)-, -C(=NR4b)- or -C(=N2)-; wherein each R2, each R3a, each R3band each R4bare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, - C(O)CH2C(O)R, -S(O)R, -S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; 10 wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m is selected from the group consisting of integers ≥ 0, when R1is -O- or -HN-, at least 1 methylene unit of L1is independently replaced by -C(O)-, - 15 C(=S)-, -C(=NR4b)- or -C(=N2)-, or each R3aand each R3bare not both hydrogen. In some embodiments, the payload-linker comprises a structure shown as formula (III-C): P129624PCT wherein, L is -La-Lb-Lc-; -La- is selected from the group consisting of: 5 wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, -P(=O)(Rwx)-, - N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 10 wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, -P(=O)(Rzx)-, - N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 15 -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; P129624PCT wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, - N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally 5 substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; -Lb- represents a peptide residue consisting of 2 to 7 amino acids; 10 -Lc- is selected from the group consisting of: wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, 15 -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H and a C1-6aliphatic group. In some embodiments, the conjugate comprises a structure shown as formula (III-D):

[0002] P129624PCT wherein, BM is the binding molecule and q is a connection number which is an integer from 1 to 16. In some embodiments of formula (III-D), the connection number q is an integer of 1, 2, 3, 4, 5, 5 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (III-D), the connection number q is an integer from 4 to 12. In some embodiments of formula (III-D), the connection number q is an integer from 6 to 10. In some embodiments of formula (III-D), the connection number q is an integer from 7 to 9. In some embodiments of formula (III-D), the connection number q is 6. In some embodiments, the connection number q is 7. In some embodiments 10 of formula (III-D), the connection number q is 8. In some embodiments of formula (III-D), the connection number q is 9. In some embodiments of formula (III-D), the connection number q is 10. In some embodiments, wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; 15 wherein wn is 1, 2, 3 or 6, and 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - C(O)-; wherein yn is 0, 4 or 8, and yp is 0 or 1; P129624PCT wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)-; -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with 1 to 3 substituent Rcx; 5 wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group. In some embodiments, -Lb- is selected from the group consisting of: 10 RL1RL2In some embodiments, -Lc- is , wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, halogen, -OH and a C1-6aliphatic group. In some embodiments, -La- is , 15 wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is 1, 2, 3 or 6, and 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - C(O)-; P129624PCT wherein yn is 0, 4 or 8, and yp is 0 or 1; wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)-; -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or 5 independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group. In some embodiments, 10 In some embodiments, wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, halogen, -OH and a C1-6aliphatic group. In some embodiments, In some embodiments, 15 In some embodiments, In some embodiments, In some embodiments, the payload-linker moiety comprises the following group of structures: P129624PCT III-A-16 III-A-17 In some embodiments, the payload moiety of the conjugate has the following structure: . In some embodiments, the payload-linker moiety of the conjugate has the following structure: P129624PCT In some embodiments, the conjugate is selected from the group consisting of the following structural formulae: 5

[0003] P129624PCT P129624PCT

[0004] P129624PCT wherein, 5 q represents a connection number, and p is selected from the group consisting of integers from 1 to 16, and BM is a binding molecule as defined herein. In some embodiments, the conjugate has the structure of Formula (IVA):

[0005] P129624PCT or a pharmaceutically acceptable salt thereof, wherein, q represents a connection number, and n is selected from the group consisting of integers from 1 to 16, and BM is a binding molecule as defined herein. 5 In some embodiments of formula (IVA), the connection number q is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (IVA), the connection number q is an integer from 4 to 12. In some embodiments of formula (IVA), the connection number q is an integer from 6 to 10. In some embodiments of formula (IVA), the connection number q is an integer from 7 to 9. In some embodiments of formula (IVA), the connection 10 number q is 6. In some embodiments of formula (IVA), the connection number q is 7. In some embodiments of formula (IVA), the connection number q is 8. In some embodiments of formula (IVA), the connection number q is 9. In some embodiments of formula (IVA), the connection number q is 10. In some embodiments, the payload or payload-linker moiety comprises a structure shown as 15 formula (II-A):

[0006] P129624PCT wherein, X1is saturated C, and X1is substituted with Rn; ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated carbocyclyl, 5 wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; 10 L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, -C(O)O-, - NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, -C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 15 R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, -C(O)O-, - NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, -C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 20 wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, - P129624PCT OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, -S(O)2R, - C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, 5 tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1. In some embodiments, the payload or payload-linker moiety comprises a structure shown as 10 formula (II-Cx): , wherein, L is -La-Lb-Lc-; -La- is selected from the group consisting of: 15 wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - P129624PCT C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, -P(=O)(Rwx)-, - N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 5 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, -P(=O)(Rzx)-, - N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially 10 unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, - N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - 15 C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; 20 -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: , wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, P129624PCT protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H and a C1-6aliphatic group. In some embodiments, the BPC comprises a structure shown as formula (II-Dx): 5 , wherein BM is the binding molecule, and q is a connection number which is an integer from 1 to 16. In some embodiments of formula (II-Dx), the connection number q is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (II-Dx), the 10 connection number q is an integer from 4 to 12. In some embodiments of formula (II-Dx), the connection number q is an integer from 6 to 10. In some embodiments of formula (II-Dx), the connection number q is an integer from 7 to 9. In some embodiments of formula (II-Dx), the connection number q is 6. In some embodiments of formula (II-Dx), the connection number q is 7. In some embodiments of formula (II-Dx), the connection number q is 8. In some 15 embodiments of formula (II-Dx), the connection number q is 9. In some embodiments of formula (II-Dx), the connection number q is 10. In some embodiments, -La- is selected from the group consisting of: P129624PCT wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers from 2 to 6, and 0 or 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)-, - C(O)-, -NRwx- or -O-; 5 wherein yn is selected from the group consisting of integers from 0 to 12, and yp is 0 or 1; wherein zn is selected from the group consisting of integers from 0 to 10, and 0 or 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or - C(O)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene and 3-10 membered 10 saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, - N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - 15 C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; 20 -Lb- represents a peptide residue consisting of 2 to 7 amino acids, and the peptide residue of -Lb- is a peptide residue formed of amino acids selected from the group consisting of: phenylalanine, glycine, alanine, valine, citrulline, lysine, serine, glutamic acid and aspartic acid; -Lc- is selected from the group consisting of:25 P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H and a C1-65 aliphatic group. In some embodiments, wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is 1, 2, 3 or 6, and 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - 10 C(O)-; wherein yn is 0, 4 or 8, and yp is 0 or 1; wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)-; -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or 15 independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group. In some embodiments, -Lb- represents a peptide residue consisting of 2 to 4 amino acids, and 20 the peptide residue of -Lb- is a peptide residue formed of amino acids selected from the group consisting of: phenylalanine, glycine, alanine, valine, citrulline and lysine. In some embodiments, -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, halogen, -OH and a C1-6aliphatic group. In some embodiments, -La- is 5 , wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is 1, 2, 3 or 6, and 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - C(O)-; 10 wherein yn is 0, 4 or 8, and yp is 0 or 1; wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)-; -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with 1 to 3 substituent Rcx; 15 wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group; In some embodiments, -Lb- is selected from the group consisting of: P129624PCT I wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, 5 halogen, -OH and a C1-6aliphatic group. In some embodiments, -La- is , wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is 1, 2, 3 or 6, and 10 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - C(O)-; wherein yn is 0, 4 or 8, and yp is 0 or 1; wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)-; 15 -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; P129624PCT wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group. In some embodiments, In some embodiments, -Lc- is wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, halogen, -OH and a C1-6aliphatic group. 5 In some embodiments, ring A is selected from the group consisting of: 3-10 membered 10 saturated heterocyclyl and 3-10 membered saturated carbocyclyl. In some embodiments, ring A is 3-10 membered saturated carbocyclyl. In some embodiments, ring A is 3-6 membered saturated carbocyclyl. In some embodiments, ring A is 4 membered saturated carbocyclyl. In some embodiments, ring A is 6 membered saturated carbocyclyl. 15 In some embodiments, ring A is 3-10 membered saturated heterocyclyl. In some embodiments, ring A is 3-6 membered saturated heterocyclyl. In some embodiments, ring A is 4 membered saturated heterocyclyl. In some embodiments, ring A is substituted with 0 substituent R1a. In some embodiments, the linker-payload moiety comprises a structure shown as formula (II- P129624PCT Ax): wherein, when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is substituted with p L2, and L2is not Rn; 5 or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2. In some embodiments, ring A is substituted with 1 L2. In some embodiments, m is 0, and L3is a covalent bond. In some embodiments, m is 2, and L3is -(C(R3a)(R3b))2-. 10 In some embodiments, n is 0 or 1. In some embodiments, n is 0, and L1is a covalent bond. In some embodiments, n is 1, and L1is -C(R5a)(R5b)-. In some embodiments, 1 methylene unit of L1is replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, -C(O)O-, -NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, -C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-. In some embodiments, 1 methylene unit 15 of L1is replaced by -C(O)-. In some embodiments, R2is selected from the group consisting of: -O-, -(R2a)N- and -S-. In some embodiments, R2is -O-. In some embodiments, R2is -(R2a)N-. In some embodiments, R2ais hydrogen. In some embodiments, wherein R2is -HN-. P129624PCT In some embodiments, R1ais hydrogen. In some embodiments, R3aand R3bare each independently hydrogen. In some embodiments, R4is hydrogen. In some embodiments, R6is hydrogen. 5 In some embodiments, R, Raand Rbare each independently hydrogen. In some embodiments, the payload or payload-linker moiety comprises the following group of structures: II-A-9 II-A-10 II-A-11 II-A-12 In some embodiments, the payload or payload-linker moiety comprises the structure P129624PCT In some embodiments, the payload or payload-linker moiety has the structure In some embodiments, the payload-linker moiety has the structure 5 . In some embodiments, the conjugate moiety has the structure of formula (IVB) P129624PCT or a pharmaceutically acceptable salt thereof, wherein, q represents a connection number, and q is selected from the group consisting of integers from 1 to 16, and BM is a binding molecule as defined herein. In some embodiments of formula (IVB), the connection number q is an integer of 1, 2, 3, 4, 5, 5 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (IVB), the connection number q is an integer from 4 to 12. In some embodiments of formula (IVB), the connection number q is an integer from 6 to 10. In some embodiments of formula (IVB), the connection number q is an integer from 7 to 9. In some embodiments of formula (IVB), the connection number q is 6. In some embodiments of formula (IVB), the connection number q is 7. In some 10 embodiments of formula (IVB), the connection number q is 8. In some embodiments of formula (IVB), the connection number q is 9. In some embodiments of formula (IVB), the connection number q is 10. 15 or a pharmaceutically acceptable salt thereof, wherein, q represents a connection number, and n is selected from the group consisting of integers from 1 to 16, and BM is a binding molecule as defined herein. The payload-linker moiety of the compound of formula (VA) is also known as deruxtecan. In some embodiments of formula (VA), the connection number q is an integer of 1, 2, 3, 4, 5, 20 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (VA), the connection number q is an integer from 4 to 12. In some embodiments of formula (VA), the connection number q is an integer from 6 to 10. In some embodiments of formula (VA), the connection P129624PCT number q is an integer from 7 to 9. In some embodiments of formula (VA), the connection number q is 6. In some embodiments of formula (VA), the connection number q is 7. In some embodiments of formula (VA), the connection number q is 8. In some embodiments of formula (VA), the connection number q is 9. In some embodiments of formula (VA), the connection 5 number q is 10. In some embodiments, the conjugate has the structure represented by formula I: wherein, BM is the binding compound; 10 q represents a connection number, and q is selected from the group consisting of integers from 1 to 16, 15 P129624PCT each Z is independently selected from a direct bond, a carbon-carbon triple bond, a carbon- carbon double bond, and amido (preferably selected from a direct bond, a carbon-carbon triple bond, and a carbon-carbon double bond); Rx and Ry are each independently selected from H and C1-4 alkyl; 5 each m is independently selected from 0, 1, 2, 3, 4, 5 and 6; y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 15 (such as 6-15); each y3 is independently selected from 1, 2, and 3; each y4 is independently selected from 0 and 1; position 1 is attached to Tb via an S atom, 10 and position 2 is attached to L2or L3; L2is absent or present, and when L2is present, L2is selected from: 15 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 10 (such as 6-10); each y3 is independently selected from 1 or 2; each y4 is independently selected from 0 and 1, position 1 is attached to L1, and position 2 is attached to L3; L3is selected from an amino acid residue or a short peptide consisting of 2-10 amino acid residues; the amino acid residue is selected from natural amino acid residues, non-natural 20 amino acid residues, or selected from amino acid residue represented by AA1or stereoisomer thereof; AA1; in the amino acid residue represented by AA1, any one of Raand Rbis H, P129624PCT and the other i or, Raand Rb, together with the carbon atom to which they are both attached, form a 5-6 membered heterocyclic ring, and said 5-6 membered heterocyclic ring is piperidine ring or piperazine ring; r, r1, r1aand r1bare each independently 0, 1, 2, 3, 4 or 5; 5 Rm1, Rn1, Rm1a, Rn1a, Rm1band Rn1bare each independently H, C1-6alkyl or -COORx1, wherein, Rx1is C1-6alkyl; or, Rm1and Rn1, Rm1aand Rn1a, and Rm1band Rn1b, together with the nitrogen atom to which they are both attached, form a 5-6 membered heterocyclic ring, and of said 5-6 membered heterocyclic ring, the heteroatom is selected from 1 or 2 N atoms; the said 5-6 membered 10 heterocyclic ring is optionally substituted with one or more R0’; Rzis selected from C1-6alkyl; R0and R0’are each independently selected from C1-6alkyl, -NRm2Rn2or 5-6 membered heterocyclyl optionally substituted with C1-6alkyl; of said 5-6 membered heterocyclyl, the heteroatom is selected from 1 or 2 N atoms; 15 Rm2and Rn2are each independently selected from H and C1-6alkyl; 20 2 is attached to D; R1and R2are each independently selected from H, halogens and C1-4 alkyl; or, R1and R2, together with the carbon atom to which they are both attached form a 5-6 membered heterocyclic ring, the heterocyclic ring contains 1, 2, or 3 of O, S, or N or any combination thereof; P129624PCT R3is selected from H and C1-4alkyl; or R3and X, together with the carbon atom to which they are both attached, form a 5-6 membered carbon ring; W is absent or present, when W is present, W is selected from -O-, -S-, -NR4-, , position 1 is attached to X, and position 2 is attached to L4or L3; 5 X is selected from optionally substituted -(CH2)n1- position 1 is attached to the parent ring and position 2 is attached to W or L4; the substituent is selected from one or two C1-4 alkyls; R4, R5, and R7are each independently selected from H and C1-4 alkyl; n, n1, n2, n3 are each independently selected from any integer between 0 and 6. 10 In some embodiments of formula (I), the connection number q is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (I), the connection number q is an integer from 4 to 12. In some embodiments of formula (I), the connection number q is an integer from 6 to 10. In some embodiments of formula (I), the connection number q is an integer from 7 to 9. In some embodiments of formula (I), the connection number 15 q is 6. In some embodiments of formula (I), the connection number q is 7. In some embodiments of formula (I), the connection number q is 8. In some embodiments of formula (I), the connection number q is 9. In some embodiments of formula (I), the connection number q is 10. 20 P129624PCT In some embodiments, Z is selected from a direct bond, a carbon-carbon triple bond, and a carbon-carbon double bond. In some embodiments, Z is a carbon-carbon triple bond. In some embodiments, Rx is H or methyl. In some embodiments, Rx is H. 5 In some embodiments, Ry is H or methyl. In some embodiments, Ry is H. In some embodiments, m is 2, 3 or 4. In some embodiments, m is 3. In some embodiments, L2is absent. In some embodiments, L3 is selected from AA1, AA1-Gly, Val-Cit, Val-Ala, Val-AA1, Val-AA1-Gly, AA1-Ala-Asn, Ala-Ala-Ala, Ala-Ala-Asn and Gly-Gly-Phe-Gly. In some embodiments, L3is 10 selected from AA1, AA1-Gly, Val-Cit, Val-AA1-Gly, AA1-Ala-Asn and Gly-Gly-Phe-Gly. In some embodiments, L3is Val-AA1-Gly. In some embodiments, the amino acid residue represented by AA1is selected from In some embodiments, the amino acid residue represented by AA1is , 15 In some embodiments, L4is selected from H , and . P129624PCT 1 N 2 In some embodiments, L4 is H . In some embodiments, W is O. In some embodiments, X is -(CH2)n1-. In some embodiments, n1 is 2, 3 or 4. In some embodiments, n1 is 3. 5 In some embodiments, the structure is: wherein position 1 is attached to the connecting atom on the binding molecule and position 2 is attached to W. ts, the structural fragment represented wherein position 1 is attached to L4.

[0007] P129624PCT In some embodiments, the linker-payload moiety has the structure: 5 In some embodiments, the conjugate is selected from the group consisting of: P129624PCT wherein, BM is the binding compound as defined herein q represents a connection number, and is selected from the group consisting of integers from 1 to 16, and BM is a binding molecule as defined herein. 5 In some embodiments, the conjugate has the structure of formula (IVC): wherein, q represents a connection number, and is selected from the group consisting of integers from 1 to 16, and BM is a binding molecule as defined herein. 10 In some embodiments of formula (IVC), the connection number q is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some embodiments of formula (IVC), the connection number q is an integer from 4 to 12. In some embodiments of formula (IVC), the connection number q is an integer from 6 to 10. In some embodiments of formula (IVC), the connection number q is an integer from 7 to 9. In some embodiments of formula (IVC), the connection 15 number q is 6. In some embodiments of formula (IVC), the connection number q is 7. In some embodiments of formula (IVC), the connection number q is 8. In some embodiments of formula (IVC), the connection number q is 9. In some embodiments of formula (IVC), the connection number q is 10. P129624PCT Methods The invention provides a method for producing a BPC according to the invention, comprising contacting a binding molecule as defined herein with a suitable linker-payload compound. The invention provides a method for producing a BPC according to the invention, comprising 5 contacting an antibody according to the invention with a suitable linker-payload compound. The linker-payload compound may be of the general formula (II-Fx): , wherein, Lxis Lax-Lb-Lc-; Lax- is selected from the group consisting of: 10 wherein Rhalis iodine or bromine; wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers ≥ 0, and P129624PCT 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, -P(=O)(Rwx)-, - N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; 5 wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, -P(=O)(Rzx)-, - N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered 10 heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, -15 N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - 20 S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H and a C1-6aliphatic group; 5 wherein, X1is saturated C, and X1is substituted with Rn; ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated carbocyclyl, wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is 10 substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene15 unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, -C(O)O-, - NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, -C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene20 unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, -C(O)O-, - NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, -C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -25 OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, -S(O)2R, - C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - P129624PCT S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1. The linker-payload compound may be of the general formula (III-F): 5 ,wherein, Lxis Lax-Lb-Lc-; Lax- is selected from the group consisting of: wherein Rhalis iodine or bromine; 10 wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, -P(=O)(Rwx)-, - N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 15 wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; P129624PCT wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, -P(=O)(Rzx)-, - N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 5 -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each10 independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, - N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium,15 tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: ,20 wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H and a C1-6aliphatic group; 25 wherein R1is selected from the group consisting of: -O-, -(R2)N-, -P(=O)(R2)- and -S-; P129624PCT X is -L1-CH2-C(O)-; L1is -(C(R3a)(R3b))m-, wherein 0 or at least 1 methylene unit of L1is independently replaced by -C(O)-, -C(=S)-, -C(=NR4b)- or -C(=N2)-; wherein each R2, each R3a, each R3band each R4bare each independently hydrogen, protium, 5 deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, - C(O)CH2C(O)R, -S(O)R, -S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -C(O)CH2C(O)H, - 10 S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m is selected from the group consisting of integers ≥ 0, and n is selected from the group consisting of integers ≥ 1; when R1is -O- or -HN-, at least 1 methylene unit of L1is independently replaced by -C(O)-, - C(=S)-, -C(=NR4b)- or -C(=N2)-, or each R3aand each R3bare not both hydrogen. 15 In some embodiments, In some embodiments, Lax-Lb-Lc- is selected from the group consisting of: . In some embodiments, the linker-payload compound is of the formula:

[0008] P129624PCT . In some embodiments, the linker-payload compound is of the formula: . The linker-payload compound may be of the formula 5 P129624PCT wherein, LG is a leaving group; 5 each Z is independently selected from a direct bond, a carbon-carbon triple bond, a carbon- carbon double bond, and amido (preferably selected from a direct bond, a carbon-carbon triple bond, and a carbon-carbon double bond); 10 Rx and Ry are each independently selected from H and C1-4 alkyl; each m is independently selected from 0, 1, 2, 3, 4, 5 and 6; y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 15 (such as 6-15); each y3 is independently selected from 1, 2, and 3; 15 each y4 is independently selected from 0 and 1; position 1 is attached to LG, and position 2 is attached to L2or L3; L2is absent or present, and when L2is present, L2is selected from: P129624PCT (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 10 5 (such as 6-10); each y3 is independently selected from 1 or 2; each y4 is independently selected from 0 and 1, position 1 is attached to L1, and position 2 is attached to L3; L3is selected from an amino acid residue or a short peptide consisting of 2-10 amino acid residues; the amino acid residue is selected from natural amino acid residues, non-natural amino acid residues, or selected from amino acid residue represented by AA1or stereoisomer 10 thereof; ; in the amino acid residue represented by AA1, any one of Raand Rbis H, and the other i or, Raand Rb, together with the carbon atom to which they are both attached, form a 5-6 membered heterocyclic ring, and said 5-6 membered heterocyclic ring is piperidine ring or piperazine ring. 15 r, r1, r1aand r1bare each independently 0, 1, 2, 3, 4 or 5; Rm1, Rn1, Rm1a, Rn1a, Rm1band Rn1bare each independently H, C1-6alkyl or -COORx1, wherein, Rx1is C1-6alkyl; or, Rm1and Rn1, Rm1aand Rn1a, and Rm1band Rn1b, together with the nitrogen atom to which they are both attached, form a 5-6 membered heterocyclic ring, and of said 5-6 membered 20 heterocyclic ring, the heteroatom is selected from 1 or 2 N atoms; the said 5-6 membered heterocyclic ring is optionally substituted with one or more R0’; P129624PCT Rzis selected from C1-6alkyl; R0and R0’are each independently selected from C1-6alkyl, -NRm2Rn2or 5-6 membered heterocyclyl optionally substituted with C1-6alkyl; of said 5-6 membered heterocyclyl, the heteroatom is selected from 1 or 2 N atoms; 5 Rm2and Rn2are each independently selected from H and C1-6alkyl; 10 2 is attached to D; R1and R2are each independently selected from H, halogens and C1-4 alkyl; or, R1and R2, together with the carbon atom to which they are both attached form a 5-6 membered heterocyclic ring, the heterocyclic ring contains 1, 2, or 3 of O, S, or N or any combination thereof; 15 R3is selected from H and C1-4alkyl; or R3and X, together with the carbon atom to which they are both attached, form a 5-6 membered carbon ring; W is absent or present, when W is present, W is selected from -O-, -S-, -NR4-, and , position 1 is attached to X, and position 2 is attached to L4or L3; X is selected from optionally substituted -(CH2)n1- P129624PCT position 1 is attached to the parent ring and position 2 is attached to W or L4; the substituent is selected from one or two C1-4 alkyls; R4, R5, and R7are each independently selected from H and C1-4 alkyl; n, n1, n2, n3 are each independently selected from any integer between 0 and 6. 5 In some embodiments, LG is selected from halogen, sulfone group, a tertiary amine salt group diazonium salt group, -OMs, MeSO2-, and CF3SO3-; In some embodiments, LG is selected from F, Cl and MeSO2- and the tertiary amine salt group is selected from Me3N+ and Et3N+; In some embodiments, LG is selected from F and MeSO2-. 10 In some embodiments, the linker-payload compound is of the formula: Nucleic acid sequence(s) The present invention provides one or more nucleic acid sequence(s) encoding the binding molecule as defined herein. In other words, the present invention provides one or more nucleic 15 acid sequence(s) capable of expressing the binding molecule as defined herein. The present invention provides one or more nucleic acid sequence(s) encoding (i.e. capable of expressing) the antibody according to the invention. As used herein, the terms “polynucleotide”, “nucleotide”, and “nucleic acid” are intended to be synonymous with each other. The nucleic acid sequence(s) may be RNA or DNA sequences, 20 or a mixture of RNA and DNA sequences. P129624PCT In an embodiment, the nucleic acid sequence(s) are one or more DNA sequences, such as cDNA sequences. In an embodiment, the nucleic acid sequence is a DNA sequence, such as a cDNA sequence. In an embodiment, the nucleic acid sequence(s) are RNA sequences, such as mRNA sequences. In an embodiment, the nucleic acid sequence is an RNA sequence, 5 such as an mRNA sequence. The nucleic acid sequence(s) may be single-stranded or may be double-strandedp. The nucleic acid sequence(s) may be, for example, genomic, recombinant, mRNA or cDNA. The nucleic acid sequence(s) may comprise synthetic nucleotides and / or modified nucleotides. These synthetic nucleotides and / or modified nucleotides may enhance in vivo activity and / or 10 stability. Due to the redundancy of the genetic code, variations in nucleic acid sequences are possible that encode for the same polypeptide. These variations in nucleic acid sequences are encompassed by the present invention. Therefore, multiple nucleic acid sequence(s) are envisaged, each of which may be different, but which still encode a binding molecule or 15 antibody according to the present invention. It is known in the art how to design and produce such nucleic acid sequences. In some embodiments, the nucleic acid sequence(s) may be codon optimised for production in the host cell of choice. In some embodiments, the nucleic acid sequence(s) may be operably linked to further sequence(s) such as control sequence(s), e.g. promoter sequence(s), 20 enhancer sequence(s), polyadenylation signal sequence(s) and / or other regulatory sequence(s), which control transcription and / or translation. The nucleic acid sequence(s) may be in the form of one or more expression cassettes. The nucleic acid sequences may be suitable for expression in prokaryotic cells or in eukaryotic cells, such as mammalian cells. Any promoter may be used, such as a strong promoter that is functional in prokaryotic cells or 25 in eukaryotic cells. Suitable promoters will be known in the art. The promoter may be a constitutive promoter. The promoter may be a tissue specific promoter. Vector The present invention provides a vector comprising the one or more nucleic acid sequence(s) of the invention. 30 Accordingly, the vector may comprise a polynucleotide comprising a nucleic acid sequence or sequences encoding the binding molecule as defined herein. The vector may comprise a P129624PCT polynucleotide comprising a nucleic acid sequence or sequences encoding the antibody according to the invention. The vector may be used to introduce nucleic acid sequence(s) according to the invention into a cell so that the cell expresses and / or produces the binding molecule as defined herein or 5 the antibody according to the invention. As used herein, the term “vector” may be considered interchangeable with the term “expression vector” and “expression construct”. The vector may be any vector that is suitable for introducing and / or expressing a nucleic acid sequence in a cell. The vector may comprise regulatory sequences, enhancer sequences and / or promoter sequences that promote 10 expression of a nucleic acid sequence in a cell. The vector according to the invention may be any agent capable of delivering nucleic acid sequence(s) according to the invention to a cell and / or expressing nucleic acid sequence(s) according to the invention in a cell. Examples of suitable vectors include but are not limited to plasmids, cosmids, phages, viruses or artificial chromosomes. 15 In some embodiments, the vector may be a plasmid or a viral vector. In some embodiments, the vector may be a retroviral vector or a lentiviral vector. The vector may be capable of transfecting or transducing a cell. Cells and related methods The present invention provides a cell comprising one or more nucleic acid sequence(s) 20 according to the invention, or a vector according to the invention. The present invention provides a cell comprising a binding molecule as defined herein. The present invention provides a cell comprising a BPC according to the invention. The present invention provides a cell comprising an antibody according to the invention. The polynucleotide or vector may, for example, be introduced into a cell by transduction or 25 transfection in vitro or ex vivo. As such, the present invention also provides a method for making a cell according to the invention comprising the step of introducing the one or more nucleic acid(s) according to the P129624PCT invention, or the vector according to the invention into said cell. In some embodiments, the nucleic acid(s) may be introduced as described herein. In some embodiments, the cell may be capable of expressing the binding molecule as defined herein. 5 In some embodiments, the cell may be capable of expressing the antibody according to the invention. In some embodiments, the cell may be capable of producing the binding molecule as defined herein or antibody according to the invention. In some embodiments, the cell may be capable of expressing and / or producing the binding 10 molecule or antibody as defined herein when the cell is cultured under suitable conditions. The present invention also provides a method for producing the binding molecule as defined herein, wherein the method comprises the steps of: (i) introducing one or more nucleic acid sequence(s) according to the invention, or a vector according to the invention into a cell; and 15 (ii) expressing the binding molecule thereof in the cell. The present invention also provides a method for producing the antibody according to the invention, wherein the method comprises the steps of: (i) introducing one or more nucleic acid sequence(s) according to the invention, or a vector according to the invention into a cell; and 20 (ii) expressing the binding molecule thereof in the cell. In some embodiments of the methods according to the invention, the one or more nucleic acid sequence(s) or vector may be introduced into the cell by transduction or transfection in vitro or ex vivo. In some embodiments of the methods according to the invention, culturing the cell under 25 suitable conditions may result in the cell expressing and / or producing the binding molecule or antibody as defined herein. In some embodiments, the method for producing the binding molecule or antibody as defined herein thereof may further comprise step (iii) harvesting the binding molecule or antibody or P129624PCT fragment thereof from the cell or cell culture supernatant of the cell. It will be understood that the binding molecule or antibody may be harvested from the cell. It will also be understood that the binding molecule or antibody may be harvested from supernatant of the cell, for example when the binding molecule or antibody is released out of 5 the cell into the cell culture medium that the cell is cultured in. In some embodiments, the cell may be a prokaryotic cell or a eukaryotic cell. In some embodiments, the cell may be a bacterial cell, a fungal cell, a yeast cell, a plant cell or an animal cell. In some embodiments, the cell may be a mammalian cell or an insect cell. In some 10 embodiments, the cell may be a human cell. Composition The present invention also provides a composition which comprises one or more BPCs according to the invention. In some embodiments, the present invention also provides a pharmaceutical composition comprising the binding molecule as defined herein. 15 As indicated above, the drug-antibody ratio (DAR) of the BPCs according to the invention may vary. Consequently, the composition may comprise a mixture of BPCs having a number of different DARs, and may therefore have an average DAR which is non-integral. In this specification “average DAR” and “average connection number” are synonymous. In some embodiments, the average DAR is an integer or decimal from about 1 to about 16. In 20 some embodiments, the average DAR is an integer or decimal of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15 or about 16. In some embodiments, the average DAR is an integer or decimal from about 4 to about 12. In some embodiments, the average DAR is an integer or decimal from about 6 to about 10. In some embodiments, the average DAR is an integer or 25 decimal from about 7 to about 9. In some embodiments, the average DAR is an integer or decimal from about 7.5 to about 8.5. In some embodiments, the average DAR is an integer or decimal from about 7.8 to about 8.2. In some embodiments, the average DAR is about 6.0. In some embodiments, the average DAR is about 6.1. In some embodiments, the average DAR is about 6.2. In some P129624PCT embodiments, the average DAR is about 6.3. In some embodiments, the average DAR is about 6.4. In some embodiments, the average DAR is about 6.5. In some embodiments, the average DAR is about 6.6. In some embodiments, the average DAR is about 6.7. In some embodiments, the average DAR is about 6.8. In some embodiments, the average DAR is 5 about 6.9. In some embodiments, the average DAR is about 7.0. In some embodiments, the average DAR is about 7.1. In some embodiments, the average DAR is about 7.2. In some embodiments, the average DAR is about 7.3. In some embodiments, the average DAR is about 7.4. In some embodiments, the average DAR is about 7.5. In some embodiments, the average DAR is about 7.6. In some embodiments, the average DAR is about 7.7. In some 10 embodiments, the average DAR is about 7.8. In some embodiments, the average DAR is about 7.9. In some embodiments, the average DAR is about 8.0. In some embodiments, the average DAR is about 8.1. In some embodiments, the average DAR is about 8.2. In some embodiments, the average DAR is about 8.3. In some embodiments, the average DAR is about 8.4. In some embodiments, the average DAR is about 8.5. In some embodiments, the 15 average DAR is about 8.6. In some embodiments, the average DAR is about 8.7. In some embodiments, the average DAR is about 8.8. In some embodiments, the average DAR is about 8.9. In some embodiments, the average DAR is about 9.0. In some embodiments, the average DAR is about 9.1. In some embodiments, the average DAR is about 9.2. In some embodiments, the average DAR is about 9.3. In some embodiments, the average DAR is 20 about 9.4. In some embodiments, the average DAR is about 9.5. In some embodiments, the average DAR is about 9.6. In some embodiments, the average DAR is about 9.7. In some embodiments, the average DAR is about 9.8. In some embodiments, the average DAR is about 9.9. In some embodiments, the DAR is about 10.0. In some embodiments, the composition comprises one or more conjugates having the 25 structure shown as formula (III-D’):

[0009] P129624PCT wherein: BM, L, R1 and X are as defined above for formula (III-D), either in its broadest aspect or a preferred aspect; and 5 q’ is an average connection number and is an integer or decimal from 1 to 16. In some embodiments, the composition comprises one or more conjugates having the structure shown as Formula (IVA’): or a pharmaceutically acceptable salt thereof, wherein, 10 q’ represents an average connection number, and is an integer or decimal from 1 to 16, and BM is a binding molecule as defined herein. P129624PCT In some embodiments, the composition comprises one or more conjugates having the structure shown as formula (II-Dx’): , wherein: 5 BM, L, L2, ring A, X and L1 are as defined above for formula (III-D), either in its broadest aspect or a preferred aspect; and q’ represents an average connection number, and is an integer or decimal from 1 to 16. In some embodiments, the composition comprises one or more conjugates having the structure shown as formula (IVB’) 10 or a pharmaceutically acceptable salt thereof, wherein, q’ represents an average connection number, and is an integer or decimal from 1 to 16; and BM is a binding molecule as defined herein. P129624PCT In some embodiments, the composition comprises one or more conjugates having the structure shown as formula I’: wherein: 5 BM, L1, L2, L3, L4, W, X, R1, R2 and R3 are as defined above for formula (I’), either in its broadest aspect or a preferred aspect; and q’ is an average connection number and is an integer or decimal from 1 to 16. In some embodiments, the composition comprises one or more conjugates having the structure shown as formula (IVC‘): 10 or a pharmaceutically acceptable salt thereof, wherein, q’ represents an average connection number, and is an integer or decimal from 1 to 16; and BM is a binding molecule as defined herein. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB), (I’) or (IVC’), the average P129624PCT connection number q’ is an integer or decimal from about 1 to about 16. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is an integer or decimal of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15 or about 16. In some 5 embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is an integer or decimal from about 4 to about 12. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is an integer or decimal from about 6 to about 10. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is an integer or decimal from about 7 10 to about 9. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is from about 7.5 to about 8.5. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is from about 7.8 to about 8.2. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average 15 connection number q’ is about 6.0. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.1. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.2. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.3. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), 20 (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.4. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.5. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.6. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.7. In some embodiments of 25 formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.8. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 6.9. In some embodiments- of formulae (III-D’) (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.0. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 30 7.1. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.2. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.3. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.4. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average P129624PCT connection number q’ is about 7.5. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.6. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.7. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average 5 connection number q’ is about 7.8. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 7.9. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.0. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.1. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), 10 (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.2. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.3. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.4. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.5. In some embodiments of 15 formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.6. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.7. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 8.8. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 20 8.9. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.0. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.1. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.2. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average 25 connection number q’ is about 9.3. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.4. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.5. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.6. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), 30 (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.7. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.8. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 9.9. In some embodiments of formulae (III-D’), (IVA’), (II-Dx’), (IVB’), (I’) or (IVC’), the average connection number q’ is about 10.0. P129624PCT Pharmaceutical Composition The present invention also provides a pharmaceutical composition which comprises the BPC according to the invention, together with a pharmaceutically acceptable carrier, diluent or excipient. 5 The present invention also provides a pharmaceutical composition which comprises the antibody according to the invention, together with a pharmaceutically acceptable carrier, diluent or excipient. The present invention also provides a pharmaceutical composition comprising the binding molecule as defined herein, the one or more nucleic acid(s) according to the invention, or the 10 vector according to the invention, together with a pharmaceutically acceptable carrier, diluent or excipient. In some embodiments, the compositions described herein may further comprise one or more selected from this list consisting of: an adjuvant, salt, active polypeptide, compound, component and active agent. 15 Compositions typically should be sterile and stable under the conditions of manufacture and storage. The composition according to the invention may be produced using current good manufacturing practices (CGMP). The pharmaceutical composition may be formulated to be suitable for administration to a patient in order to prevent and / or treat disease. Pharmaceutical compositions can be 20 formulated for administration by different routes, for example, for oral, parenteral, topical, inhalative, intravenous, intramuscular, rectal, sublingual, transdermal, subcutaneous, intratumoral application routes, according to their chemical and physical properties. The pharmaceutical composition may be in the form of a tablet, a coated tablet, powder, granulate, a pellet, a capsule, an effervescent tablet or a transdermal therapeutic system. The 25 pharmaceutical composition may be in the form of a liquid composition, selected from the group consisting of a solution, a syrup, an infusion, an extract, a solution for intravenous application, or a solution for infusion. The pharmaceutical composition may be in the form of a semisolid composition such as an emulsion, a suspension, a cream, a lotion, a gel, a globule, a buccal tablet or a suppository. 30 The term “carrier”, as used herein, may refer to a diluent, adjuvant, excipient, or vehicle. P129624PCT Such carriers can be sterile liquids, such as saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil. A sterile saline solution is a preferred carrier. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid 5 carriers. Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. The composition of the invention can be formulated as neutral or salt 10 forms. Salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc. In some embodiments, the salt may comprise a metal cation, such as a sodium salt or a 15 potassium salt. In some embodiments, the composition may comprise an aqueous diluent or solvent. In some embodiments, the aqueous diluent or solvent may be a phosphate buffered saline solution, such as a sterile phosphate buffered saline solution. In some embodiments, the composition may comprise one or more vesicles, nanoparticles, 20 lipid nanoparticle (LNPs), liposomes or polymeric mixtures. The composition may enable delivery of a nucleic acid(s) according to the invention and / or a vector according to the invention to a cell. Kit The present invention provides a kit comprising the BPC according to the invention. 25 The present invention provides a kit comprising the antibody according to the invention. The present invention provides a kit comprising the composition according to the invention. In some embodiments, the kit may optionally comprise instructions for using the kit to target the one or more payload(s) to a cell expressing CA19-9. P129624PCT Methods and uses The present invention provides an in vitro method comprising contacting a cell with the BPC according to the invention. The present invention provides an in vitro method comprising contacting a cell with the 5 antibody according to the invention. The invention provides a method of treating or diagnosing a disease, comprising administering the BPC according to the invention to a subject. The invention provides a method of treating or diagnosing a disease, comprising administering the antibody according to the invention to a subject. 10 The invention provides a method of treating or diagnosing a disease, comprising administering the composition according to the invention to a subject. The invention provides for use of the BPC according to the invention or the antibody according to the invention or the composition according to the invention for the manufacture of a medicament. 15 The invention provides the BPC according to the invention or the antibody according to the invention or the composition according to the invention for use as a medicament. The invention provides the BPC according to the invention for use in a method of therapy or a diagnostic method. The invention provides the antibody according to the invention for use in a method of therapy 20 or a diagnostic method. The invention provides the composition according to the invention for use in a method of therapy or a diagnostic method. In some embodiments, the disease is cancer. The medicament may be for use in the treatment of cancer. The method may be a method of treating, preventing or diagnosing cancer. 25 The cancer may express CA19-9. In some embodiments, the expression of CA19-9 is increased compared to the expression of CA19-9 by the same non-cancerous tissue or cells. In some embodiments, the cancer is gastrointestinal cancer, pancreatic cancer, ovarian P129624PCT cancer, colorectal cancer, stomach cancer, oesophageal cancer, endometrial cancer, breast cancer, bile duct carcinoma, transitional cell carcinoma, or hepatocellular carcinoma. In some embodiments, the pancreatic cancer is pancreatic ductal adenocarcinoma (PDAC). According to the invention, the term “CA19-9-positive cancer” means a cancer involving 5 cancer cells expressing CA19-9, preferably on the surface of said cancer cells. “Cell surface” is used in accordance with its normal meaning in the art, and thus includes the outside of the cell which is accessible to binding by proteins and other molecules. For example, a transmembrane protein having one or more extracellular portions is considered as being expressed on the cell surface. 10 CA19-9 is expressed on the surface of cells if it is located at the surface of said cells and is accessible to binding by CA19-9-specific antibodies added to the cells which have not been disrupted. According to the invention, the term “disease” refers to any pathological state, including cancer, in particular those forms of cancer described herein. Any reference herein to cancer 15 or particular forms of cancer also includes cancer metastasis thereof. In a preferred embodiment, a disease to be treated according to the present application involves cells expressing CA19-9. “Diseases associated with cells expressing CA19-9” or similar expressions means according to the invention that CA19-9 is expressed in cells of a diseased tissue or organ. 20 In one embodiment, expression of CA19-9 in cells of a diseased tissue or organ is increased compared to the state in a healthy tissue or organ. An increase refers to an increase by at least 10%, in particular at least 20%, at least 50%, at least 100%, at least 200%, at least 500%, at least 1000%, at least 10000% or even more. In one embodiment, expression is only found in a diseased tissue, while expression in a 25 corresponding healthy tissue is repressed. For example, CA19-9 is expressed in pancreatic cancer tissue while expression is not detectable in non-cancerous pancreatic tissue. According to the invention, diseases associated with cells expressing CA19-9 include cancer diseases. Furthermore, according to the invention, cancer diseases preferably are those wherein the cancer cells express CA19-9. P129624PCT As used herein, a “cancer disease” or “cancer” includes a disease characterized by aberrantly regulated cellular growth, proliferation, differentiation, adhesion, and / or migration. By “cancer cell” is meant an abnormal cell that grows by a rapid, uncontrolled cellular proliferation and continues to grow after the stimuli that initiated the new growth cease. Preferably, a “cancer 5 disease” is characterized by cells expressing CA19-9 and a cancer cell expresses CA19-9. A cell expressing CA19-9 preferably is a cancer cell, preferably of the cancers described herein. According to the invention, a “carcinoma” is a malignant tumor derived from epithelial cells. “Adenocarcinoma” is a cancer that originates in glandular tissue. This tissue is also part of a larger tissue category known as epithelial tissue. Epithelial tissue includes skin, glands and a 10 variety of other tissue that lines the cavities and organs of the body. Epithelium is derived embryologically from ectoderm, endoderm and mesoderm. To be classified as adenocarcinoma, the cells do not necessarily need to be part of a gland, as long as they have secretory properties. This form of carcinoma can occur in some higher mammals, including humans. Well differentiated adenocarcinomas tend to resemble the glandular tissue that they 15 are derived from, while poorly differentiated may not. By staining the cells from a biopsy, a pathologist will determine whether the tumor is an adenocarcinoma or some other type of cancer. Adenocarcinomas can arise in many tissues of the body due to the ubiquitous nature of glands within the body. While each gland may not be secreting the same substance, as long as there is an exocrine function to the cell, it is considered glandular and its malignant form is 20 therefore named adenocarcinoma. Malignant adenocarcinomas invade other tissues and often metastasize given enough time to do so. The pancreas, an organ of endodermal derivation, is the key regulator of protein and carbohydrate digestion and glucose homeostasis. The exocrine pancreas (80% of the tissue mass of the organ) is composed of a branching network of acinar and duct cells that produce 25 and deliver digestive enzymes into the gastrointestinal tract. The acinar cells, which are organized in functional units along the duct network, synthesize and secrete enzymes into the ductal lumen in response to cues from the stomach and duodenum. Within the acinar units near the ducts are centroacinar cells. The endocrine pancreas, which regulates metabolism and glucose homeostasis through the secretion of hormones into the bloodstream, is 30 composed of four specialized endocrine cell types gathered together into clusters called Islets of Langerhans. Pancreatic cancer is a malignant neoplasm originating from transformed cells arising in tissues P129624PCT forming the pancreas. Pancreatic cancer includes adenocarcinomas (tumors exhibiting glandular architecture) arising within the exocrine component of the pancreas and neuroendocrine carcinomas arising from islet cells. The most common form of pancreatic cancer, ductal adenocarcinoma, is typically 5 characterized by moderately to poorly differentiated glandular structures on microscopic examination. Pancreatic ductal adenocarcinoma (PDAC) commonly arises in the head of the pancreas with infiltration into surrounding tissues including lymphatics, spleen, and peritoneal cavity, and with metastasis to the liver and lungs. PDAC primarily exhibits a glandular pattern with duct-like structures and varying degrees of cellular atypia and differentiation. Less 10 common subtypes of PDAC include colloid, adenosquamous, or sarcomatoid histology. Often within an individual tumor, there are regional differences in histology, tumor grade, and degree of differentiation. Even the smallest primary lesions commonly exhibit perineural and lympho- vascular invasion, suggesting a propensity for early distant spread. The second most common type of exocrine pancreas cancer is mucinous. Mucinous 15 adenocarcinoma produces a large volume of mucin that results in a cystic appearance on imaging studies. Pancreatic neuroendocrine tumors form in hormone-making cells (islet cells) of the pancreas. Acinic cell neoplasms arise from the acinar cells of the pancreas. According to the invention, the term “cancer” also includes cancer metastasis of a primary 20 tumor such as primary pancreatic cancer. Thus, if reference is made, for example, to pancreatic cancer, this also includes metastasis of the pancreatic cancer, for example metastasis to the lung, liver and / or lymph nodes. By “metastasis” is meant the spread of cancer cells from its original site to another part of the body. The formation of metastasis is a very complex process and depends on detachment of 25 malignant cells from the primary tumor, invasion of the extracellular matrix, penetration of the endothelial basement membranes to enter the body cavity and vessels, and then, after being transported by the blood, infiltration of target organs. Finally, the growth of a new tumor at the target site depends on angiogenesis. Tumor metastasis often occurs even after the removal of the primary tumor because tumor cells or components may remain and develop metastatic 30 potential. In one embodiment, the term “metastasis” according to the invention relates to “distant metastasis” which relates to a metastasis which is remote from the primary tumor and the regional lymph node system. In one embodiment, the term “metastasis” according to the P129624PCT invention relates to lymph node metastasis. One particular form of metastasis which is treatable using the therapy of the invention is metastasis originating from pancreatic cancer as primary site. In preferred embodiments such pancreatic cancer metastasis is metastasis into lymph nodes, metastasis into lung and / or metastasis into liver. 5 A refractory cancer is a malignancy for which a particular treatment is ineffective, which is either initially unresponsive to treatment, or which becomes unresponsive over time. By “treat” is meant to administer a compound or composition or a combination of compounds or compositions to a subject in order to prevent or eliminate a disease, including reducing the size of a tumor or the number of tumors in a subject; arrest or slow a disease in a subject; 10 inhibit or slow the development of a new disease in a subject; decrease the frequency or severity of symptoms and / or recurrences in a subject who currently has or who previously has had a disease; and / or prolong, i.e., increase the lifespan of the subject. In particular, the term “treatment of a disease” includes curing, shortening the duration, ameliorating, preventing, slowing down or inhibiting progression or worsening, or preventing 15 or delaying the onset of a disease or the symptoms thereof. The term “patient” means according to the invention a subject for treatment, in particular a diseased subject, including human beings, nonhuman primates or other animals, in particular mammals such as cows, horses, pigs, sheep, goats, dogs, cats or rodents such as mice and rats. In a particularly preferred embodiment, a patient is a human being. 20 EXAMPLES ADCC and CDC assays with 5B1-Fc-inert Mab and ADC variants For ADCC (antibody-dependent cellular cytotoxicity) assay, COLO 205 cell line served as target positive cell line. Human PBMCs from a healthy donor were used as effector cells (E:T ratio 40:1). Target cells and effector cells were incubated for 12 hours with 5B1 mAb and 5B1- 25 ADCs which have the formula (IVC) as defined above wherein BM is one of a number of antibodies with different Fc-silencing mutations (LALA, LALA-KA, LALA-deltaA & STR) in different concentrations (25000 ng / mL – 0.01 ng / mL). The specific cell lysis was determined using a luciferase-based assay. For CDC (complement-dependent cytotoxicity) assay, CA-19-9+ CHO-K1 transfectants (solid 30 line) served as target cells. Target cells were incubated with human serum (25 % final P129624PCT concentration) and 5B1 mAb and 5B1-ADCs with different Fc silencing mutations (LALA, LALA-KA, LALA-deltaA & STR) at different concentrations (250000 ng / mL – 15.7 ng / mL) for 4 hours. CDC was determined using a luciferase-based assay. The STR, LALA-KA and LALA-deltaA mutations effectively reduce Fc functionality as 5 demonstrated by reduced cell lysis compared to wild-type 5B1 antibody (Figure 1). 5B1-ADC treatment leads to potent elimination of advanced xenograft tumors in mice (ADC-1) ADC-1 has the formula (IVC) as defined above, wherein BM is 5B1 antibody, and q’ has an average value of 8.0. 10 To determine the anti-tumoral efficacy of ADC-1 in vivo, a CA19.9-positive human pancreatic ductal adenocarcinoma (BxPC3) xenograft mouse model was utilized. To that end, Hsd:Athymic Nude-Foxn1 nu / nu mice (n = 14 / group) were subcutaneously (s.c.) inoculated with 5 x 106BxPC3 cells per mouse. At a median tumor size of approximately 150 mm3mice (n = 14) were stratified into treatment and control groups. A treatment regimen comprising 15 seven intraperitoneal (i.p.) bolus injections once weekly was initiated one day later applying ADC-1 in flat doses of 3 mg / kg or 8 mg / kg (Figure 2A). A target irrelevant ctrl. IgG-ADC (Comparative ADC-1) , which has the formula (IVC) wherein BM is a target irrelevant IgG and the 5B1 monoclonal antibody lacking any payload-linker moieties (AB-1) served as controls with a dose of 8 mg / kg respectively. 20 Tumor growth was monitored three times a week. 5B1-ADC treatment lead to potent elimination of advanced human PDAC tumor xenograft in mice (Figure 2B). P129624PCT 5B1-ADC treatment is well tolerated in mice and leads to survival benefits. Body weights of mice were examined twice per week using a laboratory scale. No weight loss occurred in any treatment or control group (Figure 2C). No other clinical signs occurred during 5B1-ADC treatment confirming a good tolerability of 5B1-ADC in mice. A significant dose 5 dependent survival benefit of mice receiving 5B1-ADC treatment compared to control groups could be demonstrated (Figure 2D). 5B1-ADC treatment leads to potent elimination of advanced xenograft tumors in mice (ADC-2 and ADC-3) ADC-2 has the formula (IVA) as defined above, wherein BM is 5B1 antibody, and q’ has an 10 average value of 7.99. The linker-payload portion of ADC-2 is referred to in this Example as “Linker 2”). ADC-3 has the formula (IVB) as defined above, wherein BM is 5B1 antibody, and q’ has an average value of 8.00. The linker-payload portion of ADC-3 is referred to in this Example as “Linker 1”). 15 To determine the anti-tumoral efficacy of the 5B1-ADC in vivo, a CA19.9-positive human pancreatic ductal adenocarcinoma (BxPC3) xenograft mouse model was utilized. To that end, Hsd:Athymic Nude-Foxn1 nu / nu mice (n = 13-14 / group) were subcutaneously (s.c.) inoculated with 5 x 106BxPC3 cells per mouse. At a median tumor size of approximately 150 mm3mice were stratified into treatment and control groups. A treatment regimen comprising 20 seven intraperitoneal (i.p.) bolus injections once weekly was initiated two days later applying ADC-2 or ADC-3 in flat doses of 3 mg / kg and 8 mg / kg respectively (Figure 3A). A target irrelevant IgG-ADC, which has the formula (IVA) wherein BM is a target irrelevant IgG and the payload-linker portion is Linker 2 (Comparative ADC-2) and the 5B1 monoclonal antibody lacking any payload-linker moieties (AB-1) were used as controls with a dose of 8 mg / kg 25 respectively. P129624PCT Tumour growth was monitored three times a week. 5B1-ADC treatment lead to potent elimination of advanced human PDAC tumor xenograft in mice. No mouse in any group showed weight loss over the time of treatment (Figure 3C). No other side effects of 5B1-ADC 5 therapy concerning the health of the mice were observed (Figure 3C). A significant dose dependent survival benefit of mice receiving 5B1-ADC treatment compared to control groups could be demonstrated (Figure 3D). Binding affinities of Fc-inert 5B1-ADC and control items to four human cancer cell lines 10 Cell binding of 5B1-ADC Fc-inert to its target was assessed via flow cytometry on three human cancer cell lines, including CA19-9 high-expressing COLO 205 cells, medium-expressing BxPC3 and HT-1197 cells. SK-OV-3 cells, which do not express the target, served as negative control.5B1-ADC Fc was added to the cells at concentrations ranging from 0.046 to 300 nM. For comparison, the unconjugated 5B1-mAb Fc-inert served as positive control, while a non- 15 target specific hIgG1 and an isotype ADC (ADC-IC) were utilized as negative controls. The samples were incubated for 60 minutes. A PE-conjugated anti-human IgG Fc antibody was used as a secondary antibody. 5B1-ADC Fc-inert showed specific and concentration- dependent binding to the target-positive COLO 205, HT-1197 and BxPC3 cells (Fig.4A-C). No binding could be detected with the CA19-9 negative control cell line SK-OV-3 demonstrating 20 the specificity of 5B1-ADC Fc-inert for CA19-9 (Fig.4D). No binding of the irrelevant ADC-IC and hIgG antibodies was detected in any of the tested cell lines. CDC and ADCC activity of Fc-inert 5B1-ADC in comparison to Fc-competent 5B1-mAb For the CDC assay, CA19-9-positive, luciferase-expressing CHO-K1 transfectants (CHO-K1- CA19-9, solid lines) served as target cells. 5B1-ADC Fc-inert was serially diluted (63 to 25 250,000 ng / mL) and added the target cells.5B1-mAb Fc-comp was used as a positive control. Pooled normal human serum was then added to a final concentration of 25% and the samples were incubated for 4 h at 37°C and 5% CO2. Luciferase activity was measured as readout for cell lysis. The CDC activity of 5B1-ADC Fc-inert was reduced compared to 5B1-mAb Fc-comp P129624PCT (Fig.5A). For the ADCC assay, luciferase-expressing COLO 205 cells (COLO 205_luc) served as target- positive cells.5B1-ADC Fc-inert was serially diluted (0.01 to 25,000 ng / mL) and added to the target cells.5B1-mAb Fc-comp was used as a positive control. Human PBMCs from a healthy 5 donor served as effector cells and were added at an E:T ratio of 40:1. The samples were incubated for 12 h at 37°C with 5% CO2. Luciferase activity was measured as readout for cell lysis. 5B1-ADC Fc-inert showed no ADCC activity, even at high concentrations. In contrast, 5B1-mAb Fc-comp mediated potent, dose-dependent lysis of the target cells (Fig.5B). ADCP activity of Fc-inert 5B1-ADC and 5B1-mAb and Fc-competent 5B1-mAb in 10 human cancer cell lines The ADCP activity of 5B1-ADC Fc-inert was assessed using flow cytometry across four human cancer cell lines, including CA19-9 high-expressing COLO 205 cells, medium-expressing BxPC3 and HT-1197 cells. SK-OV-3 cells, which do not express the target, served as negative control. M2c macrophages derived from human PBMCs served as effector cells and were15 added to the CellTrace Far Red dye labeled target cells at an E:T ratio of 4:1.5B1-ADC Fc- inert was added at concentrations ranging from 0.001 to 101 nM and incubated for four hours. For comparison, the unconjugated 5B1-mAb Fc-inert served as negative control, while 5B1- ADC Fc-comp served as positive control. An anti-human CD14 antibody was used to detect the effector cells via flow cytometry. The samples were gated for CellTrace Far Red and CD14 20 double positive cells and the proportion of double positive cells in CellTrace Far Red positive cells was calculated.5B1-ADC Fc-inert and the control 5B1-mAb Fc-inert showed no ADCP activity in COLO 205, HT-1197 and BxPC3 cells while the positive control 5B1-mAb Fc-comp showed strong ADCP activity in all three cell lines (Fig.6A-C). None of the test and control items showed ADCP in target-negative SK-OV-3 cells confirming target-mediated ADCP 25 activity of 5B1-ADC Fc-inert (Fig.6D). Anti-proliferation effect of Fc-inert 5B1-ADC and control items in human cancer cell lines The anti-proliferation activity of 5B1-ADC Fc-inert was assessed in CA19-9 high-expressing COLO 205 cells, medium-expressing BxPC3 and HT-1197 cells. SK-OV-3 cells, which do not 30 express the target, served as negative control. The unconjugated 5B1-mAb Fc-inert, ADC-IC and the free toxin payload (YL0010014) served as controls. Target cells were incubated with the test and control items at concentrations ranging from 0.001 nM to 200 nM for five days. P129624PCT Cell viability was measured using the CellTiter-Glo luminescent cell viability assay.5B1-ADC Fc-inert exhibited potent anti-proliferative effects in target-expressing COLO 205 and BxPC3 cell lines (Fig.7A, C). In contrast, 5B1-ADC Fc-inert did not show any anti-proliferative effects on the target-negative SK-OV-3 cell line, indicating the target-specific cytotoxicity of 5B1-ADC 5 Fc-inert. For the HT-1197 cell line, no inhibition curve could be generated for either 5B1-ADC Fc-inert or YL0010014, indicating poor susceptibility of this cell line to the payload. At high antibody concentrations of 40 and 200 nM, the ADC-IC exhibited non-specific anti-proliferative effects on COLO 205, BxPC3, and SK-OV-3 cells (Fig.7D). Internalization of Fc-inert 5B1-ADC and control items by human cancer cell lines 10 The internalization of 5B1-ADC Fc-inert was assessed in CA19-9 high-expressing COLO 205 cells and medium-expressing BxPC3 and HT-1197 cells by flow cytometry. SK-OV-3 cells, which do not express the target, served as negative control. The unconjugated 5B1-mAb Fc- inert, ADC-IC and a human IgG1 isotype-mAb served as controls. Test and control items were labeled with the pH-sensitive dye; pH-rodo. Cell lines were incubated with 40 nM of labeled 15 test and control items and internalization was measured at indicated time points via flow cytometry. In COLO 205 cells, the internalization of 5B1-ADC Fc-inert was detectable after three hours of incubation and further increased reaching a maximal internalization rate of nearly 100% at 12 hours (Fig 8A). In HT-1197 and BxPC3 cells, the internalization of 5B1-ADC Fc-inert was also detectable after three hours of incubation and further increased over the 24 20 hour time course reaching a moderate internalization of 45-60% (Fig 8B, C). The 5B1-mAb Fc-inert showed similar internalization rates in all cell lines indicating that the addition of the linker-payload has no effect on the internalization. Low levels of non-specific internalization were observed in COLO 205 and BxPC3 cells treated with ADC-IC and a human IgG1 isotype- mAb at 12 and 24 hours. No internalization was observed in target-negative SK-OV-3 cells 25 indicating target-specific internalization of 5B1-ADC Fc-inert and 5B1-mAb Fc-inert (Fig 8D). Cell cycle analysis of COLO 205 and BxPC3 cells following treatment with Fc-inert 5B1-ADC The cell cycle of CA19-9 high-expressing COLO 205 cells and medium-expressing BxPC3 cells after treatment with 5B1-ADC Fc-inert was assessed by flow cytometry analysis. 30 Treatment with DMSO, DXd and ADC-IC served as controls. COLO 205 cells were incubated with the test- and control- ADC at concentrations of 0.1 nM and 5 nM. BxPC3 cells were incubated with the test- and control- ADC at concentrations of 1 nM and 50 nM. Concentrations P129624PCT of 0.1% DMSO and 100 nM DXd were used in both cell lines. Cell cycle was measured by BrdU incorporation and total DNA content using flow cytometry 24 hours post treatment. Compared to the DMSO control, treatment with 0.1 nM 5B1-ADC Fc significantly increased the number of COLO 205 cells in the G2 / M phase. Treatment with 5 nM 5B1-ADC Fc 5 significantly increased the number of COLO 205 cells in the S phase.100 nM DXd showed a similar effect. In contrast, 24-hour treatment with ADC-IC showed no effect on the S and G2 / M cell populations in COLO 205 cells indicating the target-mediated cell cycle effects of 5B1- ADC Fc-inert (Fig.9A). Compared to the DMSO control, treatment with DXd and 5B1-ADC Fc-inert showed a significant effect on the cell cycle in BxPC3 cells.50 nM 5B1-ADC Fc-inert 10 increased the number of cells in the G2 / M phase. 100 nM DXd showed a similar effect. Treatment with 5B1-ADC Fc-inert at 1 nM significantly increased the number of cells in the G2 / M phase. In contrast, 24-hour treatment with ADC-IC showed no effect on the S and G2 / M cell populations in BxPC3 cells indicating the target-mediated cell cycle effects of 5B1-ADC Fc-inert (Fig.9B). 15 Cell apoptosis in COLO 205 and BxPC3 cells following treatment with Fc-inert 5B1- ADC Cell apoptosis of CA19-9 high-expressing COLO 205 cells and medium-expressing BxPC3 after treatment with 5B1-ADC Fc-inert was assessed by flow cytometry analysis. Treatment with DMSO, DXd and ADC-IC served as controls. COLO 205 cells were incubated with the 20 test- and control- ADC at concentrations of 0.1 nM and 5 nM. BxPC3 cells were incubated with the test- and control- ADC at concentrations of 1 nM and 50 nM. Concentrations of 0.1% DMSO and 100 nM DXd were used in both cell lines. 48 hours post treatment cells were labeled with FITC-Annexin V and propidium iodide and analyzed via flow cytometry. Treatment with 5 nM 5B1-ADC Fc-inert and 100 nM DXd showed a significant induction of apoptosis in 25 COLO 205 cells, while the ADC-IC showed no apoptotic effect, indicating target-induced apoptosis in 5B1-ADC Fc-inert treated cells (Fig 10A). Treatment with 50 nM 5B1-ADC Fc- inert and 100 nM DXd also showed a significant induction of apoptosis in BxPC3 cells, while the ADC-IC showed no apoptotic effect, indicating target-mediated apoptosis of 5B1-ADC Fc- inert (Fig 10B). 30 Bystander killing activity of 5B1-ADC Fc-inert The bystander killing activity of 5B1-ADC Fc-inert was assessed in co-cultures of target- negative SK-OV-3-luc cells and CA19-9 high-expressing COLO 205 cells or CA19-9 medium- P129624PCT expressing BxPC3 cells. Cells were seeded at a ratio of 1:3. SK-OV-3-luc cell monocultures served as negative control. Cell cultures were incubated with 5B1-ADC Fc-inert and ADC-IC at concentrations ranging from 0.0001 nM to 40 nM for five days. Bystander activity was measured by luciferase activity.5B1-ADC Fc-inert exhibited potent bystander killing activity 5 effects in target-negative SK-OV-3-luc cells co-cultured with target-expressing COLO 205 (Fig. 11A) and BxPC3 (Fig.11B) cell lines with corresponding ReIC50 values of 1.29 nM and 0.05 nM, respectively. In contrast, 5B1-ADC Fc-inert did not show any anti-proliferative effects on the target-negative SK-OV-3 monoculture, indicating the target-specific bystander killing activity of 5B1-ADC Fc-inert in co-cultures (Fig.11C). At high antibody concentrations of 4010 nM, the ADC-IC exhibited non-specific bystander killing activity in SK-OV-3-luc cells co- cultured with BxPC3 cells (Fig.11B) and SK-OV-3-luc monocultures (Fig.11C). 5B1-ADC Fc-inert treatment is well tolerated, leads to potent elimination of advanced xenograft tumors, and provides survival benefits in mice (BxPC3) To determine the anti-tumoral efficacy of 5B1-ADC Fc-inert in vivo, a CA19-9-positive human 15 pancreatic ductal adenocarcinoma (BxPC3) xenograft mouse model was utilized. To that end, Hsd:Athymic Nude-Foxn1 nu / nu mice (n = 15 / group) were subcutaneously (s.c.) inoculated with 5 × 106BxPC3 cells per mouse. At a mean tumor size of approximately 130 mm3mice (n= 15) were stratified into treatment and control groups. A treatment regimen comprising six intravenous (i.v.) bolus injections once weekly was initiated three days later applying 5B1-ADC 20 Fc-inert in flat doses of 3 mg / kg or 8 mg / kg. The unconjugated Fc-competent 5B1 monoclonal antibody (5B1-mAb Fc-comp) and the payload-conjugated Fc-competent 5B1 ADC (5B1-ADC Fc-comp) were serving as controls with a dose of 8 mg / kg, while a third control group received DPBS. Body weights of mice were examined twice per week using a laboratory scale. No weight loss occurred in any treatment or control group. No other clinical signs occurred during 25 5B1-ADC Fc-inert treatment confirming a good tolerability of 5B1-ADC Fc-inert in mice (Fig. 12A). Treatment with 3 and 8 mg / kg 5B1-ADC Fc-inert resulted in a significant reduction in tumor volumes compared to the 5B1-mAb Fc-comp and DPBS control groups (Fig.12B). No difference in anti-tumor effect between 5B1-ADC Fc-inert and 5B1-ADC Fc-comp was observed. A significant dose dependent survival benefit of mice receiving 5B1-ADC treatment 30 compared to control groups could be demonstrated (Fig.12C). P129624PCT 5B1-ADC Fc-inert treatment is well tolerated, leads to potent elimination of advanced xenograft tumors, and provides survival benefits in mice (COLO 205) To determine the anti-tumoral efficacy of 5B1-ADC Fc-inert in vivo, a CA19-9-positive human colon adenocarcinoma (COLO 205) xenograft mouse model was utilized. To that end, 5 NMRI:nu / nu (Rj:NMRI-Foxn1nu / nu) mice (n = 20 / group) were subcutaneously (s.c.) inoculated with 1 × 106COLO 205 cells per mouse. At a mean tumor size of approximately 200 mm3mice were stratified into treatment and control groups. A treatment regimen comprising six intravenous (i.v.) bolus injections once weekly was initiated one day later applying 5B1-ADC Fc-inert in flat doses of 1, 3 and 8 mg / kg respectively. The control group received DPBS. No 10 weight loss occurred in any treatment or control group. No other clinical signs occurred during 5B1-ADC Fc-inert treatment confirming a good tolerability of 5B1-ADC Fc-inert in mice (Fig. 13A). 5B1-ADC Fc-inert treatment at a dose of 8 mg / kg resulted in a significant anti-tumor effect compared to the DPBS control group.5B1-ADC Fc-inert treatment at doses of 3 mg / kg showed a delay in tumor growth (Fig.13B).5B1-ADC Fc-inert treatment at 8 mg / kg conferred 15 significant survival benefits over the DPBS control group (Fig.13C). 5B1-ADC Fc-inert treatment is well tolerated and leads to potent elimination of advanced xenograft tumors (CAPAN-2) To determine the anti-tumoral efficacy of 5B1-ADC Fc-inert in vivo, a CA19-9-positive human pancreatic ductal adenocarcinoma (CAPAN-2) xenograft mouse model was utilized. To that 20 end, NSG mice (n = 10 / group) were subcutaneously (s.c.) inoculated with 5 × 106CAPAN-2 cells per mouse. At a mean tumor size of approximately 100 mm3mice (n = 10) were stratified into treatment and control groups. A treatment regimen comprising four intravenous (i.v.) bolus injections once weekly was initiated three days later applying 5B1-ADC Fc-inert in flat doses of 0.3, 1, 3 or 8 mg / kg, respectively. The control group received DPBS. Body weights of mice 25 were examined twice per week using a laboratory scale. Weight loss occurred in all groups at the start of treatment. However, the body weight recovered at later time points. No clinical signs were observed in any of the treatment groups confirming a good tolerability of 5B1-ADC Fc-inert in mice (Fig.14A). Treatment with 1, 3 and 8 mg / kg 5B1-ADC Fc-inert resulted in a significant reduction in tumor volumes compared to the DPBS control groups (Fig. 14B). 30 Except for three animals that were sacrificed for reasons unrelated to the experimental procedure, all animals survived until the end of the observation period. P129624PCT NUMBERED EMBODIMENTS 1. A binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain 5 complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, LCDR1 comprises an amino acid 10 sequence according to SEQ ID NO: 4, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 5, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, 15 optionally via one or more linkers. 2. A binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity 20 determining regions (LCDRs) 1-3 according to the Kabat numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 15, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 16, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid 25 sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. 30 3. A binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: P129624PCT a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Chothia numbering scheme, wherein: 5 HCDR1 comprises an amino acid sequence according to SEQ ID NO: 20, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 21, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence 10 according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. 4. The BPC according to any one of embodiments 1 to 3, wherein the binding molecule 15 comprises a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID NO: 7 or a variant having at least 80% sequence identity thereto. 5. The BPC according to any one of embodiments 1 to 4, wherein the binding molecule comprises a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8 or a variant having at least 80% sequence identity thereto. 20 6. The BPC according to any one of embodiments 1 to 5, wherein the binding molecule further comprises an Fc region. 7. The BPC according to embodiment 6, wherein the Fc region is a modified Fc region. 8. The BPC according to embodiment 7, wherein the binding of the Fc region to FcγRI is reduced compared to a wild-type Fc region. 25 9. The BPC according to embodiment 7 or embodiment 8, wherein the Fc region comprises an amino acid substitution at position 234, or an amino acid substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme. 30 10. The BPC according to embodiment 9, wherein the one or more amino acid substitution(s) are selected from the group consisting of: P129624PCT a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); b) L234A, L235A, and K322A (LALA-KA); c) L234S, L235T, and G236R (STR); and d) L234A and L235A (LALA). 5 11. The BPC according to any preceding embodiment, which is an antibody drug conjugate (ADC), wherein the binding molecule comprises a heavy chain and a light chain. 12. The BPC according to embodiment 11, wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 10, or a variant having at least 80% sequence identity thereto. 10 13. The BPC according to embodiment 11, wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 or SEQ ID NO: 14, or a variant having at least 80% sequence identity thereto. 14. The BPC according to any one of embodiments 11 to 13, wherein the light chain comprises an amino acid sequence according to SEQ ID NO: 9, or a variant having at least 15 80% sequence identity thereto. 15. The BPC according to any one of the preceding embodiments, wherein the one or more payload moieties is covalently linked to the binding molecule via a linker. 16. The BPC according to any one of the preceding embodiments, wherein the linker comprises or is a peptide linker. 20 17. The BPC according to any one of the preceding embodiments, wherein the linker comprises a first conjugation moiety for coupling with the binding molecule. 18. The BPC according to embodiment 17, wherein the linker comprises a second conjugation moiety for coupling with the payload moiety. 19. The BPC according to any one of the preceding embodiments, wherein the linker 25 comprises a peptide linker selected from AA1, AA1-Gly, Val-Cit, Val-Ala, Val-AA1, Val-AA1-Gly, AA1-Ala-Asn, Ala-Ala-Ala, Ala-Ala-Asn and Gly-Gly-Phe-Gly. P129624PCT 20. The BPC according to embodiment 19, wherein the amino acid residue represented 5 21. The BPC according to any one of embodiments 17 to 20, wherein the first conjugation moiety comprises a pyrimidine-sulfone moiety. 22. The BPC according to embodiment 21, wherein the pyrimidine-sulfone moiety is linked to the peptide moiety via a C1-10 alkynoyl group. 10 23. The BPC according to embodiment 19, wherein the linker comprises a peptide linker comprising the peptide sequence Gly-Gly-Phe-Gly. 24. The BPC according to any one of embodiments 17 to 20, wherein the first conjugation moiety comprises a maleimide moiety which is capable of adding to a sulfhydryl moiety on the binding molecule such that the conjugate comprises a sulfur-linked succinimidyl group. 15 25. The BPC according to embodiment 24, wherein the maleimide moiety is linked to the peptide moiety via a C1-10 alkanoyl group. 26. The BPC according to any preceding embodiment, wherein the payload moiety is selected from a drug, a detectable marker, a radioisotope, a fluorescent agent, a luminescent P129624PCT agent, a colored agent, an enzyme, polyethylene glycol, a nuclide, a nucleic acid, a small molecule toxin, a polypeptide having binding activity, a protein, a receptor, a ligand, another active agent that inhibits tumor cell growth, promotes tumor cell apoptosis or necrosis. 27. The BPC according to embodiment 26, wherein the payload moiety is a drug. 5 28. The BPC according to embodiment 27, wherein the payload moiety is a cytotoxic drug, immune modulator, or a STING inhibitor. 29. The BPC according to embodiment 28, wherein the cytotoxic drug is a tubulin inhibitor, a DNA damaging agent, a TOPO1 inhibitor, an auristatin, a maytansinoid, or a calicheamicin. 30. The BPC according to embodiment 29, wherein the cytotoxic drug is a TOPO1 10 inhibitor. 31. The BPC according to embodiment 30, wherein the TOPO1 inhibitor is a camptothecin or an exatecan. 32. The BPC according to any one of embodiments 1 to 31, wherein the payload or payload-linker comprises a structure shown as formula (III-A): 15 or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein R1is selected from the group consisting of: -O-, -(R2)N-, -P(=O)(R2)- and -S-; X is -L1-CH2-C(O)-; 20 L1is -(C(R3a)(R3b))m-, wherein 0 or at least 1 methylene unit of L1is independently replaced by -C(O)-, -C(=S)-, -C(=NR4b)- or -C(=N2)-; P129624PCT wherein each R2, each R3a, each R3band each R4bare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, - C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, -S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), - OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; 5 wherein each R, each Ra and each Rb are each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m is selected from the group consisting of integers ≥ 0, 10 when R1is -O- or -HN-, at least 1 methylene unit of L1is independently replaced by -C(O)-, - C(=S)-, -C(=NR4b)- or -C(=N2)-, or each R3aand each R3bare not both hydrogen. 33. The BPC according to any one of embodiments 1 to 31, wherein the payload-linker comprises a structure shown as formula (III-C): 15 or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein L is -La-Lb-Lc-; -La- is selected from the group consisting of: 20 P129624PCT wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, - P(=O)(Rwx)-, -N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or - 5 C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, -10 P(=O)(Rzx)-, -N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently 15 substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, -N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group 20 optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; 25 -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, - 5 C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, - N(H)SO2H and a C1-6aliphatic group. 34. The BPC according to any one of embodiments 1 to 31, wherein the conjugate comprises a structure shown as formula (III-D): 10 or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein BM is the binding molecule and q is a connection number which is an integer from 1 to 16. 35. The BPC according to any one of embodiments 33 or 34, wherein -La- is P129624PCT wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is 1, 2, 3 or 6, and 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - C(O)-; 5 wherein yn is 0, 4 or 8, and yp is 0 or 1; wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)- ; -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or 10 independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group. 15 36. The BPC according to any one of embodiments 32 to 35, wherein -Lb- is selected from the group consisting of: 37. The BPC according to any one of embodiments 32 to 36, wherein -Lc- is 20 , wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, halogen, -OH and a C1-6aliphatic group. P129624PCT 38. The BPC according to embodiment 35, wherein -La- is . 39. The BPC according to embodiment 36, wherein - . 40. The BPC according to embodiment 37, wherein -Lc- is . 5 41. The BPC according to any one of embodiments 38-40, wherein -La-Lb-Lc- is 42. The BPC according to embodiment 32, wherein the payload moiety of the conjugate is selected from the group consisting of the following structures: P129624PCT III-A-11 III-A-12 III-A-13 III-A-14 III-A-15 III-A-16 III-A-17. 43. The BPC according to embodiment 32, wherein the payload moiety of the conjugate has the following structure: . 5 44. The BPC according to embodiment 33, wherein the payload-linker moiety of the conjugate has the following structure: . 45. The BPC according to embodiment 34, wherein the conjugate is selected from the group consisting of the following structural formulae: P129624PCT BM BM BM ONO H O NH O N F N O HO O q 130 P129624PCT BM B HO O q O O BM H O H N N N N N OH O H OO NO S H NH O N F N O HO O q 131 P129624PCT P129624PCT or a pharmaceutically acceptable salt thereof, wherein, q represents a connection number, and q is selected from the group consisting of integers from 1 to 16, and 5 BM is a binding molecule as described in any one of embodiments 1 to 8. 46. The BPC according to embodiment 45, wherein the conjugate is: or a pharmaceutically acceptable salt thereof, wherein, q represents a connection number, and q is selected from the group consisting of integers 10 from 1 to 16. 47. The BPC according to embodiment 46, wherein q is an integer from 4 to 12. 48. The BPC according to embodiment 47, wherein q is an integer from 6 to 10. 49. The BPC according to embodiment 48, wherein q is an integer from 7 to 9. P129624PCT 50. The BPC according to embodiment 49, wherein q is an integer and is 8. 51. The BPC according to any one of embodiments 1 to 31, wherein the BPC comprises a structure shown as formula (II-A): 5 or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein, X1is saturated C, and X1is substituted with Rn; ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated 10 carbocyclyl, wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; 15 L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, - C(O)O-, -NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, - C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 20 R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, - P129624PCT C(O)O-, -NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, - C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, 5 -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, - S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -10 C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1. 52. The BPC according to any one of embodiments 1 to 31, wherein the BPC comprises 15 a structure shown as formula (II-Cx): , or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein L is -La-Lb-Lc-; 20 -La- is selected from the group consisting of: P129624PCT wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - 5 C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, - P(=O)(Rwx)-, -N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 10 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, - P(=O)(Rzx)-, -N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered 15 heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr,20 -N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -25 C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, - 5 C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, - N(H)SO2H and a C1-6aliphatic group. 53. The BPC according to any one of embodiments 1 to 31, wherein the BPC comprises a structure shown as formula (II-Dx): , 10 wherein BM is the binding molecule, q is the connection number and is an integer from 1 to 16; L is -La-Lb-Lc-; -La- is selected from the group consisting of: P129624PCT wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, - 5 P(=O)(Rwx)-, -N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -10 C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, - P(=O)(Rzx)-, -N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or 15 partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, -N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - 20 C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-256aliphatic group; -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, - 5 C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, - N(H)SO2H and a C1-6aliphatic group; wherein, X1is saturated C, and X1is substituted with Rn; ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated 10 carbocyclyl, wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; 15 L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, - C(O)O-, -NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, - C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 20 R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, - C(O)O-, -NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, - C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 25 wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, P129624PCT -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, - S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, 5 tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1. 10 54. The BPC according to any one of embodiments 52 or 53, wherein -La- is selected from the group consisting of: wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers from 2 to 6, and 15 0 or 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)-, - C(O)-, -NRwx- or -O-; wherein yn is selected from the group consisting of integers from 0 to 12, and yp is 0 or 1; wherein zn is selected from the group consisting of integers from 0 to 10, and 0 or 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or - 20 C(O)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each 25 independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, -N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - P129624PCT C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - 5 C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group. 55. The BPC according to any one of embodiments 52 to 54, wherein -Lb- represents a peptide residue consisting of 2 to 7 amino acids, and the peptide residue of -Lb- is a peptide residue formed of amino acids selected from the group consisting of: phenylalanine, glycine, 10 alanine, valine, citrulline, lysine, serine, glutamic acid and aspartic acid. 56. The BPC according to any one of embodiments 52 to 55, wherein -Lc- is selected from the group consisting of: 15 wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, - C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, - N(H)SO2H and a C1-6aliphatic group. 57. The BPC according to embodiment 54, wherein 20 wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; wherein wn is 1, 2, 3 or 6, and 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, -C(O)N(Rwx)- or - C(O)-; P129624PCT wherein yn is 0, 4 or 8, and yp is 0 or 1; wherein zn is 1, 2 or 3, and 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -C(O)N(Rzx)- or -C(O)- ; 5 -Cyr- is 3-10 membered saturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with 1 to 3 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, halogen, -ORr, or a C1-6aliphatic group optionally substituted with Rr; 10 wherein each Rris independently hydrogen, halogen or a C1-6aliphatic group. 58. The BPC according to embodiment 55, wherein -Lb- represents a peptide residue consisting of 2 to 4 amino acids, and the peptide residue of -Lb- is a peptide residue formed of amino acids selected from the group consisting of: phenylalanine, glycine, alanine, valine, citrulline and lysine. 15 59. The BPC according to embodiment 56, wherein -Lc- is selected from the group consisting of: wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, halogen, -OH and a C1-6aliphatic group. 20 60. The BPC according to embodiment 58, wherein -Lb- is selected from the group consisting of:

[0010] P129624PCT 61. The BPC according to embodiment 59, wherein -Lc- is , wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, 5 halogen, -OH and a C1-6aliphatic group. 62. The BPC according to embodiment 57, wherein -La- is . 63. The BPC according to embodiment 60, wherein 64. The BPC according to embodiment 61, wherein -Lc- is . 65. The BPC according to any one of embodiments 62 to 64, wherein -La-Lb-Lc- is 10 66. The BPC according to any one of embodiments 51 to 65, wherein ring A is selected from the group consisting of: 3-10 membered saturated heterocyclyl and 3-10 membered saturated carbocyclyl. 67. The BPC according to embodiment 66, wherein ring A is 3-10 membered saturated 15 carbocyclyl. 68. The BPC according to embodiment 67, wherein ring A is 3-6 membered saturated carbocyclyl. 69. The BPC according to embodiment 68, wherein ring A is 4 membered saturated carbocyclyl. P129624PCT 70. The BPC according to embodiment 68 wherein ring A is 6 membered saturated carbocyclyl. 71. The BPC according to embodiment 66, wherein ring A is 3-10 membered saturated heterocyclyl. 5 72. The BPC according to embodiment 71, wherein ring A is 3-6 membered saturated heterocyclyl. 73. The BPC according to embodiment 72, wherein ring A is 4 membered saturated heterocyclyl. 74. The BPC according to any one of embodiments 51 to 73, wherein ring A is substituted 10 with 0 substituent R1a. 75. The BPC according to embodiment 51, wherein the linker-payload comprises a structure shown as formula (II-Ax): wherein, when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A 15 is substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2. 76. The BPC according to embodiment 75, wherein ring A is substituted with 1 L2. 77. The BPC according to any one of embodiments 51 to 76, wherein m is 0, and L3is a 20 covalent bond. P129624PCT 78. The BPC according to any one of embodiments 51 to 76, wherein m is 2, and L3is - (C(R3a)(R3b))2-. 79. The BPC according to any one of embodiments 51 to 78, wherein n is 0 or 1. 80. The BPC according to embodiment 79, wherein n is 0, and L1is a covalent bond. 5 81. The BPC according to embodiment 79, wherein n is 1, and L1is -C(R5a)(R5b)-. 82. The BPC according to any one of embodiments 51 to 81, wherein 1 methylene unit of L1is replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, -C(O)O-, -NR6-, -O-, -S-, -SO-, - SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, -C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-. 10 83. The BPC according to embodiment 82, wherein 1 methylene unit of L1is replaced by -C(O)-. 84. The BPC according to any one of embodiments 51 to 83, wherein R2is selected from the group consisting of: -O-, -(R2a)N- and -S-. 85. The BPC according to embodiment 84, wherein R2is -O-. 15 86. The BPC according to embodiment 84, wherein R2is -(R2a)N-. 87. The BPC according to embodiment 86, wherein R2ais hydrogen. 88. The BPC according to embodiment 86, wherein R2is -HN-. 89. The BPC according to any one of embodiments 51 to 88, wherein R1ais hydrogen. 90. The BPC according to any one of embodiments 51 to 89, wherein R3aand R3bare each 20 independently hydrogen. 91. The BPC according to any one of embodiments 51 to 90, wherein R4is hydrogen. 92. The BPC according to any one of embodiments 51 to 91, wherein R6is hydrogen. 93. The BPC according to any one of embodiments 51 to 92, wherein R, Raand Rbare each independently hydrogen. 25 94. The BPC according to embodiment 51, wherein the payload is selected from the group consisting of structures: P129624PCT II-A-9 II-A-10 II-A-11 II-A-12. 95. The BPC according to embodiment 94, wherein the payload comprises the structure 96. The BPC according to embodiment 95, wherein the payload has the structure P129624PCT . 97. The BPC according to embodiment 52, wherein the payload-linker moiety has the structure . 5 98. The BPC according to any one of embodiments 1 to 31, wherein the conjugate has the structure represented by formula I: or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein, 10 BM is the binding molecule; P129624PCT 5 each Z is independently selected from a direct bond, a carbon-carbon triple bond, a carbon- carbon double bond, and amido (preferably selected from a direct bond, a carbon- carbon triple bond, and a carbon-carbon double bond); Rx and Ry are each independently selected from H and C1-4 alkyl; each m is independently selected from 0, 1, 2, 3, 4, 5 and 6; 10 y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 15 (such as 6-15); each y3 is independently selected from 1, 2, and 3; each y4 is independently selected from 0 and 1; position 1 is attached to BM via an S atom, and position 2 is attached to L2or L3; 15 P129624PCT y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 10 (such as 6-10); each y3 is independently selected from 1 or 2; each y4 is independently selected from 0 and 1, position 1 is attached to L1, and position 2 5 is attached to L3; L3is selected from an amino acid residue or a short peptide consisting of 2-10 amino acid residues; the amino acid residue is selected from natural amino acid residues, non- natural amino acid residues, or selected from amino acid residue represented by AA1or stereoisomer thereof; 10 AA1; in the amino acid residue represented by AA1, any one of Raand Rbis H, and Rb, together with the carbon atom to which they are both attached, form a 5-6 membered heterocyclic ring, and said 5-6 membered heterocyclic ring is piperidine ring or piperazine ring. 15 r, r1, r1aand r1bare each independently 0, 1, 2, 3, 4 or 5; Rm1, Rn1, Rm1a, Rn1a, Rm1band Rn1bare each independently H, C1-6alkyl or -COORx1, wherein, Rx1is C1-6alkyl; or, Rm1and Rn1, Rm1aand Rn1a, and Rm1band Rn1b, together with the nitrogen atom to which they are both attached, form a 5-6 membered heterocyclic ring, and of said 5-6 20 membered heterocyclic ring, the heteroatom is selected from 1 or 2 N atoms; the said 5-6 membered heterocyclic ring is optionally substituted with one or more R0’; Rzis selected from C1-6alkyl; R0and R0’are each independently selected from C1-6alkyl, -NRm2Rn2or 5-6 membered heterocyclyl optionally substituted with C1-6alkyl; of said 5-6 membered heterocyclyl, 25 the heteroatom is selected from 1 or 2 N atoms; P129624PCT Rm2and Rn2are each independently selected from H and C1-6alkyl; 5 position 2 is attached to W; R1and R2are each independently selected from H, halogens and C1-4 alkyl; or, R1and R2, together with the carbon atom to which they are both attached form a 5-6 membered heterocyclic ring, the heterocyclic ring contains 1, 2, or 3 of O, S, or N or any 10 combination thereof; R3is selected from H and C1-4alkyl; or R3and X, together with the carbon atom to which they are both attached, form a 5-6 membered carbon ring; W is absent or present, when W is present, W is selected from -O-, -S-, -NR4-, and , position 1 is attached to X, and position 2 is attached to L4or L3; 15 X is selected from optionally substituted -(CH2)n1- position 1 is attached to the parent ring and position 2 is attached to W or L4; the substituent is selected from one or two C1-4 alkyls; R4, R5, and R7are each independently selected from H and C1-4 alkyl; n, n1, n2, n3 are each independently selected from any integer between 0 and 6. P129624PCT 5 100. The BPC according to embodiment 99, wherein L1is , 101. The BPC according to embodiment 98 or 99, wherein Z is selected from a direct bond, a carbon-carbon triple bond, and a carbon-carbon double bond. 102. The BPC according to embodiment 101, wherein Z is a carbon-carbon triple bond. 103. The BPC according to any one of embodiments 98 to 102, wherein Rx is H or methyl. 10 104. The BPC according to embodiment 103, wherein Rx is H. 105. The BPC according to any one of embodiments 98 to 104, wherein Ry is H or methyl. 106. The BPC according to embodiment 105, wherein Ry is H. 107. The BPC according to any one of embodiments 98 to 106, wherein m is 2, 3 or 4. 108. The BPC according to embodiment 107, wherein m is 3. 15 109. The BPC according to any one of embodiments 98 to 108, wherein L2is absent. 110. The BPC according to any one of embodiments 98 to 109, wherein L3is selected from AA1, AA1-Gly, Val-Cit, Val-Ala, Val-AA1, Val-AA1-Gly, AA1-Ala-Asn, Ala-Ala-Ala, Ala-Ala-Asn and Gly-Gly-Phe-Gly. 111. The BPC according to embodiment 110, wherein L3is selected from AA1, AA1-Gly, Val- 20 Cit, Val-AA1-Gly, AA1-Ala-Asn and Gly-Gly-Phe-Gly. P129624PCT 112. The BPC according to embodiment 111, wherein L3is Val-AA1-Gly. 113. The BPC according to any one of embodiments 110 to 112, wherein the amino acid , 5 114. The BPC according to embodiment 113, wherein the amino acid residue represented . 115. The BPC according to any one of embodiments 98 to 114, wherein L4is selected from 1 N 2 116. The BPC according to embodiment 115, wherein L4is H . 10 117. The BPC according to any one of embodiments 98 to 116, wherein W is O. 118. The BPC according to embodiment 117, wherein X is -(CH2)n1-. 119. The BPC according to any one of embodiments 98 to 118, wherein n1 is 2, 3 or 4. 120. The BPC according to embodiment 119, wherein n1 is 3. 121. The BPC according to any one of embodiments 98 to 120, wherein the structure 15 P129624PCT wherein position 1 is attached to the connecting atom on the binding molecule and position 2 is attached to W. 122. The BPC according to any one of embodiments 98 to 121, wherein the structural is 5 attached to L4. 123. The BPC according to any one of embodiments 98 to 122, wherein the structural 124. The BPC according to any one of embodiments 98 to 123, wherein the linker-payload comprises the structure: 10 125. The BPC according to embodiment 98, wherein the conjugate is selected from the group consisting of: P129624PCT or a pharmaceutically acceptable salt thereof wherein, BM is the binding molecule of any one of embodiments 1 to 31; and q represents a connection number, and q is selected from the group consisting of integers from 1 to 16. 5 126. The BPC according to embodiment 98 wherein the conjugate is or a pharmaceutically acceptable salt thereof wherein BM is the binding molecule of any one of embodiments 1 to 31; and P129624PCT q represents a connection number, and q is selected from the group consisting of integers from 1 to 16. 127. The BPC according to embodiment 125 or 126, wherein q is an integer from 4 to 12. 128. The BPC according to embodiment 127, wherein q is an integer from 6 to 10. 5 129. The BPC according to embodiment 128, wherein q is an integer from 7 to 9. 130. The BPC according to embodiment 129, wherein q is an integer and is 8. 131. An antibody comprising: a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering 10 scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 4, LCDR2 comprises an amino acid sequence 15 according to SEQ ID NO: 5, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and b) a modified Fc region. 132. An antibody comprising: 20 a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Kabat numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 15, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 16, HCDR3 comprises 25 an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises one, two or three amino acid mutations relative to the recited sequences; and 30 b) a modified Fc region. 133. An antibody comprising: P129624PCT a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the Chothia numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 20, HCDR2 5 comprises an amino acid sequence according to SEQ ID NO: 21, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 17, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 18, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 19, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of the CDRs comprises 10 one, two or three amino acid mutations relative to the recited sequences; and b) a modified Fc region. 134. The antibody according to any one of embodiments 131 to 133, wherein the antibody comprises a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID NO: 7 or a variant having at least 80% sequence identity thereto. 15 135. The antibody according to any one of embodiments 131 to 134, wherein the antibody comprises a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8 or a variant having at least 80% sequence identity thereto. 136. The antibody according to any one of embodiments 131 to 135, wherein the binding of the Fc region to FcγRI is reduced compared to a wild-type Fc region. 20 137. The antibody according to any one of embodiments 131 to 136, wherein the Fc region comprises an amino acid substitution at position 234, or an amino acid substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme. 25 138. The antibody according to embodiment 137, wherein the one or more amino acid substitution(s) are selected from the group consisting of: a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); b) L234A, L235A, and K322A (LALA-KA); c) L234S, L235T, and G236R (STR); and 30 d) L234A and L235A (LALA). 139. The antibody according to any one of embodiments 131 to 138, wherein the antibody comprises a heavy chain, wherein the heavy chain comprises an amino acid sequence P129624PCT according to SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 or SEQ ID NO: 14, or a variant having at least 80% sequence identity thereto. 140. The antibody according to any one of embodiments 131 to 139, wherein the antibody comprises a light chain, wherein the light chain comprises an amino acid sequence according 5 to SEQ ID NO: 9, or a variant having at least 80% sequence identity thereto. 141. A method for producing a BPC according to any one of embodiments 7 to 11 or 13 to 14, comprising contacting an antibody according to any one of embodiments 131 to 140 with a suitable linker-payload compound. 142. A method according to embodiment 141, wherein the linker-payload compound is of 10 the general formula (II-Fx): , wherein, Lxis Lax-Lb-Lc-; Lax- is selected from the group consisting of: 15 wherein Rhalis iodine or bromine; wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp-, and Z is -(C(Rza)(Rzb))zn; P129624PCT wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, - P(=O)(Rwx)-, -N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or - 5 C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, - C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, -10 P(=O)(Rzx)-, -N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently 15 substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, -N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group 20 optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; 25 -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, - 5 C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, - N(H)SO2H and a C1-6aliphatic group; wherein, X1is saturated C, and X1is substituted with Rn; ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated 10 carbocyclyl, wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; 15 L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, - C(O)O-, -NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, - C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 20 R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, - C(O)O-, -NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, - C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; 25 wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, P129624PCT -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, - S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, 5 tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1. 10 143. A method according to embodiment 141, wherein the linker-payload compound is of the general formula (III-F): ,wherein, Lxis Lax-Lb-Lc-; 15 Lax- is selected from the group consisting of: wherein Rhalis iodine or bromine; P129624PCT wherein W is -(C(Rwa)(Rwb))wn-, Y is -(OCH2CH2)yn-Oyp, and Z is -(C(Rza)(Rzb))zn; wherein wn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of W is independently replaced by -Cyr-, -N(Rwx)C(O)-, - C(O)N(Rwx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRwx-, -O-, -S-, -SO-, -SO2-, -P(Rwx)-, - 5 P(=O)(Rwx)-, -N(Rwx)SO2-, -SO2N(Rwx)-, -C(=S)-, -C(=NRwx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; wherein yn is selected from the group consisting of integers ≥ 0, and yp is 0 or 1; wherein zn is selected from the group consisting of integers ≥ 0, and 0 or at least 1 methylene unit of Z is independently replaced by -Cyr-, -N(Rzx)C(O)-, -10 C(O)N(Rzx)-, -C(O)-, -OC(O)-, -C(O)O-, -NRzx-, -O-, -S-, -SO-, -SO2-, -P(Rzx)-, - P(=O)(Rzx)-, -N(Rzx)SO2-, -SO2N(Rzx)-, -C(=S)-, -C(=NRzx)-, -N=N-, -C=N-, -N=C- or - C(=N2)-; -Cyr- is selected from the group consisting of: 6-10 membered arylene, 5-8 membered heteroarylene, 3-10 membered heterocyclylene and 3-10 membered saturated or 15 partially unsaturated carbocyclylene, wherein -Cyr- is unsubstituted or independently substituted with at least 1 substituent Rcx; wherein each Rwa, each Rwb, each Rza, each Rzb, each Rwx, each Rzxand each Rcxare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -ORr, -SRr, -N(Rra)(Rrb), -C(O)Rr, -CO2Rr, -C(O)C(O)Rr, -C(O)CH2C(O)Rr, -S(O)Rr, -S(O)2Rr, - 20 C(O)N(Rra)(Rrb), -SO2N(Rra)(Rrb), -OC(O)Rr, -N(R)SO2Rr, or a C1-6aliphatic group optionally substituted with Rr; wherein each Rr, each Rraand each Rrbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-256aliphatic group; -Lb- represents a peptide residue consisting of 2 to 7 amino acids; -Lc- is selected from the group consisting of: P129624PCT wherein RL1and RL2are each independently selected from the group consisting of: hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, - 5 C(O)C(O)H, -C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, - N(H)SO2H and a C1-6aliphatic group; wherein R1is selected from the group consisting of: -O-, -(R2)N-, -P(=O)(R2)- and -S-; X is -L1-CH2-C(O)-; L1is -(C(R3a)(R3b))m-, wherein 0 or at least 1 methylene unit of L1is independently replaced by 10 -C(O)-, -C(=S)-, -C(=NR4b)- or -C(=N2)-; wherein each R2, each R3a, each R3band each R4bare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, - C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, -S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), - OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; 15 wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m is selected from the group consisting of integers ≥ 0, and n is selected from the group 20 consisting of integers ≥ 1; when R1is -O- or -HN-, at least 1 methylene unit of L1is independently replaced by -C(O)-, - C(=S)-, -C(=NR4b)- or -C(=N2)-, or each R3aand each R3bare not both hydrogen. 144. The method according to embodiment 142 or 143, wherein Lax- is . 145. The method according to embodiment 142 or 143, wherein Lax-Lb-Lc- is selected from the 25 group consisting of: P129624PCT . 146. The method according to embodiment 142 wherein the linker-payload compound is of the formula: . 5 147. The method according to embodiment 143 wherein the linker-payload compound is of the formula: . 148. A method according to embodiment 141 wherein the linker-payload compound is of the formula P129624PCT wherein, LG is a leaving group; 5 each Z is independently selected from a direct bond, a carbon-carbon triple bond, a carbon- carbon double bond, and amido (preferably selected from a direct bond, a carbon- 10 carbon triple bond, and a carbon-carbon double bond); Rx and Ry are each independently selected from H and C1-4 alkyl; each m is independently selected from 0, 1, 2, 3, 4, 5 and 6; y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 15 (such as 6-15); 15 each y3 is independently selected from 1, 2, and 3; P129624PCT each y4 is independently selected from 0 and 1; position 1 is attached to LG, and position 2 is attached to L2or L3; 5 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 10 (such as 6-10); each y3 is independently selected from 1 or 2; each y4 is independently selected from 0 and 1, position 1 is attached to L1, and position 2 10 is attached to L3; L3is selected from an amino acid residue or a short peptide consisting of 2-10 amino acid residues; the amino acid residue is selected from natural amino acid residues, non- natural amino acid residues, or selected from amino acid residue represented by AA1or stereoisomer thereof; 15 ; in the amino acid residue represented by AA1, any one of Raand Rbis H, and Rb, together with the carbon atom to which they are both attached, form a 5-6 membered heterocyclic ring, and said 5-6 membered heterocyclic ring is piperidine ring or piperazine ring. 20 r, r1, r1aand r1bare each independently 0, 1, 2, 3, 4 or 5; Rm1, Rn1, Rm1a, Rn1a, Rm1band Rn1bare each independently H, C1-6alkyl or -COORx1, wherein, Rx1is C1-6alkyl; P129624PCT or, Rm1and Rn1, Rm1aand Rn1a, and Rm1band Rn1b, together with the nitrogen atom to which they are both attached, form a 5-6 membered heterocyclic ring, and of said 5-6 membered heterocyclic ring, the heteroatom is selected from 1 or 2 N atoms; the said 5-6 membered heterocyclic ring is optionally substituted with one or more R0’; 5 Rzis selected from C1-6alkyl; R0and R0’are each independently selected from C1-6alkyl, -NRm2Rn2or 5-6 membered heterocyclyl optionally substituted with C1-6alkyl; of said 5-6 membered heterocyclyl, the heteroatom is selected from 1 or 2 N atoms; Rm2and Rn2are each independently selected from H and C1-6alkyl; 10 position 2 is attached to W; 15 R1and R2are each independently selected from H, halogens and C1-4 alkyl; or, R1and R2, together with the carbon atom to which they are both attached form a 5-6 membered heterocyclic ring, the heterocyclic ring contains 1, 2, or 3 of O, S, or N or any combination thereof; R3is selected from H and C1-4alkyl; or R3and X, together with the carbon atom to which they 20 are both attached, form a 5-6 membered carbon ring; W is absent or present, when W is present, W is selected from -O-, -S-, -NR4-, and , position 1 is attached to X, and position 2 is attached to L4or L3; P129624PCT X is selected from optionally substituted -(CH2)n1- position 1 is attached to the parent ring and position 2 is attached to W or L4; the substituent is selected from one or two C1-4 alkyls; R4, R5, and R7are each independently selected from H and C1-4 alkyl; 5 n, n1, n2, n3 are each independently selected from any integer between 0 and 6. 149. A method according to embodiment 148, wherein LG is selected from halogen, sulfone group, a tertiary amine salt group diazonium salt group, -OMs, MeSO2-, and CF3SO3-. 150. A method according to embodiment 149, wherein LG is selected from F, Cl and MeSO2- and the tertiary amine salt group is selected from Me3N+ and Et3N+. 10 151. A method according to embodiment 149, wherein LG is selected from F and MeSO2-. 152. A method according to embodiment 148, wherein the linker-payload compound is of the formula: 153. One or more nucleic acid sequence(s) encoding a binding molecule as defined in any 15 one of embodiments 1 to 14 or an antibody according to any one of embodiments 131 to 140; optionally wherein the one or more nucleic acid sequence(s) is an RNA sequence. 154. A vector comprising the one or more nucleic acid sequences(s) according to embodiment 153. 155. A cell comprising the one or more nucleic acid sequence(s) according to embodiment 20 153, the vector according to embodiment 154, the binding molecule as defined in any one of embodiments 1 to 14, the BPC according to any one of embodiments 1 to 130, or the antibody P129624PCT according to any one of embodiments 131 to 140; optionally, wherein the cell is capable of expressing the binding molecule as defined in any one of embodiments 1 to 14 or the antibody according to any one of embodiments 131 to 140. 156. A composition comprising the BPC according to any one of embodiments 1 to 130 or 5 the antibody according to any one of embodiments 131 to 140, together with a pharmaceutically acceptable carrier, diluent or excipient. 157. An in vitro method comprising contacting a cell with the BPC according to any one of embodiments 1 to 130 or the antibody according to any one of embodiments 131 to 140. 158. A method of treating or diagnosing a disease, comprising administering the BPC 10 according to any one of embodiments 1 to 130, the antibody according to any one of embodiments 131 to 140, or the composition according to embodiment 156 to a subject. 159. The BPC according to any one of embodiments 1 to 130, the antibody according to any one of embodiments 131 to 140, or the composition according to embodiment 156 for use as a medicament. 15 160. The BPC according to any one of embodiments 1 to 130, the antibody according to any one of embodiments 131 to 140, or the composition according to embodiment 156 for use in a method of therapy or a diagnostic method. 161. The BPC, antibody, or composition for use according to embodiment 160, wherein the method is a method of treating, preventing or diagnosing cancer. 20 162. The BPC, antibody, or composition for use according to embodiment 161, wherein the cancer expresses CA19-9; optionally wherein the expression of CA19-9 is increased compared to the expression of CA19-9 by the same non-cancerous tissue or cells. 163. The BPC, antibody, or composition for use according to embodiment 160 or embodiment 161, wherein the cancer is gastrointestinal cancer, pancreatic cancer, ovarian 25 cancer, colorectal cancer, stomach cancer, oesophageal cancer, endometrial cancer, breast cancer, bile duct carcinoma, transitional cell carcinoma, or hepatocellular carcinoma; preferably wherein the cancer is pancreatic ductal adenocarcinoma (PDAC). 164. A kit comprising a BPC according to any one of embodiments 1 to 130, an antibody according to any one of embodiments 131 to 140, or a composition according to embodiment 30 156. 165. An ADC comprising a binding molecule and one or more payload-linker moieties; P129624PCT wherein: a) the binding molecule is an antibody comprising a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 10 and the light chain comprises an amino acid sequence according to SEQ ID NO: 9; 5 and b) the one or more payload-linker moieties have the structure: 166. An ADC comprising a binding molecule and one or more payload-linker moieties; wherein: 10 a) the binding molecule is an antibody comprising a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 13 and the light chain comprises an amino acid sequence according to SEQ ID NO: 9; and b) the one or more payload-linker moieties have the structure: 15 . 167. An ADC comprising a binding molecule and one or more payload-linker moieties; wherein: a) the binding molecule is an antibody comprising a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: P129624PCT 10 and the light chain comprises an amino acid sequence according to SEQ ID NO: 9; and b) the one or more payload-linker moieties have the structure: . 5 168. An ADC comprising a binding molecule and one or more payload-linker moieties; wherein: a) the binding molecule is an antibody comprising a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 10 and the light chain comprises an amino acid sequence according to SEQ ID NO: 9; 10 and b) the one or more payload-linker moieties have the structure: . 169. A binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: P129624PCT a) the binding molecule is an antibody or a fragment thereof and comprises heavy chain complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein the binding molecule specifically binds to CA19-9; and 5 b) the one or more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. 170. The BPC according to embodiment 169, wherein at least one of HCDRs 1-3 and / or LCDRs 1-3 is selected from: a) HCDR1 comprising an amino acid sequence according to SEQ ID NO: 1, 10 b) HCDR2 comprising an amino acid sequence according to SEQ ID NO: 2, c) HCDR3 comprising an amino acid sequence according to SEQ ID NO: 3, d) LCDR1 comprising an amino acid sequence according to SEQ ID NO: 4, e) LCDR2 comprising an amino acid sequence according to SEQ ID NO: 5, and f) LCDR3 comprisng an amino acid sequence according to SEQ ID NO: 6; 15 optionally wherein the at least one of HCDRs 1-3 and / or LCDRs 1-3 comprises one, two or three amino acid mutations relative to the recited sequences.

Claims

P129624PCT CLAIMS 1. A binding molecule-payload conjugate (BPC) comprising a binding molecule and one or more payload moieties; wherein: c) the binding molecule is an antibody or a fragment thereof and comprises heavy chain 5 complementarity determining regions (HCDRs) 1-3 and light chain complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein the binding molecule specifically binds to CA19-9; and d) the one or more payload moieties is covalently linked to the binding molecule, optionally via one or more linkers. 10 2. The BPC according to claim 1, wherein at least one of HCDRs 1-3 and / or LCDRs 1-3 is selected from: g) HCDR1 comprising an amino acid sequence according to SEQ ID NO: 1, h) HCDR2 comprising an amino acid sequence according to SEQ ID NO: 2, i) HCDR3 comprising an amino acid sequence according to SEQ ID NO: 3, 15 j) LCDR1 comprising an amino acid sequence according to SEQ ID NO: 4, k) LCDR2 comprising an amino acid sequence according to SEQ ID NO: 5, and l) LCDR3 comprisng an amino acid sequence according to SEQ ID NO: 6; optionally wherein the at least one of HCDRs 1-3 and / or LCDRs 1-3 comprises one, two or three amino acid mutations relative to the recited sequences. 20 3. The BPC according to claim 1 or claim 2, wherein: a) HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, LCDR1 comprises an amino acid sequence according to SEQ ID NO: 4, LCDR2 comprises an amino acid sequence 25 according to SEQ ID NO: 5, and LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of HCDRs 1-3 and / or LCDRs 1-3 comprises one, two or three amino acid mutations relative to the recited sequences; and b) the one or more payload moieties is covalently linked to the binding molecule, 30 optionally via one or more linkers; optionally wherein the binding molecule comprises a heavy chain variable region (VH) comprising anP129624PCT amino acid sequence according to SEQ ID NO: 7 or a variant having at least 80% sequence identity thereto, and / or wherein the binding molecule comprises a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8 or a variant having at least 80% sequence identity 5 thereto.

4. The BPC according to any one of claims 1 to 3, wherein the binding molecule further comprises an Fc region; optionally wherein the Fc region is a modified Fc region; optionally wherein the Fc region comprises an amino acid substitution at position 234, or an amino acid 10 substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme; optionally wherein the one or more amino acid substitution(s) are selected from the group consisting of: a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); 15 b) L234A, L235A, and K322A (LALA-KA); c) L234S, L235T, and G236R (STR); and d) L234A and L235A (LALA).

5. The BPC according to any one of claims 1 to 4, which is an antibody drug conjugate (ADC), wherein the binding molecule comprises a heavy chain and a light chain; optionally 20 wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 10, or a variant having at least 80% sequence identity thereto, or wherein the heavy chain comprises an amino acid sequence according to SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 or SEQ ID NO: 14, or a variant having at least 80% sequence identity thereto; optionally wherein the light chain comprises an amino acid sequence according to SEQ ID NO: 9, or a 25 variant having at least 80% sequence identity thereto.

6. The BPC according to any one of the preceding claims, wherein the linker comprises or is a peptide linker; optionally wherein the linker comprises a first conjugation moiety for coupling with the binding molecule, optionally wherein the linker comprises a second conjugation moiety for coupling with the 30 payload moiety; optionallyP129624PCT wherein the linker comprises a peptide linker selected from AA1, AA1-Gly, Val-Cit, Val-Ala, Val- AA1, Val-AA1-Gly, AA1-Ala-Asn, Ala-Ala-Ala, Ala-Ala-Asn and Gly-Gly-Phe-Gly, optionally 5optionally wherein the first conjugation moiety comprises a pyrimidine-sulfone moiety, optionally wherein the pyrimidine-sulfone moiety is linked to the peptide moiety via a C1-10 alkynoyl group, or 10 wherein the first conjugation moiety comprises a maleimide moiety which is capable of adding to a sulfhydryl moiety on the binding molecule such that the conjugate comprises a sulfur- linked succinimidyl group, optionally wherein the maleimide moiety is linked to the peptide moiety via a C1-10 alkanoyl group.

7. The BPC according to any one of the preceding claims, wherein the payload moiety is 15 selected from a drug, a detectable marker, a radioisotope, a fluorescent agent, a luminescent agent, a colored agent, an enzyme, polyethylene glycol, a nuclide, a nucleic acid, a small molecule toxin, a polypeptide having binding activity, a protein, a receptor, a ligand, anotherP129624PCT active agent that inhibits tumor cell growth, promotes tumor cell apoptosis or necrosis; optionally wherein the payload moiety is a drug; optionally wherein the payload moiety is a cytotoxic drug, immune modulator, or a STING inhibitor. 5 8. The BPC according to any one of the preceding claims, wherein the payload or payload-linker comprises a structure shown as formula (III-A):or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein 10 R1is selected from the group consisting of: -O-, -(R2)N-, -P(=O)(R2)- and -S-; X is -L1-CH2-C(O)-; L1is -(C(R3a)(R3b))m-, wherein 0 or at least 1 methylene unit of L1is independently replaced by -C(O)-, -C(=S)-, -C(=NR4b)- or -C(=N2)-; wherein each R2, each R3a, each R3band each R4bare each independently hydrogen, protium,15 deuterium, tritium, halogen, -NO2, -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, - C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, -S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), - OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Ra and each Rb are each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, - 20 C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m is selected from the group consisting of integers ≥ 0,P129624PCT when R1is -O- or -HN-, at least 1 methylene unit of L1is independently replaced by -C(O)-, - C(=S)-, -C(=NR4b)- or -C(=N2)-, or each R3aand each R3bare not both hydrogen.

9. The BPC according to claim 8, wherein the payload-linker moiety of the conjugate has the following structure:

5.

10. The BPC according to any one of claims 1 to 7, wherein the payload-linker comprises a structure shown as formula (II-A):or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a 10 pharmaceutically acceptable salt thereof, wherein, X1is saturated C, and X1is substituted with Rn;P129624PCT ring A is selected from the group consisting of: 3-10 membered saturated or partially unsaturated heterocyclyl and 3-10 membered saturated or partially unsaturated carbocyclyl, wherein ring A is substituted with 0 or at least 1 substituent R1a; when ring A is 3-10 membered saturated or partially unsaturated carbocyclyl, ring A is 5 substituted with p L2, and L2is not Rn; or, when ring A is 3-10 membered saturated or partially unsaturated heterocyclyl, ring A is substituted with p L2; L2is -R2-L3-, and R2is used for direct or indirect linking of a ligand; L3is -(C(R3a)(R3b))m-, wherein when L3comprises a methylene unit, 0 or at least 1 methylene10 unit of L3is independently replaced by -N(R4)C(O)-, -C(O)N(R4)-, -C(O)-, -OC(O)-, - C(O)O-, -NR4-, -O-, -S-, -SO-, -SO2-, -P(R4)-, -P(=O)(R4)-, -N(R4)SO2-, -SO2N(R4)-, - C(=S)-, -C(=NR4)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; R2is selected from the group consisting of: -O-, -(R2a)N-, -S- and -P(=O)(R2a)-; L1is -(C(R5a)(R5b))n-, wherein when L1comprises a methylene unit, 0 or at least 1 methylene15 unit of L1is independently replaced by -N(R6)C(O)-, -C(O)N(R6)-, -C(O)-, -OC(O)-, - C(O)O-, -NR6-, -O-, -S-, -SO-, -SO2-, -P(R6)-, -P(=O)(R6)-, -N(R6)SO2-, -SO2N(R6)-, - C(=S)-, -C(=NR6)-, -N=N-, -C=N-, -N=C- or -C(=N2)-; wherein each R1a, each R2a, each R3a, each R3b, each R4, each R5a, each R5b, each R6and each Rnare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2,20 -CN, -OR, -SR, -N(Ra)(Rb), -C(O)R, -CO2R, -C(O)C(O)R, -C(O)CH2C(O)R, -S(O)R, - S(O)2R, -C(O)N(Ra)(Rb), -SO2N(Ra)(Rb), -OC(O)R, -N(R)SO2R, or a C1-6aliphatic group optionally substituted with R; wherein each R, each Raand each Rbare each independently hydrogen, protium, deuterium, tritium, halogen, -NO2, -CN, -OH, -SH, -NH2, -C(O)H, -CO2H, -C(O)C(O)H, -25 C(O)CH2C(O)H, -S(O)H, -S(O)2H, -C(O)NH2, -SO2NH2, -OC(O)H, -N(H)SO2H or a C1-6aliphatic group; m and n are each independently selected from the group consisting of integers ≥ 0, and p is an integer ≥ 1.

11. The BPC according to claim 10, wherein the payload-linker moiety has the structureP129624PCT.

12. The BPC according to any one of claims 1 to 7, wherein the conjugate has the structure represented by formula I:5 or a tautomer, a mesomer, a racemate, an enantiomer or a diastereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein, BM is the binding molecule;P129624PCTeach Z is independently selected from a direct bond, a carbon-carbon triple bond, a carbon- carbon double bond, and amido (preferably selected from a direct bond, a carbon- 5 carbon triple bond, and a carbon-carbon double bond); Rx and Ry are each independently selected from H and C1-4 alkyl; each m is independently selected from 0, 1, 2, 3, 4, 5 and 6; y1 is selected from any integer between 1 and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 15 (such as 6-15); 10 each y3 is independently selected from 1, 2, and 3; each y4 is independently selected from 0 and 1; position 1 is attached to BM via an S atom, and position 2 is attached to L2or L3; 15and 6 (such as 4, 5, and 6); each y2 is independently selected from any integer between 0 and 10 (such as 6-10); each y3 is independently selected from 1 or 2; each y4 is independently selected from 0 and 1, position 1 is attached to L1, and position 2 20 is attached to L3;P129624PCT L3is selected from an amino acid residue or a short peptide consisting of 2-10 amino acid residues; the amino acid residue is selected from natural amino acid residues, non- natural amino acid residues, or selected from amino acid residue represented by AA1or stereoisomer thereof; 5; in the amino acid residue represented by AA1, any one of Raand Rbis H,and Rb, together with the carbon atom to which they are both attached, form a 5-6 membered heterocyclic ring, and said 5-6 membered heterocyclic ring is piperidine ring or piperazine ring. 10 r, r1, r1aand r1bare each independently 0, 1, 2, 3, 4 or 5; Rm1, Rn1, Rm1a, Rn1a, Rm1band Rn1bare each independently H, C1-6alkyl or -COORx1, wherein, Rx1is C1-6alkyl; or, Rm1and Rn1, Rm1aand Rn1a, and Rm1band Rn1b, together with the nitrogen atom to which they are both attached, form a 5-6 membered heterocyclic ring, and of said 5-6 15 membered heterocyclic ring, the heteroatom is selected from 1 or 2 N atoms; the said 5-6 membered heterocyclic ring is optionally substituted with one or more R0’; Rzis selected from C1-6alkyl; R0and R0’are each independently selected from C1-6alkyl, -NRm2Rn2or 5-6 membered heterocyclyl optionally substituted with C1-6alkyl; of said 5-6 membered heterocyclyl, 20 the heteroatom is selected from 1 or 2 N atoms; Rm2and Rn2are each independently selected from H and C1-6alkyl;P129624PCTposition 2 is attached to W; R1and R2are each independently selected from H, halogens and C1-4 alkyl; or, R1and R2, 5 together with the carbon atom to which they are both attached form a 5-6 membered heterocyclic ring, the heterocyclic ring contains 1, 2, or 3 of O, S, or N or any combination thereof; R3is selected from H and C1-4alkyl; or R3and X, together with the carbon atom to which they are both attached, form a 5-6 membered carbon ring; O 10 W is absent or present, when W is present, W is selected from -O-, -S-, -NR4-,and, position 1 is attached to X, and position 2 is attached to L4or L3; X is selected from optionally substituted -(CH2)n1-position 1 is attached to the parent ring and position 2 is attached to W or L4; the substituent is selected from one or two C1-4 alkyls; 15 R4, R5, and R7are each independently selected from H and C1-4 alkyl; n, n1, n2, n3 are each independently selected from any integer between 0 and 6.P129624PCT 13. The BPC according to claim 12, wherein the linker-payload moiety comprises the structure:

14. An antibody comprising: a) heavy chain complementarity determining regions (HCDRs) 1-3 and light chain 5 complementarity determining regions (LCDRs) 1-3 according to the IMGT numbering scheme, wherein: HCDR1 comprises an amino acid sequence according to SEQ ID NO: 1, HCDR2 comprises an amino acid sequence according to SEQ ID NO: 2, HCDR3 comprises an amino acid sequence according to SEQ ID NO: 3, LCDR1 comprises an amino acid 10 sequence according to SEQ ID NO: 4, LCDR2 comprises an amino acid sequence according to SEQ ID NO: 5, LCDR3 comprises an amino acid sequence according to SEQ ID NO: 6, optionally wherein one or more of HCDRs 1-3 and / or LCDRs 1-3 comprises one, two or three amino acid mutations relative to the recited sequences; and 15 b) a modified Fc region; optionally wherein the antibody comprises a heavy chain variable region (VH) comprising an amino acid sequence according to SEQ ID NO: 7 or a variant having at least 80% sequence identity thereto, and / or wherein the antibody comprises a light chain variable region (VL) comprising an amino acid sequence according to SEQ ID NO: 8 or a variant having at least 80% sequence 20 identity thereto; optionally wherein the Fc region comprises an amino acid substitution at position 234, or an amino acid substitution at position 235, or an amino acid substitution at position 236, or an amino acid substitution at positions 234 and 235, or an amino acid substitution at positions 234, 235 and 236, according to the EU numbering scheme; optionally 25 wherein the one or more amino acid substitution(s) are selected from the group consisting of:P129624PCT a) L234A, L235A, A327G, A330S, and P331S (LALA-∆A); b) L234A, L235A, and K322A (LALA-KA); c) L234S, L235T, and G236R (STR); and d) L234A and L235A (LALA). 5 15. A method for producing a BPC according to any one of claims 1 to 13, comprising contacting an antibody according to claim 14 with a suitable linker-payload compound.

16. One or more nucleic acid sequence(s) encoding a binding molecule as defined in any one of claims 1 to 5 or an antibody according claim 14; optionally wherein the one or more nucleic acid sequence(s) is an RNA sequence. 10 17. The BPC according to any one of embodiments claims 1 to 13 or the antibody according to claim 14, for use in a method of therapy or a diagnostic method; optionally wherein the method is a method of treating, preventing or diagnosing cancer; optionally wherein the cancer expresses CA19-9; optionally wherein the cancer is gastrointestinal cancer, pancreatic cancer, ovarian cancer, colorectal 15 cancer, stomach cancer, oesophageal cancer, endometrial cancer, breast cancer, bile duct carcinoma, transitional cell carcinoma, or hepatocellular carcinoma; preferably wherein the cancer is pancreatic ductal adenocarcinoma (PDAC).

Images